Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_480.133.495ON1571578221e-114
TPHA0D042603.495ON1581555032e-65
TDEL0D056303.495ON1501494536e-58
NCAS0E007803.495ON1711604131e-51
NDAI0G009103.495ON1631574112e-51
KLTH0F14894g3.495ON1661544112e-51
ZYRO0D09878g3.495ON1531534008e-50
YGR133W (PEX4)3.495ON1831573862e-47
Kwal_55.212463.495ON1601543834e-47
SAKL0F02706g3.495ON1611573755e-46
Smik_6.2293.495ON1651583756e-46
Suva_7.4213.495ON1651583731e-45
TBLA0C045003.495ON1651523722e-45
Skud_7.4443.495ON1621573633e-44
KAFR0C019903.495ON1511533554e-43
CAGL0I10450g3.495ON1621563419e-41
AFR314W3.495ON1551533287e-39
KNAG0B007803.495ON1531543224e-38
Ecym_12343.495ON1611513096e-36
KLLA0E04027g3.495ON1581522618e-29
CAGL0E04752g3.308ON1471362303e-24
NDAI0A054903.308ON1471362287e-24
KAFR0C002703.308ON1471442233e-23
KLTH0E14300g3.308ON1471362233e-23
SAKL0B06512g3.308ON1471362233e-23
AER173C3.308ON1471362233e-23
Ecym_74313.308ON1471362234e-23
NCAS0A108003.308ON1481352216e-23
TDEL0F021003.308ON1471362209e-23
Skud_4.4418.375ON2151302241e-22
ZYRO0G12870g3.308ON1471362201e-22
Suva_2.3438.375ON2151302241e-22
Smik_4.4258.375ON2151302241e-22
YDR177W (UBC1)8.375ON2151302241e-22
Suva_2.2183.308ON1481352182e-22
Skud_4.3143.308ON1481352182e-22
YDR059C (UBC5)3.308ON1481352182e-22
ADR169C8.375ON2111302222e-22
Ecym_60388.375ON2111292222e-22
Smik_4.2973.308ON1481352173e-22
CAGL0E00671g8.375ON2131302213e-22
TBLA0I021303.308ON1481352156e-22
KNAG0J023403.308ON1611292158e-22
ZYRO0C03784g8.375ON2181302181e-21
Kpol_1030.108.375ON2151302181e-21
TPHA0A038503.308ON1481352122e-21
Kpol_1052.23.308ON1481352122e-21
KLLA0E12563g3.308ON1481352122e-21
TBLA0H031308.375ON2141302144e-21
Suva_4.3263.308ON1481422094e-21
NCAS0B031508.375ON2141302127e-21
Skud_2.2073.308ON1481352087e-21
Smik_2.2193.308ON1481352087e-21
YBR082C (UBC4)3.308ON1481352087e-21
NDAI0A011608.375ON2161402127e-21
TDEL0H039707.54ON1561002088e-21
TDEL0F049908.375ON2171382119e-21
Kwal_27.124013.308ON2361052111e-20
TPHA0L008508.375ON2161302074e-20
SAKL0A00396g8.375ON2151402074e-20
KNAG0A048108.375ON2141302074e-20
Kpol_461.86.109ON1671352044e-20
KAFR0B060608.375ON2131302065e-20
YGL058W (RAD6)6.109ON1721352036e-20
Smik_7.2226.109ON1711352036e-20
ZYRO0C04950g6.109ON1681352026e-20
SAKL0A07260g6.109ON1691352027e-20
Suva_7.2136.109ON1731352037e-20
TDEL0G036106.109ON1691352027e-20
Ecym_30776.109ON1701352027e-20
AAR156C6.109ON1701352027e-20
NCAS0D032206.109ON1711352011e-19
Skud_15.5047.54ON1561152001e-19
TBLA0F024406.109ON1741432021e-19
TPHA0J017506.109ON1691352001e-19
Smik_15.5177.54ON1561001992e-19
KLLA0C05632g6.109ON1641351992e-19
CAGL0I00352g6.109ON1671351992e-19
NDAI0E038707.54ON1641001982e-19
ZYRO0E06358g2.569ON1651411974e-19
KLLA0E07745g2.569ON1651411965e-19
YOR339C (UBC11)7.54ON1561001957e-19
TPHA0I024602.569ON1671431958e-19
KLLA0C18656g8.375ON2281321998e-19
Ecym_45782.569ON1651411958e-19
Skud_7.2226.109ON1701351951e-18
KLTH0A07546g8.375ON2151401961e-18
NDAI0I016506.109ON1761351932e-18
TDEL0B065702.569ON1651411922e-18
KLTH0H06732g6.109ON1601351912e-18
NDAI0B015202.569ON1651411913e-18
KNAG0M021502.569ON1701411913e-18
Kwal_23.64858.375ON2151401934e-18
NCAS0A127402.569ON1651411904e-18
ZYRO0D04466g7.54ON1591001895e-18
SAKL0D13552g2.569ON1651411895e-18
KAFR0A021602.569ON1651411889e-18
ABR059W2.569ON1651411871e-17
Kpol_1056.52.569ON1651411871e-17
KNAG0F025706.109ON1511041861e-17
Suva_8.3897.54ON1561001871e-17
CAGL0M07568g2.569ON1651411871e-17
TBLA0H026102.569ON1651411852e-17
Kwal_14.18286.109ON1521041852e-17
KAFR0A047006.109ON1531041842e-17
Kpol_1065.127.54ON1591001834e-17
Kwal_26.82242.569ON1651411835e-17
KLTH0D07986g2.569ON1651411835e-17
SAKL0H17930g8.230ON1531071801e-16
KAFR0H012303.308ON110941771e-16
Smik_13.1862.569ON1651411782e-16
YMR022W (UBC7)2.569ON1651411783e-16
Suva_13.1892.569ON1651411773e-16
Skud_13.1762.569ON1651411773e-16
ZYRO0B11682g8.230ON1511071764e-16
Kpol_1075.1b8.230ON1521171755e-16
CAGL0M03399g1.436ON2141571787e-16
TPHA0B034108.230ON1521081731e-15
Smik_4.3358.230ON1431081712e-15
YDR092W (UBC13)8.230ON1531081712e-15
Skud_4.3528.230ON1431081702e-15
KLLA0C17622g8.230ON1591111713e-15
SAKL0B10582g7.54ON1611001703e-15
TBLA0F037908.230ON1511011694e-15
TDEL0A013408.230ON1571011695e-15
Suva_2.2538.230ON1431081677e-15
AGR121C8.230ON1541081687e-15
CAGL0G08063g8.230ON1491021677e-15
KNAG0H029808.230ON1521171678e-15
NDAI0J015408.230ON1541071678e-15
KLTH0G14366g8.230ON1491021661e-14
KLTH0D01760g7.54ON1611001661e-14
NCAS0B040108.230ON1531011651e-14
KAFR0A024208.230ON1471071651e-14
Smik_5.981.436ON2151581692e-14
YEL012W (UBC8)1.436ON2181581682e-14
Suva_5.531.436ON2151521673e-14
KNAG0H018701.436ON2101521673e-14
Ecym_13481.436ON2111521663e-14
Ecym_55638.230ON1641071643e-14
KLLA0A11198g1.436ON2021571654e-14
TPHA0O009201.436ON2261211664e-14
Skud_5.871.436ON2101521646e-14
Kwal_26.70097.54ON1611001626e-14
Kpol_1030.181.436ON2231221656e-14
TBLA0A012901.436ON2191521647e-14
NDAI0D011401.436ON2451211657e-14
Kwal_56.234828.230ON1491011608e-14
KAFR0H029601.436ON1871521629e-14
AEL045W1.436ON2111521612e-13
TDEL0B056701.436ON2031221576e-13
ZYRO0E03806g1.436ON2091221569e-13
KLTH0H13816g1.436ON2331521571e-12
SAKL0D10560g1.436ON2071221561e-12
NCAS0G031301.436ON2311101561e-12
Kwal_34.161741.436ON2131221542e-12
NCAS0I014303.301ON2581441525e-12
NDAI0A055303.301ON2731421501e-11
NCAS0A107703.301ON2731421501e-11
Skud_4.3063.301ON2971411502e-11
YDR054C (CDC34)3.301ON2951521492e-11
Smik_4.2903.301ON2971521492e-11
KAFR0H012703.301ON2871531492e-11
Smik_4.1714.249ON157961442e-11
Kwal_27.104443.301ON2781421483e-11
YDL064W (UBC9)4.249ON1571261433e-11
ZYRO0G12650g3.301ON2851521473e-11
KLTH0C04818g3.301ON2751421474e-11
Suva_4.1864.249ON1571261424e-11
NCAS0A059404.49ON1931621444e-11
Kpol_1065.453.301ON3231531465e-11
Suva_2.2113.301ON2971531465e-11
TBLA0I029604.249ON157961415e-11
TDEL0D032603.301ON2891411456e-11
KNAG0H010403.301ON2961411457e-11
Skud_4.1914.249ON1571261407e-11
Ecym_46837.392ON2431191448e-11
Ecym_26693.301ON2681421448e-11
AGL203C3.301ON2701421449e-11
CAGL0E04598g3.301ON2951411441e-10
TBLA0G032703.301ON3301411441e-10
SAKL0D02530g3.301ON2721421431e-10
Suva_7.1826.187ON1371211372e-10
ZYRO0G08228g6.187ON1381221372e-10
CAGL0H03157g6.187ON1391221353e-10
TPHA0B007704.249ON157961363e-10
TPHA0M012803.301ON435941404e-10
TDEL0G015806.187ON1381211335e-10
CAGL0D00814g4.249ON157961345e-10
TPHA0J022506.187ON1371191336e-10
YGL087C (MMS2)6.187ON1371211336e-10
TPHA0F003904.49ON1931091357e-10
KAFR0C021406.187ON1381211327e-10
KLLA0D09196g3.301ON2921421378e-10
SAKL0H03058g4.249ON157981339e-10
Smik_12.3894.49ON1871141331e-09
KLTH0D14344g4.249ON1571261321e-09
KAFR0G032404.249ON157941311e-09
KAFR0F030404.49ON1691131322e-09
CAGL0D06468g4.49ON1871121312e-09
NCAS0D036606.187ON1381221293e-09
ZYRO0B12386g4.249ON157981293e-09
KNAG0D043904.249ON1571241294e-09
Kpol_483.164.249ON122961274e-09
Ecym_32704.249ON157981284e-09
Kwal_23.42274.249ON122941264e-09
TDEL0E055604.49ON1871211294e-09
NDAI0A075703.301ON239941297e-09
SAKL0F12474g7.392ON2511271291e-08
TDEL0E012204.249ON157961251e-08
AER056C4.249ON157961242e-08
TBLA0E015704.49ON194871252e-08
KLLA0E19119g6.187ON1391211222e-08
NCAS0A024904.249ON1571241233e-08
NDAI0D029104.49ON1891271243e-08
KLLA0E05039g4.249ON157961223e-08
Kpol_YGOB_414.24.49ON193941233e-08
Kpol_414.2singletonOFF192941233e-08
KLTH0C06688g7.392ON2461531244e-08
Skud_7.1956.187ON100891184e-08
Suva_10.4014.49ON1871081216e-08
KNAG0I029404.49ON1971041216e-08
Skud_12.3894.49ON1871081217e-08
YLR306W (UBC12)4.49ON1881151208e-08
KLLA0E20395g7.392ON2511271211e-07
KNAG0B023607.392ON2511191201e-07
NDAI0A016507.392ON2511271201e-07
NDAI0D043804.249ON157941171e-07
Smik_7.1966.187ON100891142e-07
Kwal_27.108377.392ON2461271192e-07
CAGL0I05478g7.392ON2461211182e-07
KLTH0H09504g4.49ON184921146e-07
Kpol_1045.397.392ON2531221149e-07
KLLA0C17248g4.49ON184861121e-06
KNAG0J022803.301ON217941131e-06
KNAG0F021306.187ON1381221092e-06
NCAS0A143907.392ON2401221122e-06
Ecym_22306.187ON1381171092e-06
Smik_5.2467.392ON2501261122e-06
AFL064W6.187ON138721082e-06
YER100W (UBC6)7.392ON2501271112e-06
SAKL0A05192g6.187ON1401221082e-06
Skud_5.2257.392ON2501271113e-06
SAKL0H24112g4.49ON185741084e-06
NCAS0E026007.392ON2551451104e-06
Ecym_83714.49ON267891087e-06
ZYRO0G19910g4.49ON179971067e-06
TBLA0D006007.392ON256891071e-05
TBLA0A019006.187ON1391231031e-05
ADL035C4.49ON200931041e-05
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_480.13
         (157 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON} ...   321   e-114
TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.49...   198   2e-65
TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3....   179   6e-58
NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON...   163   1e-51
NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON...   162   2e-51
KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} simil...   162   2e-51
ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {O...   158   8e-50
YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}  PEX4Peroxis...   153   2e-47
Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W...   152   4e-47
SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {O...   149   5e-46
Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W (...   149   6e-46
Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W (...   148   1e-45
TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3....   147   2e-45
Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W (...   144   3e-44
KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.49...   141   4e-43
CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa] ...   135   9e-41
AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic h...   130   7e-39
KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON...   128   4e-38
Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON} ...   123   6e-36
KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {O...   105   8e-29
CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {O...    93   3e-24
NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 14...    92   7e-24
KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {O...    91   3e-23
KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936) ...    91   3e-23
SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444...    91   3e-23
AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON} Sy...    91   3e-23
Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON} ...    91   4e-23
NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [...    90   6e-23
TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa...    89   9e-23
Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W (...    91   1e-22
ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431) ...    89   1e-22
Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W (...    91   1e-22
Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W (...    91   1e-22
YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}  UBC1Ubiquit...    91   1e-22
Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 b...    89   2e-22
Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 b...    89   2e-22
YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, ...    89   2e-22
ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON} ...    90   2e-22
Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to A...    90   2e-22
Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 b...    88   3e-22
CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}...    90   3e-22
TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 ...    87   6e-22
KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {O...    87   8e-22
ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly ...    89   1e-21
Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON...    89   1e-21
TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa...    86   2e-21
Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON} ...    86   2e-21
KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 1...    86   2e-21
TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.37...    87   4e-21
Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 b...    85   4e-21
NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON}      86   7e-21
Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 b...    85   7e-21
Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 b...    85   7e-21
YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, ...    85   7e-21
NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON}      86   7e-21
TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON...    85   8e-21
TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.37...    86   9e-21
Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa] ...    86   1e-20
TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.3...    84   4e-20
SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}...    84   4e-20
KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON...    84   4e-20
Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..148...    83   4e-20
KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8....    84   5e-20
YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}  RAD6Ubiquit...    83   6e-20
Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W (...    83   6e-20
ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 a...    82   6e-20
SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 a...    82   7e-20
Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W (...    83   7e-20
TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa...    82   7e-20
Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to...    82   7e-20
AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON} Sy...    82   7e-20
NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109      82   1e-19
Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {O...    82   1e-19
TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON...    82   1e-19
TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {O...    82   1e-19
Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {O...    81   2e-19
KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {O...    81   2e-19
CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly si...    81   2e-19
NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON...    81   2e-19
ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly ...    80   4e-19
KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {O...    80   5e-19
YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}  ...    80   7e-19
TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.56...    80   8e-19
KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highl...    81   8e-19
Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON...    80   8e-19
Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W (...    80   1e-18
KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly ...    80   1e-18
NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON}      79   2e-18
TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2....    79   2e-18
KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 a...    78   2e-18
NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON...    78   3e-18
KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.5...    78   3e-18
Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177...    79   4e-18
NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2....    78   4e-18
ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {O...    77   5e-18
SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highl...    77   5e-18
KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.56...    77   9e-18
ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic hom...    77   1e-17
Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON} c...    77   1e-17
KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.10...    76   1e-17
Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}...    77   1e-17
CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {...    77   1e-17
TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON...    76   2e-17
Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W ...    76   2e-17
KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.10...    75   2e-17
Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON} (25814.....    75   4e-17
Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W ...    75   5e-17
KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly ...    75   5e-17
SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741) ...    74   1e-16
KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.30...    73   1e-16
Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W...    73   2e-16
YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiqui...    73   3e-16
Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W...    73   3e-16
Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W...    73   3e-16
ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly ...    72   4e-16
Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..195...    72   5e-16
CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {...    73   7e-16
TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON...    71   1e-15
Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W (...    70   2e-15
YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {O...    70   2e-15
Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W (...    70   2e-15
KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 1...    70   3e-15
SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {O...    70   3e-15
TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49...    70   4e-15
TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 ...    70   5e-15
Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W (...    69   7e-15
AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, ...    69   7e-15
CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly ...    69   7e-15
KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa...    69   8e-15
NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465...    69   8e-15
KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 1...    69   1e-14
KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly ...    69   1e-14
NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 ...    68   1e-14
KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON...    68   1e-14
Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa] ...    70   2e-14
YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {O...    69   2e-14
Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 21...    69   3e-14
KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON...    69   3e-14
Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp...    69   3e-14
Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 ...    68   3e-14
KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609...    68   4e-14
TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.4...    69   4e-14
Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W (R...    68   6e-14
Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C ...    67   6e-14
Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa] ...    68   6e-14
TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 ...    68   7e-14
NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa...    68   7e-14
Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {O...    66   8e-14
KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON...    67   9e-14
AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {O...    67   2e-13
TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1....    65   6e-13
ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 a...    65   9e-13
KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012) ...    65   1e-12
SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {O...    65   1e-12
NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON}                65   1e-12
Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W...    64   2e-12
NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON}                63   5e-12
NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3....    62   1e-11
NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {...    62   1e-11
Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}...    62   2e-11
YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}  C...    62   2e-11
Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}...    62   2e-11
KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON}                62   2e-11
Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]...    60   2e-11
Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C...    62   3e-11
YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {O...    60   3e-11
ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa] ...    61   3e-11
KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly ...    61   4e-11
Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]...    59   4e-11
NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49     60   4e-11
Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON} (12142...    61   5e-11
Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}...    61   5e-11
TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 ...    59   5e-11
TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.30...    60   6e-11
KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON}                60   7e-11
Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]...    59   7e-11
Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON...    60   8e-11
Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar ...    60   8e-11
AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON} Sy...    60   9e-11
CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {O...    60   1e-10
TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON...    60   1e-10
SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly ...    60   1e-10
Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 b...    57   2e-10
ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417...    57   2e-10
CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420...    57   3e-10
TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.24...    57   3e-10
TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {...    59   4e-10
TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa...    56   5e-10
CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly si...    56   5e-10
TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414...    56   6e-10
YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, ...    56   6e-10
TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, ...    57   7e-10
KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 ...    55   7e-10
KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar...    57   8e-10
SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 a...    56   9e-10
Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W...    56   1e-09
KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413) ...    55   1e-09
KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON...    55   1e-09
KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON...    55   2e-09
CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar...    55   2e-09
NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 ...    54   3e-09
ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa] ...    54   3e-09
KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON...    54   4e-09
Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON} ...    54   4e-09
Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa] ...    54   4e-09
Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W ...    53   4e-09
TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [...    54   4e-09
NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {...    54   7e-09
SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar...    54   1e-08
TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.24...    53   1e-08
AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, ...    52   2e-08
TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 ...    53   2e-08
KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236) ...    52   2e-08
NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 ...    52   3e-08
NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49       52   3e-08
KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly ...    52   3e-08
Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, ...    52   3e-08
Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF} co...    52   3e-08
KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {O...    52   4e-08
Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}...    50   4e-08
Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W...    51   6e-08
KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa...    51   6e-08
Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W...    51   7e-08
YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {...    51   8e-08
KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} simil...    51   1e-07
KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON...    51   1e-07
NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON...    51   1e-07
NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 15...    50   1e-07
Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}...    49   2e-07
Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {O...    50   2e-07
CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {O...    50   2e-07
KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555...    49   6e-07
Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON...    49   9e-07
KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa] ...    48   1e-06
KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {O...    48   1e-06
KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.18...    47   2e-06
NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7....    48   2e-06
Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa] ...    47   2e-06
Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W (...    48   2e-06
AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa] {O...    46   2e-06
YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}  UBC6Ubiquit...    47   2e-06
SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 a...    46   2e-06
Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W (...    47   3e-06
SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 1...    46   4e-06
NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON...    47   4e-06
Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to...    46   7e-06
ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} simil...    45   7e-06
TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON...    46   1e-05
TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420 ...    44   1e-05
ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, ...    45   1e-05
Suva_5.219 Chr5 (333753..334502) [750 bp, 249 aa] {ON} YER100W (...    45   2e-05
NDAI0E04170 Chr5 complement(940288..941061) [774 bp, 257 aa] {ON...    45   2e-05
NDAI0I01230 Chr9 (296124..296160,296450..296886) [474 bp, 157 aa...    44   2e-05
KLTH0H04796g Chr8 (428760..428770,428834..429239) [417 bp, 138 a...    44   2e-05
KAFR0L01750 Chr12 (320295..321050) [756 bp, 251 aa] {ON} Anc_7.3...    44   3e-05
AGR372W Chr7 (1420314..1421042) [729 bp, 242 aa] {ON} Syntenic h...    44   3e-05
ZYRO0B03344g Chr2 (278107..278859) [753 bp, 250 aa] {ON} similar...    44   4e-05
Kpol_1002.65 s1002 (176569..176874) [306 bp, 101 aa] {ON} (17656...    42   7e-05
TPHA0K00820 Chr11 complement(172380..173153) [774 bp, 257 aa] {O...    43   7e-05
TDEL0C01550 Chr3 complement(267010..267756) [747 bp, 248 aa] {ON...    41   3e-04
Kwal_27.11182 s27 complement(675053..675358) [306 bp, 101 aa] {O...    39   7e-04
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    32   0.90 
Kpol_467.19 s467 (42459..43622) [1164 bp, 387 aa] {ON} (42459..4...    29   5.4  
Smik_12.11 Chr12 complement(26055..31040) [4986 bp, 1661 aa] {ON...    29   6.3  
KLLA0A09427g Chr1 complement(821244..824279) [3036 bp, 1011 aa] ...    29   6.8  

>Kpol_480.13 s480 complement(27113..27586) [474 bp, 157 aa] {ON}
           complement(27113..27586) [474 nt, 158 aa]
          Length = 157

 Score =  321 bits (822), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 157/157 (100%), Positives = 157/157 (100%)

Query: 1   MSERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIH 60
           MSERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIH
Sbjct: 1   MSERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIH 60

Query: 61  LTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSD 120
           LTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSD
Sbjct: 61  LTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSD 120

Query: 121 PVTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNKSDK 157
           PVTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNKSDK
Sbjct: 121 PVTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNKSDK 157

>TPHA0D04260 Chr4 (920720..921196) [477 bp, 158 aa] {ON} Anc_3.495
           YGR133W
          Length = 158

 Score =  198 bits (503), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 91/155 (58%), Positives = 115/155 (74%)

Query: 1   MSERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIH 60
           MS +RLLKE ++++KEL  +   I  LEP+  ++   W A + GP NTPYH HSF L I 
Sbjct: 1   MSLKRLLKEKRLIEKELSGYSESIELLEPVAFENFLKWRAVLKGPVNTPYHKHSFKLLIE 60

Query: 61  LTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSD 120
           L  EYPL PP +TF  Y MPHCN+EF TGKICLNIL++ +WSPVWNL+ V++A+YQLL +
Sbjct: 61  LPSEYPLVPPAITFEPYSMPHCNVEFSTGKICLNILEHEHWSPVWNLMYVMVALYQLLQE 120

Query: 121 PVTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNKS 155
           PV DSPLNIDL+NIL+  DTSAY+GLI YYL   +
Sbjct: 121 PVVDSPLNIDLANILRAGDTSAYHGLINYYLQEDT 155

>TDEL0D05630 Chr4 (1013302..1013754) [453 bp, 150 aa] {ON} Anc_3.495
           YGR133W
          Length = 150

 Score =  179 bits (453), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 82/149 (55%), Positives = 107/149 (71%), Gaps = 1/149 (0%)

Query: 5   RLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPE 64
           R+ +EY+ ++  LG+  +++ SLEPID D L+ W   I GP  TPY GH+F LR+ L   
Sbjct: 3   RIAREYKHIQATLGSESSLVVSLEPIDGD-LSRWAGEIRGPTGTPYEGHTFSLRLVLGDR 61

Query: 65  YPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTD 124
           YP  PPQVTF+   MPHCN+ ++TG ICLNIL   +WSP W+LL V+ AI QLLSDP  D
Sbjct: 62  YPTTPPQVTFARRSMPHCNVNYETGSICLNILTPEHWSPAWDLLHVLEAIIQLLSDPEPD 121

Query: 125 SPLNIDLSNILKIKDTSAYYGLIEYYLNN 153
           SPL+IDL+NIL+ +D SAYYGL+ YYL +
Sbjct: 122 SPLDIDLANILRAQDRSAYYGLVNYYLQS 150

>NCAS0E00780 Chr5 complement(145435..145950) [516 bp, 171 aa] {ON}
           Anc_3.495
          Length = 171

 Score =  163 bits (413), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 79/160 (49%), Positives = 106/160 (66%), Gaps = 12/160 (7%)

Query: 5   RLLKEYQVVKKELG----NHKN--------IISSLEPIDSDDLTNWTATILGPPNTPYHG 52
           RLLKEY+ ++  L     +H N        II+ L PI + DLT+W A I GP  TPY  
Sbjct: 3   RLLKEYKKIQTTLSPNSTHHNNNDDDEFNQIITYLHPISTSDLTHWQAQIKGPQGTPYAN 62

Query: 53  HSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVL 112
           H F L+I   P YP++PP + F    MPHCN+ F+TG ICL+IL+  +W+P WNL+T + 
Sbjct: 63  HEFQLQIECPPTYPIEPPIIHFQPLSMPHCNVNFQTGAICLDILEKQHWTPAWNLMTTMK 122

Query: 113 AIYQLLSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYYLN 152
           AI+ LL DPV DSPLN+D++NIL++ D SAY GL+ YYL+
Sbjct: 123 AIWILLKDPVPDSPLNVDIANILRVNDQSAYNGLLNYYLS 162

>NDAI0G00910 Chr7 complement(191811..192302) [492 bp, 163 aa] {ON}
           Anc_3.495
          Length = 163

 Score =  162 bits (411), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 81/157 (51%), Positives = 107/157 (68%), Gaps = 9/157 (5%)

Query: 5   RLLKEYQVVKKELGNHKN--------IISSLEPIDSD-DLTNWTATILGPPNTPYHGHSF 55
           R++KEY+ ++K+L N++N        II SL PID D DLT W A I GP  TPY+G +F
Sbjct: 3   RIIKEYKTIQKQLNNNRNNQDDEFNNIIVSLAPIDPDQDLTKWEAVIKGPQGTPYYGFNF 62

Query: 56  DLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIY 115
            L I +  EYP  PP   F    MPHCN+ + TG+ICL+IL   +W+PVWNL++ + AI+
Sbjct: 63  ILYITIPQEYPTVPPFFEFQPRSMPHCNVNYNTGEICLDILKQDHWTPVWNLMSTLKAIW 122

Query: 116 QLLSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYYLN 152
            LL DPV +SPLN+DL+N+L+  D SAY GLI YYLN
Sbjct: 123 LLLKDPVPESPLNVDLANLLRFGDLSAYNGLINYYLN 159

>KLTH0F14894g Chr6 (1219767..1220267) [501 bp, 166 aa] {ON} similar
           to uniprot|P29340 Saccharomyces cerevisiae YGR133W PEX4
           Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 166

 Score =  162 bits (411), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 75/154 (48%), Positives = 105/154 (68%), Gaps = 2/154 (1%)

Query: 4   RRLLKEYQVVKKELGNHKNI--ISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           +RL KEY+ + K LG       I SL P+  ++L  W + I GPP+TPY GH F L+I  
Sbjct: 3   QRLAKEYRALSKTLGRDPEYAYIISLAPVSEENLRKWESLITGPPDTPYFGHEFTLQIEA 62

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
           +  YPL+PP+V F A  MPHCN++F +G+ICL++LD A+W+P W+LL VV AI+ LL+ P
Sbjct: 63  SEAYPLEPPKVQFQARCMPHCNVDFDSGRICLSVLDAAHWTPAWDLLHVVHAIWLLLASP 122

Query: 122 VTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNKS 155
             DSPL++DL+ +++  D SA+  LI YYLN  S
Sbjct: 123 EPDSPLDVDLACLVRAGDRSAHNSLIAYYLNGGS 156

>ZYRO0D09878g Chr4 complement(834515..834976) [462 bp, 153 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 153

 Score =  158 bits (400), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 76/153 (49%), Positives = 101/153 (66%), Gaps = 6/153 (3%)

Query: 5   RLLKEYQVVKKELGN----HKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIH 60
           R  KEY+ + K L      +  +I  +EP   +DLT W A I GP  TPY G +F L + 
Sbjct: 3   RAAKEYKTITKVLKEGDEVYSQLIVGMEP--KEDLTRWEALIRGPSGTPYEGCNFRLHLS 60

Query: 61  LTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSD 120
           L  EYP+ PP V F  Y MPH N++F+TG+ICL+IL   +WSP W+LL VV AI QLL +
Sbjct: 61  LPQEYPMSPPYVKFEPYAMPHANVDFRTGEICLDILTKQHWSPAWDLLHVVQAIGQLLDE 120

Query: 121 PVTDSPLNIDLSNILKIKDTSAYYGLIEYYLNN 153
           PV+ SPLN+D++NILK  D +AYYGL+ YY+ +
Sbjct: 121 PVSSSPLNVDIANILKANDMNAYYGLVHYYIKS 153

>YGR133W Chr7 (756896..757447) [552 bp, 183 aa] {ON}
           PEX4Peroxisomal ubiquitin conjugating enzyme required
           for peroxisomal matrix protein import and peroxisome
           biogenesis
          Length = 183

 Score =  153 bits (386), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 69/157 (43%), Positives = 104/157 (66%), Gaps = 7/157 (4%)

Query: 5   RLLKEYQVVKKELGN-------HKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDL 57
           R++KEY+V+ K L +       ++ II SL PID  DL+ W A I GP +TPY  H F +
Sbjct: 21  RIVKEYKVILKTLASDDPIANPYRGIIESLNPIDETDLSKWEAIISGPSDTPYENHQFRI 80

Query: 58  RIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQL 117
            I +   YP+ PP+++F    + HCN++  TG+ICLNIL    W+PVW+LL  V A+++L
Sbjct: 81  LIEVPSSYPMNPPKISFMQNNILHCNVKSATGEICLNILKPEEWTPVWDLLHCVHAVWRL 140

Query: 118 LSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNK 154
           L +PV DSPL++D+ NI++  D SAY G+++Y+L  +
Sbjct: 141 LREPVCDSPLDVDIGNIIRCGDMSAYQGIVKYFLAER 177

>Kwal_55.21246 s55 (747274..747756) [483 bp, 160 aa] {ON} YGR133W
           (PEX4) - Member of ubiquitin-conjugating protein family
           [contig 130] FULL
          Length = 160

 Score =  152 bits (383), Expect = 4e-47,   Method: Compositional matrix adjust.
 Identities = 72/154 (46%), Positives = 104/154 (67%), Gaps = 2/154 (1%)

Query: 4   RRLLKEYQVVKKELGNHKNI--ISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           +RL KEY+ + K L        I  L P+  D+L  W A I GP +TPY GH F L I +
Sbjct: 3   QRLAKEYKTLLKTLKEDPAYSHIRKLRPVSDDNLYVWEADITGPSDTPYQGHEFSLLITI 62

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
              YPL+PP+V F+A  +PHCN++F++G+IC+N+L+ A+WSP W+LL +V AI+ LL++P
Sbjct: 63  PSAYPLEPPKVQFNARCVPHCNVDFESGRICINLLERAHWSPAWDLLHLVHAIWLLLANP 122

Query: 122 VTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNKS 155
             DSPL++DL+ + +  D SA+ GL+ YYLN  S
Sbjct: 123 EPDSPLDVDLACLRRAGDYSAHNGLVAYYLNGGS 156

>SAKL0F02706g Chr6 complement(229712..230197) [486 bp, 161 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 161

 Score =  149 bits (375), Expect = 5e-46,   Method: Compositional matrix adjust.
 Identities = 75/157 (47%), Positives = 106/157 (67%), Gaps = 5/157 (3%)

Query: 1   MSERRLLKEYQVVKKELGNHK--NIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLR 58
           MS +R+ KE++ V+K L      N I  LEP D+ ++ +W A I GPP TPY    F L 
Sbjct: 1   MSLQRITKEFKSVRKTLAEDPSYNHILKLEPKDTGNMYHWIADISGPPETPYASAVFALD 60

Query: 59  IHLTPEYPLKPPQVTF---SAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIY 115
           + L  +YPL+PP+V F   S   + HCN++FKTG+ICL+IL   +WSPVW+L+ V+ AI+
Sbjct: 61  VELPIQYPLEPPRVKFLPGSRNNICHCNVDFKTGEICLDILTREHWSPVWDLVHVIHAIW 120

Query: 116 QLLSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYYLN 152
            LL +PV +SPLN+D++N+LK  D  AY GLI+YY+ 
Sbjct: 121 ILLGEPVPESPLNVDIANVLKAGDLEAYEGLIKYYIG 157

>Smik_6.229 Chr6 (374835..375332) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  149 bits (375), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 67/158 (42%), Positives = 103/158 (65%), Gaps = 7/158 (4%)

Query: 5   RLLKEYQVVKKELGN-------HKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDL 57
           R+ KEY+V+ K L +       ++ II SL PID  DL+ W A I GP +TPY  + F +
Sbjct: 3   RITKEYRVILKTLASDDPIVNPYRGIIRSLNPIDETDLSRWEAKIYGPSHTPYENYQFHI 62

Query: 58  RIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQL 117
            I +   YP+ PP++ F    + HCN++  TG+ICL+IL   +W+PVW+LL  V A+++L
Sbjct: 63  LIDVPSSYPMTPPRINFEQNDILHCNVKSATGEICLDILKPEDWTPVWDLLHCVHAVWRL 122

Query: 118 LSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNKS 155
           L +PV DSPL++D+ NI++  D SAY G+++Y+L  + 
Sbjct: 123 LREPVCDSPLDVDMGNIIRCADESAYQGIVKYFLAERE 160

>Suva_7.421 Chr7 (727108..727605) [498 bp, 165 aa] {ON} YGR133W
           (REAL)
          Length = 165

 Score =  148 bits (373), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 66/158 (41%), Positives = 102/158 (64%), Gaps = 7/158 (4%)

Query: 5   RLLKEYQVVKKELGN-------HKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDL 57
           R+ KEY++++K L +       ++ II SL P D  DL+ W ATI GP +TPY  + F +
Sbjct: 3   RITKEYRLIRKTLASDDPTVNPYRGIIESLNPTDETDLSKWEATICGPEHTPYERYQFRM 62

Query: 58  RIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQL 117
            I +   YP+ PP++ F    + HCNI   TG+ICL+IL   +W+PVW+LL  V A+++L
Sbjct: 63  LIDVPDSYPMAPPKIMFEKDAILHCNINSSTGEICLDILKLQDWTPVWDLLHCVHAVWRL 122

Query: 118 LSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNKS 155
           L +PV DSPL++D+ NI++  D  AY G+++Y+L  + 
Sbjct: 123 LREPVCDSPLDVDMGNIIRCGDKRAYQGIVKYFLAERE 160

>TBLA0C04500 Chr3 (1089815..1090312) [498 bp, 165 aa] {ON} Anc_3.495
           YGR133W
          Length = 165

 Score =  147 bits (372), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 79/152 (51%), Positives = 104/152 (68%), Gaps = 4/152 (2%)

Query: 5   RLLKEYQVVKKELGNHKNIISSLEPID--SDDLTNWTATILGPPNTPYHGHSFDLRIHLT 62
           R++KEY  ++K L    + +++L P+   + DL+NW + ILGP ++PYH  SF L IH+ 
Sbjct: 3   RIIKEYNHIRK-LNALPDNMTTLHPVSNATSDLSNWHSIILGPKDSPYHNKSFLLEIHIP 61

Query: 63  PEYPLKPPQVTFSAYKMP-HCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
            EYP  PP + F+   +P HCN+ F TG+ICLNIL N NWSPVWNLL  V AI QLL+ P
Sbjct: 62  TEYPSIPPVIKFNKNSIPPHCNVNFTTGEICLNILKNENWSPVWNLLYSVQAIIQLLAYP 121

Query: 122 VTDSPLNIDLSNILKIKDTSAYYGLIEYYLNN 153
              SPLNIDLS +L +KD+ AY  LI+YYL N
Sbjct: 122 DPSSPLNIDLSRLLTLKDSKAYNSLIKYYLYN 153

>Skud_7.444 Chr7 (736148..736633) [486 bp, 162 aa] {ON} YGR133W
           (REAL)
          Length = 162

 Score =  144 bits (363), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 68/157 (43%), Positives = 101/157 (64%), Gaps = 7/157 (4%)

Query: 5   RLLKEYQVVKKELGN-------HKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDL 57
           R+ KEY  ++K L +       ++ +I SL PID  DL+ W A I+GP +TPY  + F +
Sbjct: 3   RIAKEYGDIQKTLASNDPIVNPYQGLIESLNPIDETDLSKWEAIIIGPTHTPYEHYRFRI 62

Query: 58  RIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQL 117
            I +   YP+ PP + F    + HCNI+  TG+ICL+IL   +W+PVW+LL  V AI++L
Sbjct: 63  LIDVPSSYPMAPPNIRFDRNNILHCNIKSPTGEICLDILKPEDWTPVWDLLHCVHAIWRL 122

Query: 118 LSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNK 154
           L +PV DSPL++D+ NI++  DT AY G+I Y+L  +
Sbjct: 123 LKEPVYDSPLDVDMGNIIRCGDTGAYQGIIRYFLAER 159

>KAFR0C01990 Chr3 (395423..395878) [456 bp, 151 aa] {ON} Anc_3.495
           YGR133W
          Length = 151

 Score =  141 bits (355), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 73/153 (47%), Positives = 100/153 (65%), Gaps = 4/153 (2%)

Query: 3   ERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLT 62
           E R+LKEY   K         I +L+PI +DDLT+W  TI GP ++P+  H+F LRI + 
Sbjct: 2   ESRILKEY---KDSRSLQSQYILALDPISTDDLTHWECTIKGPLHSPFANHTFKLRIDIP 58

Query: 63  PEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPV 122
             YPL  P   F  + MPH N+ F+TG+ICL+ILD  NWSPV+N+  +V AI  LL++P 
Sbjct: 59  QTYPLTTPICKFEPFAMPHPNVNFETGEICLDILD-TNWSPVFNIQYIVEAIVWLLNEPN 117

Query: 123 TDSPLNIDLSNILKIKDTSAYYGLIEYYLNNKS 155
             SPLN+DL+N+L+  D  AY+ LI Y+LNN +
Sbjct: 118 FKSPLNLDLANLLRFDDLKAYHDLISYHLNNSA 150

>CAGL0I10450g Chr9 complement(1035489..1035977) [489 bp, 162 aa]
           {ON} similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133w ubiquitin-conjugating enzyme - peroxin
          Length = 162

 Score =  135 bits (341), Expect = 9e-41,   Method: Compositional matrix adjust.
 Identities = 67/156 (42%), Positives = 97/156 (62%), Gaps = 7/156 (4%)

Query: 5   RLLKEYQVVKKELGNHKN-IISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           R+ KE   ++K L +  +  +  L P+D  DL+ W A I GP  TPY+ + F L I +  
Sbjct: 3   RISKELLKIRKALEHGDSEFLVDLAPVDDSDLSRWFAVIKGPAETPYYPYEFKLAIEVPA 62

Query: 64  EYPLKPPQVTFSAYKM------PHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQL 117
            YP+ PP + F +         PHCN++ +TG+ICL+IL    WSP+W++L VV AI+ L
Sbjct: 63  SYPMVPPTIKFVSDAKAGIRVPPHCNVDRRTGEICLDILKPEGWSPIWDILHVVQAIHIL 122

Query: 118 LSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYYLNN 153
           L +PV DSPL++D++NILK  D SAY G+I Y+L  
Sbjct: 123 LQEPVPDSPLDVDMANILKNNDMSAYNGIIRYFLTE 158

>AFR314W Chr6 (1006415..1006882) [468 bp, 155 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR133W (PEX4)
          Length = 155

 Score =  130 bits (328), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 67/153 (43%), Positives = 102/153 (66%), Gaps = 4/153 (2%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPI--DSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           RR+L+EY+ ++K+L  H  ++S L P+  ++ DL  W A   GP NTPY G +F LRI++
Sbjct: 2   RRILREYKQLQKQLALHPAVLS-LAPVGEENGDLHRWEAHFQGPENTPYAGFTFTLRINV 60

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
              YP +PP+ +F  + + H NI++ TG++CL++L +  WSPV+NLL VV AI  LL++P
Sbjct: 61  PETYPNEPPKCSFPPHHICHPNIKWSTGEVCLDLLKHEAWSPVYNLLQVVEAISTLLAEP 120

Query: 122 VTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNK 154
             DSPL++DLS  L   D +AY G++ Y L  +
Sbjct: 121 GVDSPLDVDLSR-LYTTDRAAYDGVVNYRLRTR 152

>KNAG0B00780 Chr2 complement(145805..146266) [462 bp, 153 aa] {ON}
           Anc_3.495 YGR133W
          Length = 153

 Score =  128 bits (322), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 64/154 (41%), Positives = 98/154 (63%), Gaps = 3/154 (1%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +R+L+EY+ +    G      S+L P D  DLT+W AT+ GP  TPY GHSF LR+ +  
Sbjct: 3   QRVLREYRRLVAAGGAANE--SNLHPTDPADLTHWEATLEGPQGTPYEGHSFPLRVTVPD 60

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVT 123
           +YP  PP V F    MPH N+++ TG++CL+ L    W+PV +L   V+A+ +LL++P  
Sbjct: 61  KYPTLPPSVCFPKRTMPHPNVKWDTGEVCLDTL-AGGWTPVMDLQYAVMAVRRLLAEPNP 119

Query: 124 DSPLNIDLSNILKIKDTSAYYGLIEYYLNNKSDK 157
           +SPLN++L+ + ++ D  AY G+I+Y L + S K
Sbjct: 120 ESPLNLELAALSRLGDHKAYDGIIKYRLAHSSIK 153

>Ecym_1234 Chr1 complement(482339..482824) [486 bp, 161 aa] {ON}
           similar to Ashbya gossypii AFR314W
          Length = 161

 Score =  123 bits (309), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 59/151 (39%), Positives = 94/151 (62%), Gaps = 1/151 (0%)

Query: 5   RLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPE 64
           R+L EY+ ++++L +H++I+      D   L+ W A   GP NTPY   +F L I +   
Sbjct: 11  RMLAEYKQIREQLQSHESILMLCPAGDGGSLSKWEAQFCGPENTPYADFTFTLSIEIPEM 70

Query: 65  YPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTD 124
           YP +PP   F    + H NI++ TG++CL++L +  WSP++NLL VV AI  LL++P  D
Sbjct: 71  YPNEPPNCRFPPNHICHPNIKWSTGEVCLDLLKHETWSPMYNLLQVVEAIRTLLAEPGVD 130

Query: 125 SPLNIDLSNILKIKDTSAYYGLIEYYLNNKS 155
           SPL++DL+ +  + D  AY GL+ Y L +++
Sbjct: 131 SPLDVDLAKLYSV-DKQAYQGLVTYRLCSRT 160

>KLLA0E04027g Chr5 complement(365119..365595) [477 bp, 158 aa] {ON}
           similar to uniprot|P29340 Saccharomyces cerevisiae
           YGR133W PEX4 Involved in peroxisome biogenesis Member of
           ubiquitin-conjugating protein family
          Length = 158

 Score =  105 bits (261), Expect = 8e-29,   Method: Compositional matrix adjust.
 Identities = 59/152 (38%), Positives = 90/152 (59%), Gaps = 5/152 (3%)

Query: 5   RLLKEYQVVKKELGNHK-NIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           R++KEY  ++K L   + + IS L P+D DDL+ W     GP  +P+ G    L I +  
Sbjct: 3   RIVKEYMGLQKRLQTPEFSWISFLAPVDDDDLSEWVCRFQGPSESPFEGFELGLNITIDL 62

Query: 64  E-YPLKP-PQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
           E YP+   P+V F    + H N+++ TG+ICL++L +A W+P++ LL VV AI  LL+DP
Sbjct: 63  EKYPISGGPRVLFEPRTVAHPNVKWDTGEICLDLLKDA-WTPIYTLLDVVGAIRDLLADP 121

Query: 122 VTDSPLNIDLSNILKIKDTSAYYGLIEYYLNN 153
             DSPL++D++ I    D  AY  ++ Y L  
Sbjct: 122 GLDSPLDLDIAQIYD-ADYEAYVQIVRYRLEE 152

>CAGL0E04752g Chr5 complement(456202..456645) [444 bp, 147 aa] {ON}
           highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082c UBC4 E2 ubiquitin-conjugating enzyme
           or uniprot|P15732 Saccharomyces cerevisiae YDR059c UBC5
          Length = 147

 Score = 93.2 bits (230), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 56/136 (41%), Positives = 80/136 (58%), Gaps = 8/136 (5%)

Query: 1   MSERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIH 60
           MS +R+ KE      +LG       S  P+  DDL +W A+I+GPP++PY G  F L IH
Sbjct: 1   MSSKRIAKELS----DLGRDPPTSCSAGPV-GDDLYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 61  LTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSD 120
              +YP KPP+++F+  K+ H NI    G ICL+IL +  WSP   L  V+L+I  LL+D
Sbjct: 56  FPTDYPFKPPKISFTT-KIYHPNIN-ANGNICLDILKD-QWSPALTLSKVLLSICSLLTD 112

Query: 121 PVTDSPLNIDLSNILK 136
              D PL  ++++I K
Sbjct: 113 ANPDDPLVPEIAHIYK 128

>NDAI0A05490 Chr1 (1240963..1241006,1241105..1241504) [444 bp, 147
           aa] {ON} Anc_3.308
          Length = 147

 Score = 92.4 bits (228), Expect = 7e-24,   Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 80/136 (58%), Gaps = 8/136 (5%)

Query: 1   MSERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIH 60
           MS +R+ KE      ++G       S  P+  DDL +W A+I+GPP++PY G  F L IH
Sbjct: 1   MSSKRITKELS----DMGRDPPTSCSAGPV-GDDLYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 61  LTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSD 120
              +YP KPP+++F+  K+ H NI    G ICL+IL +  WSP   L  V+L+I  LL+D
Sbjct: 56  FPTDYPFKPPKISFTT-KIYHPNIN-ANGNICLDILKD-QWSPALTLSKVLLSICSLLTD 112

Query: 121 PVTDSPLNIDLSNILK 136
              D PL  ++++I K
Sbjct: 113 ANPDDPLVPEIAHIYK 128

>KAFR0C00270 Chr3 (47414..47457,47593..47992) [444 bp, 147 aa] {ON} 
          Length = 147

 Score = 90.5 bits (223), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 60/144 (41%), Positives = 86/144 (59%), Gaps = 11/144 (7%)

Query: 1   MSERRLLKEYQVVKKELGNHKNIIS-SLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRI 59
           MS +R+ KE   ++K+      I S S  P+  DDL +W A+I+GPP++PY G  F L I
Sbjct: 1   MSSKRISKELNDLRKD-----PITSFSAGPV-GDDLFHWQASIMGPPDSPYAGGVFFLSI 54

Query: 60  HLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLS 119
           H   +YP KPP+++F+  K+ H NI    G ICL+IL +  WSP   L  V+L+I  LL+
Sbjct: 55  HFPTDYPFKPPKISFTT-KIYHPNIN-ANGNICLDILKD-QWSPALTLSKVLLSICSLLT 111

Query: 120 DPVTDSPLNIDLSNILKIKDTSAY 143
           D   D PL  ++++I K  D S Y
Sbjct: 112 DANPDDPLVPEIAHIYKT-DRSKY 134

>KLTH0E14300g Chr5 complement(1265287..1265686,1265893..1265936)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 90.5 bits (223), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 80/136 (58%), Gaps = 8/136 (5%)

Query: 1   MSERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIH 60
           MS +R+ KE      +LG       S  P+  DDL +W A+I+GPP++PY G  F L IH
Sbjct: 1   MSLKRITKELN----DLGRDPPTSCSAGPV-GDDLYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 61  LTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSD 120
              +YP KPP+++F+  K+ H NI    G ICL+IL +  WSP   +  V+L+I  LL+D
Sbjct: 56  FPTDYPFKPPKISFTT-KIYHPNIN-ANGNICLDILKD-QWSPALTISKVLLSICSLLTD 112

Query: 121 PVTDSPLNIDLSNILK 136
              D PL  ++++I K
Sbjct: 113 ANPDDPLVPEIAHIYK 128

>SAKL0B06512g Chr2 complement(557855..558254,558581..558624) [444
           bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 90.5 bits (223), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 80/136 (58%), Gaps = 8/136 (5%)

Query: 1   MSERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIH 60
           MS +R+ KE      +LG       S  P+  DDL +W A+I+GPP++PY G  F L IH
Sbjct: 1   MSLKRITKELN----DLGRDPPTSCSAGPV-GDDLYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 61  LTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSD 120
              +YP KPP+++F+  K+ H NI    G ICL+IL +  WSP   +  V+L+I  LL+D
Sbjct: 56  FPTDYPFKPPKISFTT-KIYHPNIN-ANGNICLDILKD-QWSPALTISKVLLSICSLLTD 112

Query: 121 PVTDSPLNIDLSNILK 136
              D PL  ++++I K
Sbjct: 113 ANPDDPLVPEIAHIYK 128

>AER173C Chr5 complement(960420..960863) [444 bp, 147 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR082C
           (UBC4) and YDR059C (UBC5)
          Length = 147

 Score = 90.5 bits (223), Expect = 3e-23,   Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 80/136 (58%), Gaps = 8/136 (5%)

Query: 1   MSERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIH 60
           MS +R+ KE      +LG       S  P+  DDL +W A+I+GPP++PY G  F L IH
Sbjct: 1   MSLKRITKELN----DLGRDPPTSCSAGPV-GDDLYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 61  LTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSD 120
              +YP KPP+++F+  K+ H NI    G ICL+IL +  WSP   +  V+L+I  LL+D
Sbjct: 56  FPTDYPFKPPKISFTT-KIYHPNIN-ANGNICLDILKD-QWSPALTISKVLLSICSLLTD 112

Query: 121 PVTDSPLNIDLSNILK 136
              D PL  ++++I K
Sbjct: 113 ANPDDPLVPEIAHIYK 128

>Ecym_7431 Chr7 complement(883095..883538) [444 bp, 147 aa] {ON}
           similar to Ashbya gossypii AER173C
          Length = 147

 Score = 90.5 bits (223), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 55/136 (40%), Positives = 80/136 (58%), Gaps = 8/136 (5%)

Query: 1   MSERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIH 60
           MS +R+ KE      +LG       S  P+  DDL +W A+I+GPP++PY G  F L IH
Sbjct: 1   MSLKRITKELN----DLGRDPPTSCSAGPV-GDDLYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 61  LTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSD 120
              +YP KPP+++F+  K+ H NI    G ICL+IL +  WSP   +  V+L+I  LL+D
Sbjct: 56  FPTDYPFKPPKISFTT-KIYHPNIN-ANGNICLDILKD-QWSPALTISKVLLSICSLLTD 112

Query: 121 PVTDSPLNIDLSNILK 136
              D PL  ++++I K
Sbjct: 113 ANPDDPLVPEIAHIYK 128

>NCAS0A10800 Chr1 complement(2150862..2151261,2151377..2151423) [447
           bp, 148 aa] {ON} Anc_3.308
          Length = 148

 Score = 89.7 bits (221), Expect = 6e-23,   Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 79/135 (58%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           S +R+ KE      ++G       S  P+  DDL +W A+I+GPP++PY G  F L IH 
Sbjct: 3   SSKRITKELS----DMGRDPPTSCSAGPV-GDDLYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             +YP KPP+++F+  K+ H NI    G ICL+IL +  WSP   L  V+L+I  LL+D 
Sbjct: 58  PTDYPFKPPKISFTT-KIYHPNIN-ANGNICLDILKD-QWSPALTLSKVLLSICSLLTDA 114

Query: 122 VTDSPLNIDLSNILK 136
             D PL  ++++I K
Sbjct: 115 NPDDPLVPEIAHIYK 129

>TDEL0F02100 Chr6 (382357..382400,382469..382868) [444 bp, 147 aa]
           {ON} 
          Length = 147

 Score = 89.4 bits (220), Expect = 9e-23,   Method: Compositional matrix adjust.
 Identities = 54/136 (39%), Positives = 79/136 (58%), Gaps = 8/136 (5%)

Query: 1   MSERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIH 60
           MS +R+ KE      +LG       S  P+  DD+ +W A+I+GPP++PY G  F L IH
Sbjct: 1   MSLKRITKELN----DLGRDPPTSCSAGPV-GDDIYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 61  LTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSD 120
              +YP KPP++ F+  K+ H NI    G ICL+IL +  WSP   +  V+L+I  LL+D
Sbjct: 56  FPTDYPFKPPKIAFTT-KIYHPNIN-ANGNICLDILKD-QWSPALTISKVLLSICSLLTD 112

Query: 121 PVTDSPLNIDLSNILK 136
              D PL  ++++I K
Sbjct: 113 ANPDDPLVPEIAHIYK 128

>Skud_4.441 Chr4 (783817..784464) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 90.9 bits (224), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 74/130 (56%), Gaps = 6/130 (4%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +R++KE Q VK +   H     +LE +   D+ +   T LGPP TPY G  F + I +  
Sbjct: 5   KRIMKEIQAVKDDPAAH----ITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPM 60

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVT 123
           EYP KPP++ F   K+ H NI   TG ICL+IL NA WSPV  L + ++++  LL  P  
Sbjct: 61  EYPFKPPKMQFDT-KVYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLSN 133
           + P + +++ 
Sbjct: 119 NDPQDAEVAQ 128

>ZYRO0G12870g Chr7 complement(1022897..1023296,1023388..1023431)
           [444 bp, 147 aa] {ON} highly similar to uniprot|P15731
           Saccharomyces cerevisiae YBR082C UBC4
           Ubiquitin-conjugating enzyme that mediates degradation
           of short-lived and abnormal proteins interacts with
           E3-CaM in ubiquitinating calmodulin interacts with many
           SCF ubiquitin protein ligases component of the cellular
           stress response
          Length = 147

 Score = 89.4 bits (220), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 54/136 (39%), Positives = 79/136 (58%), Gaps = 8/136 (5%)

Query: 1   MSERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIH 60
           MS +R+ KE      +LG       S  P+  DD+ +W A+I+GPP++PY G  F L IH
Sbjct: 1   MSLKRITKELN----DLGRDPPTSCSAGPV-GDDVYHWQASIMGPPDSPYAGGVFFLSIH 55

Query: 61  LTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSD 120
              +YP KPP++ F+  K+ H NI    G ICL+IL +  WSP   +  V+L+I  LL+D
Sbjct: 56  FPTDYPFKPPKIAFTT-KIYHPNIN-ANGNICLDILKD-QWSPALTISKVLLSICSLLTD 112

Query: 121 PVTDSPLNIDLSNILK 136
              D PL  ++++I K
Sbjct: 113 ANPDDPLVPEIAHIYK 128

>Suva_2.343 Chr2 (608195..608842) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 90.9 bits (224), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 74/130 (56%), Gaps = 6/130 (4%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +R++KE Q VK +   H     +LE +   D+ +   T LGPP TPY G  F + I +  
Sbjct: 5   KRIMKEIQAVKDDPAAH----ITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPM 60

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVT 123
           EYP KPP++ F   K+ H NI   TG ICL+IL NA WSPV  L + ++++  LL  P  
Sbjct: 61  EYPFKPPKMQFDT-KVYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLSN 133
           + P + +++ 
Sbjct: 119 NDPQDAEVAQ 128

>Smik_4.425 Chr4 (772926..773573) [648 bp, 215 aa] {ON} YDR177W
           (REAL)
          Length = 215

 Score = 90.9 bits (224), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 74/130 (56%), Gaps = 6/130 (4%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +R++KE Q VK +   H     +LE +   D+ +   T LGPP TPY G  F + I +  
Sbjct: 5   KRIMKEIQAVKDDPAAH----ITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPM 60

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVT 123
           EYP KPP++ F   K+ H NI   TG ICL+IL NA WSPV  L + ++++  LL  P  
Sbjct: 61  EYPFKPPKMQFDT-KVYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLSN 133
           + P + +++ 
Sbjct: 119 NDPQDAEVAQ 128

>YDR177W Chr4 (816878..817525) [648 bp, 215 aa] {ON}
           UBC1Ubiquitin-conjugating enzyme that mediates selective
           degradation of short-lived and abnormal proteins; plays
           a role in vesicle biogenesis and ER-associated protein
           degradation (ERAD); component of the cellular stress
           response
          Length = 215

 Score = 90.9 bits (224), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 50/130 (38%), Positives = 74/130 (56%), Gaps = 6/130 (4%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +R++KE Q VK +   H     +LE +   D+ +   T LGPP TPY G  F + I +  
Sbjct: 5   KRIMKEIQAVKDDPAAH----ITLEFVSESDIHHLKGTFLGPPGTPYEGGKFVVDIEVPM 60

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVT 123
           EYP KPP++ F   K+ H NI   TG ICL+IL NA WSPV  L + ++++  LL  P  
Sbjct: 61  EYPFKPPKMQFDT-KVYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLSN 133
           + P + +++ 
Sbjct: 119 NDPQDAEVAQ 128

>Suva_2.218 Chr2 complement(369003..369402,369494..369540) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 88.6 bits (218), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/135 (40%), Positives = 77/135 (57%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           S +R+ KE      +LG       S  P+  DDL +W A+I+GP ++PY G  F L IH 
Sbjct: 3   SSKRIAKELS----DLGRDPPASCSAGPV-GDDLYHWQASIMGPSDSPYAGGVFFLSIHF 57

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             +YP KPP+V F+  K+ H NI   +G ICL+IL +  WSP   L  V+L+I  LL+D 
Sbjct: 58  PTDYPFKPPKVNFTT-KIYHPNIN-SSGNICLDILKD-QWSPALTLSKVLLSICSLLTDA 114

Query: 122 VTDSPLNIDLSNILK 136
             D PL  +++ I K
Sbjct: 115 NPDDPLVPEIAQIYK 129

>Skud_4.314 Chr4 complement(545266..545665,545759..545805) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 88.6 bits (218), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/135 (40%), Positives = 77/135 (57%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           S +R+ KE      +LG       S  P+  DDL +W A+I+GP ++PY G  F L IH 
Sbjct: 3   SSKRIAKELS----DLGRDPPASCSAGPV-GDDLYHWQASIMGPSDSPYAGGVFFLSIHF 57

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             +YP KPP+V F+  K+ H NI   +G ICL+IL +  WSP   L  V+L+I  LL+D 
Sbjct: 58  PTDYPFKPPKVNFTT-KIYHPNIN-SSGNICLDILKD-QWSPALTLSKVLLSICSLLTDA 114

Query: 122 VTDSPLNIDLSNILK 136
             D PL  +++ I K
Sbjct: 115 NPDDPLVPEIAQIYK 129

>YDR059C Chr4 complement(569234..569633,569724..569770) [447 bp, 148
           aa] {ON}  UBC5Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived, abnormal, or
           excess proteins, including histone H3; central component
           of the cellular stress response; expression is heat
           inducible
          Length = 148

 Score = 88.6 bits (218), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 55/135 (40%), Positives = 77/135 (57%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           S +R+ KE      +LG       S  P+  DDL +W A+I+GP ++PY G  F L IH 
Sbjct: 3   SSKRIAKELS----DLGRDPPASCSAGPV-GDDLYHWQASIMGPSDSPYAGGVFFLSIHF 57

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             +YP KPP+V F+  K+ H NI   +G ICL+IL +  WSP   L  V+L+I  LL+D 
Sbjct: 58  PTDYPFKPPKVNFTT-KIYHPNIN-SSGNICLDILKD-QWSPALTLSKVLLSICSLLTDA 114

Query: 122 VTDSPLNIDLSNILK 136
             D PL  +++ I K
Sbjct: 115 NPDDPLVPEIAQIYK 129

>ADR169C Chr4 complement(1000734..1001369) [636 bp, 211 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YDR177W
           (UBC1)
          Length = 211

 Score = 90.1 bits (222), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/130 (40%), Positives = 76/130 (58%), Gaps = 6/130 (4%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +RL+KE Q VK +     NI  SL  +   D+ +   T LGPP TPYHG +F + I +  
Sbjct: 5   KRLMKEIQSVKDD--PDANI--SLAFVSESDIHHLKGTFLGPPGTPYHGGTFIVDIQVPL 60

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVT 123
           EYP KPP++ F   K+ H NI   TG ICL+IL N+ WSPV  L T ++++  LL  P  
Sbjct: 61  EYPFKPPKMQFDT-KVYHPNISSVTGAICLDILKNS-WSPVLTLKTSLISLQALLQSPEP 118

Query: 124 DSPLNIDLSN 133
           + P + +++ 
Sbjct: 119 NDPQDAEVAK 128

>Ecym_6038 Chr6 (73539..74174) [636 bp, 211 aa] {ON} similar to
           Ashbya gossypii ADR169C
          Length = 211

 Score = 90.1 bits (222), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 53/129 (41%), Positives = 75/129 (58%), Gaps = 6/129 (4%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +RL+KE Q VK +     NI  SL  +   D+ +   T LGPP TPYHG  F + I +  
Sbjct: 5   KRLMKEIQSVKDD--PDANI--SLSFVSESDIHHLKGTFLGPPGTPYHGGKFVVDIQVPL 60

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVT 123
           EYP KPP++ F   K+ H NI   TG ICL+IL N+ WSPV  L T ++++  LL  P  
Sbjct: 61  EYPFKPPKMQFDT-KVYHPNISSVTGAICLDILKNS-WSPVLTLKTSLISLQALLQSPEP 118

Query: 124 DSPLNIDLS 132
           + P + +++
Sbjct: 119 NDPQDAEVA 127

>Smik_4.297 Chr4 complement(535773..536172,536260..536306) [447 bp,
           148 aa] {ON} YDR059C (REAL)
          Length = 148

 Score = 88.2 bits (217), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 54/135 (40%), Positives = 77/135 (57%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           S +R+ KE      +LG       S  P+  DDL +W A+I+GP ++PY G  F L IH 
Sbjct: 3   SSKRIAKELS----DLGRDPPASCSAGPV-GDDLYHWQASIMGPSDSPYAGGVFFLSIHF 57

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             +YP KPP+V F+  K+ H NI   +G ICL+IL +  WSP   L  V+L++  LL+D 
Sbjct: 58  PTDYPFKPPKVNFTT-KIYHPNIN-SSGNICLDILKD-QWSPALTLSKVLLSVCSLLTDA 114

Query: 122 VTDSPLNIDLSNILK 136
             D PL  +++ I K
Sbjct: 115 NPDDPLVPEIAQIYK 129

>CAGL0E00671g Chr5 complement(61697..62338) [642 bp, 213 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177w E2 ubiquitin-conjugating enzyme
          Length = 213

 Score = 89.7 bits (221), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 76/130 (58%), Gaps = 6/130 (4%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +R++KE Q VK +     NI  SLE +   D+ +   + LGPP TPY G  F + I +  
Sbjct: 5   KRIMKELQAVKDD--PEANI--SLEFVSESDIHHLKGSFLGPPGTPYEGGKFIVDIEVPM 60

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVT 123
           EYP KPP++ F + K+ H NI   TG ICL+IL NA WSPV  L + ++++  LL  P  
Sbjct: 61  EYPFKPPKMKFDS-KVYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLSN 133
           + P + +++ 
Sbjct: 119 NDPQDAEVAQ 128

>TBLA0I02130 Chr9 complement(489054..489453,489732..489778) [447 bp,
           148 aa] {ON} 
          Length = 148

 Score = 87.4 bits (215), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 53/135 (39%), Positives = 79/135 (58%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           S +R+ KE      +LG       S  P+  DD+ +W A+I+GPP++PY G  F L IH 
Sbjct: 3   SLKRITKELN----DLGRDPPTSCSAGPV-GDDIYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             +YP KPP+++F+  K+ H NI    G ICL+IL +  WSP   +  V+L+I  LL+D 
Sbjct: 58  PTDYPFKPPKISFTT-KIYHPNIN-ANGNICLDILKD-QWSPALTISKVLLSICSLLTDA 114

Query: 122 VTDSPLNIDLSNILK 136
             D PL  ++++I K
Sbjct: 115 NPDDPLVPEIAHIYK 129

>KNAG0J02340 Chr10 complement(439355..439840) [486 bp, 161 aa] {ON} 
          Length = 161

 Score = 87.4 bits (215), Expect = 8e-22,   Method: Compositional matrix adjust.
 Identities = 54/129 (41%), Positives = 78/129 (60%), Gaps = 7/129 (5%)

Query: 17  LGNHKNIISSLE--PIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTF 74
             + ++ ISS    P+  DDL +W A+I+GPP++PY G  F L IH   +YP KPP+++F
Sbjct: 25  FSSQRDPISSFSAGPV-GDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISF 83

Query: 75  SAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNI 134
           +  K+ H NI    G ICL+IL +  WSP   L  V+L+I  LL+D   D PL  ++++I
Sbjct: 84  TT-KIYHPNIN-ANGNICLDILKD-QWSPALTLSKVLLSICSLLTDANPDDPLVPEIAHI 140

Query: 135 LKIKDTSAY 143
            K  D S Y
Sbjct: 141 YKT-DRSKY 148

>ZYRO0C03784g Chr3 (301102..301758) [657 bp, 218 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 218

 Score = 88.6 bits (218), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 51/130 (39%), Positives = 74/130 (56%), Gaps = 6/130 (4%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +RL+KE Q V+ +     NI  +LE I   D+     + LGPP TPY G  F + I +  
Sbjct: 5   KRLMKELQAVRDDPA--ANI--TLEFISESDIHRLKGSFLGPPETPYQGGRFIIDIEVPM 60

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVT 123
           EYP KPP++ F   K+ H NI   TG ICL+IL NA WSPV  L + ++++  LL  P  
Sbjct: 61  EYPFKPPKMKFDT-KVYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLSN 133
           + P + +++ 
Sbjct: 119 NDPQDAEVAQ 128

>Kpol_1030.10 s1030 complement(21147..21794) [648 bp, 215 aa] {ON}
           complement(21147..21794) [648 nt, 216 aa]
          Length = 215

 Score = 88.6 bits (218), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 49/130 (37%), Positives = 74/130 (56%), Gaps = 6/130 (4%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +R++KE Q VK +   + N    LE +   D+ +   + LGPP TPY G  F + I +  
Sbjct: 5   KRIMKEMQAVKDDPAANIN----LEFVSESDIHHLKGSFLGPPETPYQGGRFIVDIEVPM 60

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVT 123
           EYP KPP++ F   K+ H NI   TG ICL+IL NA WSPV  L + ++++  LL  P  
Sbjct: 61  EYPFKPPKMKFDT-KVYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLSN 133
           + P + +++ 
Sbjct: 119 NDPQDAEVAQ 128

>TPHA0A03850 Chr1 (846488..846534,846907..847306) [447 bp, 148 aa]
           {ON} Anc_3.308 YBR082C
          Length = 148

 Score = 86.3 bits (212), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 79/135 (58%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           S +R+ KE      +LG       S  P+  DD+ +W A+I+GPP++PY G  F L IH 
Sbjct: 3   SLKRITKELN----DLGRDPPTSCSAGPV-GDDIYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             +YP KPP+++F+  K+ H NI    G ICL+IL +  WSP   +  V+L+I  LL+D 
Sbjct: 58  PTDYPFKPPKISFTT-KIYHPNIN-ANGNICLDILKD-QWSPALTISKVLLSICSLLTDA 114

Query: 122 VTDSPLNIDLSNILK 136
             D PL  +++++ K
Sbjct: 115 NPDDPLVPEIAHLYK 129

>Kpol_1052.2 s1052 (6121..6167,6406..6805) [447 bp, 148 aa] {ON}
           (6121..6167,6406..6805) [447 nt, 149 aa]
          Length = 148

 Score = 86.3 bits (212), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 79/135 (58%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           S +R+ KE      +LG       S  P+  DD+ +W A+I+GPP++PY G  F L IH 
Sbjct: 3   SLKRITKELN----DLGRDPPTSCSAGPV-GDDVYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             +YP KPP+++F+  K+ H NI    G ICL+IL +  WSP   +  V+L+I  LL+D 
Sbjct: 58  PTDYPFKPPKISFTT-KIYHPNIN-ANGNICLDILKD-QWSPALTISKVLLSICSLLTDA 114

Query: 122 VTDSPLNIDLSNILK 136
             D PL  +++++ K
Sbjct: 115 NPDDPLVPEIAHLYK 129

>KLLA0E12563g Chr5 (1117022..1117068,1117342..1117741) [447 bp, 148
           aa] {ON} highly similar to uniprot|P15731 Saccharomyces
           cerevisiae YBR082C UBC4 Ubiquitin-conjugating enzyme
           that mediates degradation of short-lived and abnormal
           proteins interacts with E3-CaM in ubiquitinating
           calmodulin interacts with many SCF ubiquitin protein
           ligases component of the cellular stress response
          Length = 148

 Score = 86.3 bits (212), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 79/135 (58%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           S +R+ KE      +LG       S  P+  DD+ +W A+I+GPP++PY G  F L IH 
Sbjct: 3   SLKRITKELN----DLGRDPPTSCSAGPV-GDDVYHWQASIMGPPDSPYAGGVFFLSIHF 57

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             +YP KPP+++F+  K+ H NI    G ICL+IL +  WSP   +  V+L+I  LL+D 
Sbjct: 58  PTDYPFKPPKISFTT-KIYHPNIN-ANGNICLDILKD-QWSPALTISKVLLSICSLLTDA 114

Query: 122 VTDSPLNIDLSNILK 136
             D PL  +++++ K
Sbjct: 115 NPDDPLVPEIAHLYK 129

>TBLA0H03130 Chr8 (763830..764474) [645 bp, 214 aa] {ON} Anc_8.375
           YDR177W
          Length = 214

 Score = 87.0 bits (214), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 49/130 (37%), Positives = 76/130 (58%), Gaps = 6/130 (4%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +R++KE Q VK +     NI  +L+ ++  D+ +   + LGPP TPY G  F + I +  
Sbjct: 5   KRIMKEMQAVKDDPA--ANI--TLDFVNESDIHHLKGSFLGPPGTPYEGGRFMIDIEVPM 60

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVT 123
           EYP KPP++ F   K+ H NI   TG ICL+IL NA WSPV  L + ++++  LL  P  
Sbjct: 61  EYPFKPPKMKFDT-KVYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLSN 133
           + P + +++ 
Sbjct: 119 NDPQDAEVAQ 128

>Suva_4.326 Chr4 complement(575255..575654,575770..575816) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 85.1 bits (209), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 55/142 (38%), Positives = 82/142 (57%), Gaps = 9/142 (6%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           S +R+ KE   ++++         S  P+  DDL +W A+I+GP ++PY G  F L IH 
Sbjct: 3   SSKRIAKELSDLERDPPTS----CSAGPV-GDDLYHWQASIMGPADSPYAGGVFFLSIHF 57

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             +YP KPP+++F+  K+ H NI    G ICL+IL +  WSP   L  V+L+I  LL+D 
Sbjct: 58  PTDYPFKPPKISFTT-KIYHPNIN-ANGNICLDILKD-QWSPALTLSKVLLSICSLLTDA 114

Query: 122 VTDSPLNIDLSNILKIKDTSAY 143
             D PL  ++++I K  D S Y
Sbjct: 115 NPDDPLVPEIAHIYKT-DRSKY 135

>NCAS0B03150 Chr2 complement(544870..545514) [645 bp, 214 aa] {ON} 
          Length = 214

 Score = 86.3 bits (212), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 48/130 (36%), Positives = 72/130 (55%), Gaps = 6/130 (4%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +R++KE Q VK    +       LE ++  D+ +   + LGPP TPY G  F + I +  
Sbjct: 5   KRIMKELQAVK----DDPEARIELEFVNESDIHHLKGSFLGPPGTPYEGGQFIVDIEVPM 60

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVT 123
           EYP KPP + F   K+ H NI   TG ICL+IL NA WSPV  L + ++++  LL  P  
Sbjct: 61  EYPFKPPMMKFDT-KVYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLSN 133
           + P + +++ 
Sbjct: 119 NDPQDAEVAQ 128

>Skud_2.207 Chr2 complement(374501..374900,375003..375049) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 84.7 bits (208), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 79/135 (58%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           S +R+ KE   ++++         S  P+  DDL +W A+I+GP ++PY G  F L IH 
Sbjct: 3   SSKRIAKELSDLERDPPTS----CSAGPV-GDDLYHWQASIMGPADSPYAGGVFFLSIHF 57

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             +YP KPP+++F+  K+ H NI    G ICL+IL +  WSP   L  V+L+I  LL+D 
Sbjct: 58  PTDYPFKPPKISFTT-KIYHPNIN-ANGNICLDILKD-QWSPALTLSKVLLSICSLLTDA 114

Query: 122 VTDSPLNIDLSNILK 136
             D PL  ++++I K
Sbjct: 115 NPDDPLVPEIAHIYK 129

>Smik_2.219 Chr2 complement(389737..390136,390239..390285) [447 bp,
           148 aa] {ON} YBR082C (REAL)
          Length = 148

 Score = 84.7 bits (208), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 79/135 (58%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           S +R+ KE   ++++         S  P+  DDL +W A+I+GP ++PY G  F L IH 
Sbjct: 3   SSKRIAKELSDLERDPPTS----CSAGPV-GDDLYHWQASIMGPADSPYAGGVFFLSIHF 57

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             +YP KPP+++F+  K+ H NI    G ICL+IL +  WSP   L  V+L+I  LL+D 
Sbjct: 58  PTDYPFKPPKISFTT-KIYHPNIN-ANGNICLDILKD-QWSPALTLSKVLLSICSLLTDA 114

Query: 122 VTDSPLNIDLSNILK 136
             D PL  ++++I K
Sbjct: 115 NPDDPLVPEIAHIYK 129

>YBR082C Chr2 complement(406628..407027,407123..407169) [447 bp, 148
           aa] {ON}  UBC4Ubiquitin-conjugating enzyme (E2),
           mediates degradation of abnormal or excess proteins,
           including calmodulin and histone H3; interacts with many
           SCF ubiquitin protein ligases; component of the cellular
           stress response
          Length = 148

 Score = 84.7 bits (208), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 52/135 (38%), Positives = 79/135 (58%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           S +R+ KE   ++++         S  P+  DDL +W A+I+GP ++PY G  F L IH 
Sbjct: 3   SSKRIAKELSDLERDPPTS----CSAGPV-GDDLYHWQASIMGPADSPYAGGVFFLSIHF 57

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             +YP KPP+++F+  K+ H NI    G ICL+IL +  WSP   L  V+L+I  LL+D 
Sbjct: 58  PTDYPFKPPKISFTT-KIYHPNIN-ANGNICLDILKD-QWSPALTLSKVLLSICSLLTDA 114

Query: 122 VTDSPLNIDLSNILK 136
             D PL  ++++I K
Sbjct: 115 NPDDPLVPEIAHIYK 129

>NDAI0A01160 Chr1 complement(245057..245707) [651 bp, 216 aa] {ON} 
          Length = 216

 Score = 86.3 bits (212), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 49/140 (35%), Positives = 78/140 (55%), Gaps = 7/140 (5%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +R++KE Q VK    +       LE ++  D+ +   +  GPP TPY G  F + I +  
Sbjct: 5   KRIMKELQAVK----DDPTAKIGLEFVNESDIHHLKGSFFGPPGTPYEGGQFIIDIEVPM 60

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVT 123
           EYP KPP++ F   K+ H NI   TG ICL+IL NA WSPV  L + ++++  LL  P  
Sbjct: 61  EYPFKPPKMKFDT-KVYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLSNILKIKDTSAY 143
           + P + +++    +KD +++
Sbjct: 119 NDPQDAEVAQHY-LKDRASF 137

>TDEL0H03970 Chr8 complement(677619..678089) [471 bp, 156 aa] {ON}
           Anc_7.54 YOR339C
          Length = 156

 Score = 84.7 bits (208), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 62/100 (62%), Gaps = 3/100 (3%)

Query: 29  PIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKT 88
           P   DDLT W   I+GP  TPY    F L +  T +YP +PP+VTF +  M H N++  +
Sbjct: 33  PASEDDLTQWFGVIVGPEGTPYENLKFRLSLKFTDQYPYQPPKVTFVS-PMWHPNVDM-S 90

Query: 89  GKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLN 128
           G ICL+IL +  WS V+N+ T++L++  LL +P   SPLN
Sbjct: 91  GNICLDILKD-QWSAVYNVQTILLSLQALLEEPNNGSPLN 129

>TDEL0F04990 Chr6 (941804..942457) [654 bp, 217 aa] {ON} Anc_8.375
           YDR177W
          Length = 217

 Score = 85.9 bits (211), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 51/138 (36%), Positives = 78/138 (56%), Gaps = 7/138 (5%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +R++KE Q VK +     N    LE +   D+ +   + LGPP TPY G  F + I +  
Sbjct: 5   KRIMKEMQAVKDDPAAKIN----LEFVTESDIHHLKGSFLGPPGTPYDGGLFIVDIEVPM 60

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVT 123
           EYP KPP++ F   K+ H N+   TG ICL+IL NA WSPV  L + ++++  LL  P  
Sbjct: 61  EYPFKPPKMKFDT-KVYHPNVSSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLSN-ILKIKDT 140
           + P + +++   L+ KD+
Sbjct: 119 NDPQDAEVAQHYLRDKDS 136

>Kwal_27.12401 s27 complement(1209894..1210604) [711 bp, 236 aa]
           {ON} YBR082C (UBC4) - 1:1 [contig 457] FULL
          Length = 236

 Score = 85.9 bits (211), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 46/105 (43%), Positives = 67/105 (63%), Gaps = 3/105 (2%)

Query: 32  SDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKI 91
            DDL +W A+I+GPP++PY G  F L IH   +YP KPP+++F+  K+ H NI    G I
Sbjct: 116 GDDLYHWQASIMGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNI 173

Query: 92  CLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNILK 136
           CL+IL +  WSP   +  V+L+I  LL+D   D PL  ++++I K
Sbjct: 174 CLDILKD-QWSPALTISKVLLSICSLLTDANPDDPLVPEIAHIYK 217

>TPHA0L00850 Chr12 (168648..169298) [651 bp, 216 aa] {ON} Anc_8.375
           YDR177W
          Length = 216

 Score = 84.3 bits (207), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 48/130 (36%), Positives = 74/130 (56%), Gaps = 6/130 (4%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +R++KE + V+ +     NI   LE +   D+ +   + LGPP TPY G  F + I +  
Sbjct: 5   KRIMKEMEAVRDD--PEANI--DLEFVSEADIHHLKGSFLGPPETPYEGGKFIVDIEVPM 60

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVT 123
           EYP KPP++ F   K+ H NI   TG ICL+IL NA WSPV  L + ++++  LL  P  
Sbjct: 61  EYPFKPPKMKFDT-KVYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLSN 133
           + P + +++ 
Sbjct: 119 NDPQDAEVAQ 128

>SAKL0A00396g Chr1 complement(43630..44277) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P21734 Saccharomyces
           cerevisiae YDR177W UBC1 Ubiquitin-conjugating enzyme
           that mediates selective degradation of short-lived and
           abnormal proteins plays a role in vesicle biogenesis and
           ER- associated protein degradation (ERAD) component of
           the cellular stress response
          Length = 215

 Score = 84.3 bits (207), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 50/140 (35%), Positives = 78/140 (55%), Gaps = 7/140 (5%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +R++KE Q  K +     NI  S   +   D+ +   +  GPP TPY G +F + I +  
Sbjct: 5   KRIIKEIQAAKDD--PEANITLSF--VSESDIHHLKGSFYGPPGTPYEGGNFIVDIQVPL 60

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVT 123
           EYP KPP++ F   K+ H NI   TG ICL+IL NA WSPV  L + ++++  LL  P  
Sbjct: 61  EYPFKPPKMQFDT-KVYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLSNILKIKDTSAY 143
           + P + +++    I+D S++
Sbjct: 119 NDPQDAEVAQHF-IRDKSSF 137

>KNAG0A04810 Chr1 complement(689230..689874) [645 bp, 214 aa] {ON}
           Anc_8.375 YDR177W
          Length = 214

 Score = 84.3 bits (207), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 73/130 (56%), Gaps = 6/130 (4%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +R++KE Q VK +   H     +LE ++  D+ +   T  GPP TPY    F + I +  
Sbjct: 5   KRIMKEMQAVKDDPEAH----ITLEFVNESDIHHLKGTFQGPPETPYDRGQFVVDIEVPM 60

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVT 123
           EYP KPP++ F   K+ H N+   TG ICL+IL NA WSPV  L + ++++  LL  P  
Sbjct: 61  EYPFKPPKMKFDT-KVYHPNVSSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLSN 133
           + P + +++ 
Sbjct: 119 NDPQDAEVAQ 128

>Kpol_461.8 s461 (14306..14809) [504 bp, 167 aa] {ON} (14306..14809)
           [504 nt, 168 aa]
          Length = 167

 Score = 83.2 bits (204), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 81/135 (60%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           + RRL+++++ +K++      + +S  P   D++  W A I+GP +TPY   +F L +  
Sbjct: 5   ARRRLMRDFKRMKEDAP--PGVSASPLP---DNVMVWNAMIIGPADTPYEDGTFRLLLEF 59

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             EYP KPP V F + +M H N+ +  G+ICL+IL N  W+P +++ +++ +I  L +DP
Sbjct: 60  DEEYPNKPPHVKFVS-EMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDP 116

Query: 122 VTDSPLNIDLSNILK 136
              SP N++ + + K
Sbjct: 117 NPASPANVEAATLFK 131

>KAFR0B06060 Chr2 (1251667..1252308) [642 bp, 213 aa] {ON} Anc_8.375
           YDR177W
          Length = 213

 Score = 84.0 bits (206), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 47/130 (36%), Positives = 73/130 (56%), Gaps = 6/130 (4%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +R++KE Q VK    +      +LE +   D+ +   + +GPP TPY   +F + I +  
Sbjct: 5   KRIMKELQAVK----DDPEAKITLEFVIESDIHHLKGSFIGPPGTPYENGAFVVDIEVPM 60

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVT 123
           EYP KPPQ+ F   K+ H NI   TG ICL+IL NA WSPV  L + ++++  LL  P  
Sbjct: 61  EYPFKPPQMKFDT-KVYHPNISSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLSN 133
           + P + +++ 
Sbjct: 119 NDPQDAEVAQ 128

>YGL058W Chr7 (393986..394504) [519 bp, 172 aa] {ON}
           RAD6Ubiquitin-conjugating enzyme (E2), involved in
           postreplication repair (as a heterodimer with Rad18p),
           DSBR and checkpoint control (as a heterodimer with
           Bre1p), ubiquitin-mediated N-end rule protein
           degradation (as a heterodimer with Ubr1p
          Length = 172

 Score = 82.8 bits (203), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 81/135 (60%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           + RRL+++++ +K++      + +S  P   D++  W A I+GP +TPY   +F L +  
Sbjct: 5   ARRRLMRDFKRMKEDAP--PGVSASPLP---DNVMVWNAMIIGPADTPYEDGTFRLLLEF 59

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             EYP KPP V F + +M H N+ +  G+ICL+IL N  W+P +++ +++ +I  L +DP
Sbjct: 60  DEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDP 116

Query: 122 VTDSPLNIDLSNILK 136
              SP N++ + + K
Sbjct: 117 NPASPANVEAATLFK 131

>Smik_7.222 Chr7 (388521..389036) [516 bp, 171 aa] {ON} YGL058W
           (REAL)
          Length = 171

 Score = 82.8 bits (203), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 81/135 (60%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           + RRL+++++ +K++      + +S  P   D++  W A I+GP +TPY   +F L +  
Sbjct: 5   ARRRLMRDFKRMKEDAP--PGVSASPLP---DNVMVWNAMIIGPADTPYEDGTFRLLLEF 59

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             EYP KPP V F + +M H N+ +  G+ICL+IL N  W+P +++ +++ +I  L +DP
Sbjct: 60  DEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDP 116

Query: 122 VTDSPLNIDLSNILK 136
              SP N++ + + K
Sbjct: 117 NPASPANVEAATLFK 131

>ZYRO0C04950g Chr3 (389805..389846,389914..390378) [507 bp, 168 aa]
           {ON} similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058W RAD6 Ubiquitin-conjugating enzyme (E2) involved
           in postreplication repair (with Rad18p) sporulation
           telomere silencing and ubiquitin-mediated N-end rule
           protein degradation (with Ubr1p)
          Length = 168

 Score = 82.4 bits (202), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 81/135 (60%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           + RRL+++++ +K++      + +S  P   D++  W A I+GP +TPY   +F L +  
Sbjct: 5   ARRRLMRDFKRMKEDAP--PGVSASPLP---DNVMVWNAMIIGPADTPYEDGTFRLLLEF 59

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             EYP KPP V F + +M H N+ +  G+ICL+IL N  W+P +++ +++ +I  L +DP
Sbjct: 60  DEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDP 116

Query: 122 VTDSPLNIDLSNILK 136
              SP N++ + + K
Sbjct: 117 NPASPANVEAATLFK 131

>SAKL0A07260g Chr1 (644551..644592,644678..645145) [510 bp, 169 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 169

 Score = 82.4 bits (202), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 81/135 (60%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           + RRL+++++ +K++      + +S  P   D++  W A I+GP +TPY   +F L +  
Sbjct: 5   ARRRLMRDFKRMKEDAP--PGVSASPLP---DNVMVWNAMIIGPADTPYEDGTFRLLLEF 59

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             EYP KPP V F + +M H N+ +  G+ICL+IL N  W+P +++ +++ +I  L +DP
Sbjct: 60  DEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDP 116

Query: 122 VTDSPLNIDLSNILK 136
              SP N++ + + K
Sbjct: 117 NPASPANVEAATLFK 131

>Suva_7.213 Chr7 (387129..387650) [522 bp, 173 aa] {ON} YGL058W
           (REAL)
          Length = 173

 Score = 82.8 bits (203), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 81/135 (60%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           + RRL+++++ +K++      + +S  P   D++  W A I+GP +TPY   +F L +  
Sbjct: 5   ARRRLMRDFKRMKEDAP--PGVSASPLP---DNVMVWNAMIIGPADTPYEDGTFRLLLEF 59

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             EYP KPP V F + +M H N+ +  G+ICL+IL N  W+P +++ +++ +I  L +DP
Sbjct: 60  DEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDP 116

Query: 122 VTDSPLNIDLSNILK 136
              SP N++ + + K
Sbjct: 117 NPASPANVEAATLFK 131

>TDEL0G03610 Chr7 (667177..667218,667282..667749) [510 bp, 169 aa]
           {ON} Anc_6.109 YGL058W
          Length = 169

 Score = 82.4 bits (202), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 81/135 (60%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           + RRL+++++ +K++      + +S  P   D++  W A I+GP +TPY   +F L +  
Sbjct: 5   ARRRLMRDFKRMKEDAP--PGVSASPLP---DNVMVWNAMIIGPADTPYEDGTFRLLLEF 59

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             EYP KPP V F + +M H N+ +  G+ICL+IL N  W+P +++ +++ +I  L +DP
Sbjct: 60  DEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDP 116

Query: 122 VTDSPLNIDLSNILK 136
              SP N++ + + K
Sbjct: 117 NPASPANVEAATLFK 131

>Ecym_3077 Chr3 (145205..145717) [513 bp, 170 aa] {ON} similar to
           Ashbya gossypii AAR156C
          Length = 170

 Score = 82.4 bits (202), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 81/135 (60%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           + RRL+++++ +K++      + +S  P   D++  W A I+GP +TPY   +F L +  
Sbjct: 5   ARRRLMRDFKRMKEDAP--PGVSASPLP---DNVMVWNAMIIGPADTPYEDGTFRLLLEF 59

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             EYP KPP V F + +M H N+ +  G+ICL+IL N  W+P +++ +++ +I  L +DP
Sbjct: 60  DEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDP 116

Query: 122 VTDSPLNIDLSNILK 136
              SP N++ + + K
Sbjct: 117 NPASPANVEAATLFK 131

>AAR156C Chr1 complement(626372..626884) [513 bp, 170 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL058W
           (RAD6)
          Length = 170

 Score = 82.4 bits (202), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 81/135 (60%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           + RRL+++++ +K++      + +S  P   D++  W A I+GP +TPY   +F L +  
Sbjct: 5   ARRRLMRDFKRMKEDAP--PGVSASPLP---DNVMVWNAMIIGPADTPYEDGTFRLLLEF 59

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             EYP KPP V F + +M H N+ +  G+ICL+IL N  W+P +++ +++ +I  L +DP
Sbjct: 60  DEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDP 116

Query: 122 VTDSPLNIDLSNILK 136
              SP N++ + + K
Sbjct: 117 NPASPANVEAATLFK 131

>NCAS0D03220 Chr4 (604785..605300) [516 bp, 171 aa] {ON} Anc_6.109
          Length = 171

 Score = 82.0 bits (201), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           + RRL+++++ +K++      + +S  P   D++  W A I+GP  TPY   +F L +  
Sbjct: 5   ARRRLMRDFKRMKEDAP--PGVSASPLP---DNVMVWNAMIIGPAETPYEDGTFRLLLEF 59

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             EYP KPP V F + +M H N+ +  G+ICL+IL N  W+P +++ +++ +I  L +DP
Sbjct: 60  DEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDP 116

Query: 122 VTDSPLNIDLSNILK 136
              SP N++ + + K
Sbjct: 117 NPASPANVEAATLFK 131

>Skud_15.504 Chr15 complement(898776..899246) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 81.6 bits (200), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 47/115 (40%), Positives = 68/115 (59%), Gaps = 4/115 (3%)

Query: 29  PIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKT 88
           P+D +DLT WT  I+GP  TPY    F + ++    YP  PP+V F +  M H N++ K+
Sbjct: 32  PVDDNDLTYWTGYIMGPQGTPYSDLKFKISLNFPENYPFHPPKVKFVS-PMWHPNVD-KS 89

Query: 89  GKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNILKIKDTSAY 143
           G ICL+IL    WS V+N+ T++L++  LL +P   SPLN  ++  L  KD   Y
Sbjct: 90  GNICLDIL-KEKWSAVYNVETILLSLQSLLGEPNNRSPLNA-VAAELWDKDMEGY 142

>TBLA0F02440 Chr6 complement(594780..595304) [525 bp, 174 aa] {ON}
           Anc_6.109 YGL058W
          Length = 174

 Score = 82.4 bits (202), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 84/143 (58%), Gaps = 10/143 (6%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           + RRL+++++ +K +  +   I +S  P   D++  W A I+GP +TPY   +F L +  
Sbjct: 5   ARRRLMRDFKRIKSD--SPPGISASPLP---DNVMLWNAMIIGPSDTPYEDGTFRLVLEF 59

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             EYP KPP V F + +M H N+ +  G+ICL+IL N  W+P +++ +++ +I  L +DP
Sbjct: 60  DEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQN-RWTPTYDVSSILTSIQSLFNDP 116

Query: 122 VTDSPLNIDLSNILKIKDTSAYY 144
              SP N++ + +   KD  A Y
Sbjct: 117 NPASPANVEAATLF--KDHRAQY 137

>TPHA0J01750 Chr10 complement(404340..404849) [510 bp, 169 aa] {ON}
           Anc_6.109 YGL058W
          Length = 169

 Score = 81.6 bits (200), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 45/135 (33%), Positives = 80/135 (59%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           + RRL+++++ +K++      +  S  P   D++  W A I+GP +TPY   +F L +  
Sbjct: 5   ARRRLMRDFKRMKEDAP--PGVSGSPLP---DNVMIWNAMIIGPSDTPYEDGTFRLLLEF 59

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             EYP KPP V F + +M H N+ +  G+ICL+IL N  W+P +++ +++ +I  L +DP
Sbjct: 60  DEEYPNKPPHVKFIS-EMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDP 116

Query: 122 VTDSPLNIDLSNILK 136
              SP N++ + + K
Sbjct: 117 NPASPANVEAATLFK 131

>Smik_15.517 Chr15 complement(907953..908423) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 81.3 bits (199), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 61/100 (61%), Gaps = 3/100 (3%)

Query: 29  PIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKT 88
           P+D +DLT W   I GP  TPY G  F + ++    YP  PP++ F +  M H N++ K+
Sbjct: 32  PVDDNDLTYWVGYITGPQGTPYSGLKFKISLNFPENYPFHPPKIKFVS-PMWHPNVD-KS 89

Query: 89  GKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLN 128
           G ICL+IL    WS V+N+ T++L++  LL +P   SPLN
Sbjct: 90  GNICLDILKE-KWSAVYNVETILLSLQSLLGEPNNKSPLN 128

>KLLA0C05632g Chr3 complement(503484..503978) [495 bp, 164 aa] {ON}
           highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 164

 Score = 81.3 bits (199), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 82/135 (60%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           + RRL+++++ +K++  +   + +S  P   D++  W A I+GP +TPY   +F L +  
Sbjct: 5   ARRRLMRDFKRMKED--SPPGVSASPLP---DNVMIWNAMIIGPADTPYEDGTFRLLLEF 59

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             EYP KPP V F + +M H N+ +  G+ICL+IL N  W+P +++ +++ +I  L +DP
Sbjct: 60  DEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDP 116

Query: 122 VTDSPLNIDLSNILK 136
              SP N++ + + +
Sbjct: 117 NPASPANVEAATLFQ 131

>CAGL0I00352g Chr9 (26900..27403) [504 bp, 167 aa] {ON} highly
           similar to uniprot|P06104 Saccharomyces cerevisiae
           YGL058w RAD6 E2 ubiquitin-conjugating
          Length = 167

 Score = 81.3 bits (199), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 82/135 (60%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           + RRL+++++ +K++  +   + +S  P   D++  W A I+GP +TPY   +F L +  
Sbjct: 5   ARRRLMRDFKRMKED--SPPGVSASPLP---DNVMVWNAMIIGPADTPYEDGTFRLLLEF 59

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             +YP KPP V F + +M H N+ +  G+ICL+IL N  W+P +++ +++ +I  L +DP
Sbjct: 60  DEDYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDP 116

Query: 122 VTDSPLNIDLSNILK 136
              SP N++ + + K
Sbjct: 117 NPASPANVEAATLFK 131

>NDAI0E03870 Chr5 complement(850773..851267) [495 bp, 164 aa] {ON}
           Anc_7.54
          Length = 164

 Score = 80.9 bits (198), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 44/100 (44%), Positives = 62/100 (62%), Gaps = 3/100 (3%)

Query: 29  PIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKT 88
           P D +DLT+W+A I GP +TPY G  F L    +  YP  PP V F +  M H N++  +
Sbjct: 40  PNDEEDLTHWSAIITGPKDTPYDGLRFKLSFQFSDSYPYAPPLVKFIS-PMWHPNVDM-S 97

Query: 89  GKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLN 128
           G ICL+IL +  WS V+N+ T++L++  LL +P   SPLN
Sbjct: 98  GNICLDILKD-QWSAVYNVETILLSLQALLEEPNNSSPLN 136

>ZYRO0E06358g Chr5 (484003..484500) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 80.5 bits (197), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 82/141 (58%), Gaps = 18/141 (12%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           +++RLLKE Q + K+  +   I++   P   +DL  W   I GPP+TPY G  F+ ++  
Sbjct: 5   AQKRLLKELQQLMKD--SSTGIVAG--PRSENDLFVWDCLIQGPPDTPYEGGIFNAKLEF 60

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL----DNAN--------WSPVWNLLT 109
             +YPL PP++TF+   + H NI +  G++C++IL    D+ N        WSPV ++  
Sbjct: 61  PKDYPLSPPKLTFTPSIL-HPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 110 VVLAIYQLLSDPVTDSPLNID 130
           ++L++  +LS+P  +S  N+D
Sbjct: 119 ILLSVMSMLSEPNVESGANVD 139

>KLLA0E07745g Chr5 complement(693694..694191) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022W QRI8 Ubiquitin conjugating enzyme
           involved in the ER-associated protein degradation
           pathway requires Cue1p for recruitment to the ER
           membrane proposed to be involved in chromatin assembly
          Length = 165

 Score = 80.1 bits (196), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 82/141 (58%), Gaps = 18/141 (12%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           +++RLLKE + + K+  + + I++S  PID  +L  W   I+GPP++ Y G  F+ R+  
Sbjct: 5   AQKRLLKELEKLTKD--SPEGILAS--PIDDSNLFQWDCLIMGPPDSCYEGGVFNARLDF 60

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL------------DNANWSPVWNLLT 109
             +YPL PP++TF    + H NI +  G++C++IL            +   WSPV ++  
Sbjct: 61  PKDYPLNPPKLTFQPSIL-HPNI-YPNGEVCISILHSPGSDPNMYEHECERWSPVQSVEM 118

Query: 110 VVLAIYQLLSDPVTDSPLNID 130
           ++L++  +LS+P  +S  NID
Sbjct: 119 ILLSVMSILSEPNIESGANID 139

>YOR339C Chr15 complement(958362..958832) [471 bp, 156 aa] {ON}
           UBC11Ubiquitin-conjugating enzyme most similar in
           sequence to Xenopus ubiquitin-conjugating enzyme E2-C,
           but not a true functional homolog of this E2; unlike
           E2-C, not required for the degradation of mitotic cyclin
           Clb2
          Length = 156

 Score = 79.7 bits (195), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 60/100 (60%), Gaps = 3/100 (3%)

Query: 29  PIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKT 88
           P+D +DLT W   I GP +TPY G  F + +     YP  PP + F +  M H N++ K+
Sbjct: 32  PVDDNDLTYWVGYITGPKDTPYSGLKFKVSLKFPQNYPFHPPMIKFLS-PMWHPNVD-KS 89

Query: 89  GKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLN 128
           G ICL+IL    WS V+N+ T++L++  LL +P   SPLN
Sbjct: 90  GNICLDIL-KEKWSAVYNVETILLSLQSLLGEPNNRSPLN 128

>TPHA0I02460 Chr9 (549215..549718) [504 bp, 167 aa] {ON} Anc_2.569
           YMR022W
          Length = 167

 Score = 79.7 bits (195), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 49/143 (34%), Positives = 82/143 (57%), Gaps = 18/143 (12%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           +++RLLKEYQ + +E  +   I++   P D +++  W   I GPP TPY    F+  +  
Sbjct: 7   AQKRLLKEYQQLIRE--SPPGIVAG--PSDENNMFEWDCLISGPPETPYENGVFNATLLF 62

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL----DNAN--------WSPVWNLLT 109
             +YPL PP++TF+   + H NI +  G++C++IL    D+ N        WSPV ++  
Sbjct: 63  PKDYPLSPPKLTFTPSLL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 120

Query: 110 VVLAIYQLLSDPVTDSPLNIDLS 132
           ++L++  +LS+P  +S  NID S
Sbjct: 121 ILLSVMSMLSEPNIESGANIDAS 143

>KLLA0C18656g Chr3 (1654787..1655473) [687 bp, 228 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 228

 Score = 81.3 bits (199), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 45/132 (34%), Positives = 74/132 (56%), Gaps = 6/132 (4%)

Query: 1   MSERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIH 60
           +  +R+LKE Q VK++          L+ ++  D+ +   + +GP  TPY G  F + I+
Sbjct: 2   LRSKRILKEIQAVKED----PEAQIELKFVNESDIHHMKGSFIGPSGTPYEGGKFVVDIN 57

Query: 61  LTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSD 120
           +  EYP KPPQ+ F   K+ H N+   TG ICL+IL NA W+PV  L + ++++  LL  
Sbjct: 58  IPVEYPYKPPQMKFDT-KVYHPNVSSVTGAICLDILKNA-WTPVITLKSALISLQALLQS 115

Query: 121 PVTDSPLNIDLS 132
           P  + P +  ++
Sbjct: 116 PEPNDPQDAQVA 127

>Ecym_4578 Chr4 complement(1130475..1130972) [498 bp, 165 aa] {ON}
           similar to Ashbya gossypii ABR059W
          Length = 165

 Score = 79.7 bits (195), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 82/141 (58%), Gaps = 18/141 (12%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           +++RL+KE Q + K+    + I++   P++ +++  W   I GPP++PY G  F+ R+  
Sbjct: 5   AQKRLMKEMQQLLKDC--PEGIVAG--PVNEENMFLWDCLIAGPPDSPYEGGIFNARLQF 60

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL------------DNANWSPVWNLLT 109
             +YPL PP++TF+   + H N+ +  G++C++IL             +  WSPV ++  
Sbjct: 61  PTDYPLSPPKLTFTPSIL-HPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEK 118

Query: 110 VVLAIYQLLSDPVTDSPLNID 130
           ++L++  +LS+P  +S  NID
Sbjct: 119 ILLSVMSMLSEPNVESGANID 139

>Skud_7.222 Chr7 (397309..397821) [513 bp, 170 aa] {ON} YGL058W
           (REAL)
          Length = 170

 Score = 79.7 bits (195), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 80/135 (59%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           + RRL+++++ +K++      + +S  P   D++  W A I+GP +T Y   +F L +  
Sbjct: 5   ARRRLMRDFKRMKEDAP--PGVSASPLP---DNVMVWNAMIIGPADTSYEDGTFRLLLEF 59

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             EYP KPP V F + +M H N+ +  G+ICL+IL N  W+P +++ +++ +I  L +DP
Sbjct: 60  DEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDP 116

Query: 122 VTDSPLNIDLSNILK 136
              SP N++ + + K
Sbjct: 117 NPASPANVEAATLFK 131

>KLTH0A07546g Chr1 (635570..636217) [648 bp, 215 aa] {ON} highly
           similar to uniprot|P21734 Saccharomyces cerevisiae
           YDR177W UBC1 Ubiquitin-conjugating enzyme that mediates
           selective degradation of short-lived and abnormal
           proteins plays a role in vesicle biogenesis and ER-
           associated protein degradation (ERAD) component of the
           cellular stress response
          Length = 215

 Score = 80.1 bits (196), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 78/140 (55%), Gaps = 7/140 (5%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +R++KE Q +K    +       L+ ++ +D+     + LGPP TPY    F + I +  
Sbjct: 5   KRVMKELQAIK----DDPEAKVDLQLVNENDIHLLKGSFLGPPGTPYENGKFIVDIEVPM 60

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVT 123
           EYP KPP++ F   K+ H N+   TG ICL+IL NA WSPV  L + ++++  LL  P  
Sbjct: 61  EYPFKPPKMKFDT-KVYHPNVSSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLSNILKIKDTSAY 143
           + P + +++    ++D +++
Sbjct: 119 NDPQDAEVAQHF-LRDKASF 137

>NDAI0I01650 Chr9 complement(388545..389075) [531 bp, 176 aa] {ON} 
          Length = 176

 Score = 79.0 bits (193), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 43/135 (31%), Positives = 79/135 (58%), Gaps = 8/135 (5%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           + RRL+++++ +K++      + +S  P   D++  W A I+GP  TPY   +F L +  
Sbjct: 5   ARRRLMRDFKRMKEDAP--PGVSASPLP---DNVMVWNAMIIGPAETPYEDGTFRLLLEF 59

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             EYP+  P V F + +M H N+ +  G+ICL+IL N  W+P +++ +++ +I  L +DP
Sbjct: 60  DEEYPINRPHVKFLS-EMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDP 116

Query: 122 VTDSPLNIDLSNILK 136
              SP N++ + + K
Sbjct: 117 NPASPANVEAATLFK 131

>TDEL0B06570 Chr2 (1164122..1164619) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 78.6 bits (192), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 49/141 (34%), Positives = 81/141 (57%), Gaps = 18/141 (12%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           + RRLLKEYQ + ++      I+++  P    +L  W   I GPP+TPY G  F+ R+  
Sbjct: 5   ASRRLLKEYQQLIRD--PPPGILAA--PKSESNLFLWDCLIQGPPDTPYEGGIFNARLDF 60

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL----DNAN--------WSPVWNLLT 109
             +YPL PP++TF+   + H NI +  G++C++IL    D+ N        WSPV ++  
Sbjct: 61  PKDYPLSPPKLTFTPSIL-HPNI-YHNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 110 VVLAIYQLLSDPVTDSPLNID 130
           ++L++  +LS+P  +S  N+D
Sbjct: 119 ILLSVMSMLSEPNIESGANVD 139

>KLTH0H06732g Chr8 (592074..592115,592201..592641) [483 bp, 160 aa]
           {ON} highly similar to uniprot|P06104 Saccharomyces
           cerevisiae YGL058W RAD6 Ubiquitin-conjugating enzyme
           (E2) involved in postreplication repair (with Rad18p)
           sporulation telomere silencing and ubiquitin-mediated N-
           end rule protein degradation (with Ubr1p)
          Length = 160

 Score = 78.2 bits (191), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 44/135 (32%), Positives = 76/135 (56%), Gaps = 12/135 (8%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           + RRL+++++     +        S  P+  D++  W A I+GP  TPY   +F L +  
Sbjct: 5   ARRRLMRDFKDAPPGV--------SASPL-PDNVMVWNAMIIGPAETPYEDGTFRLLLEF 55

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
             EYP KPP V F + +M H N+ +  G+ICL+IL N  W+P +++ +++ +I  L +DP
Sbjct: 56  DEEYPNKPPHVKFLS-EMFHPNV-YANGEICLDILQN-RWTPTYDVASILTSIQSLFNDP 112

Query: 122 VTDSPLNIDLSNILK 136
              SP N++ + + K
Sbjct: 113 NPASPANVEAATLFK 127

>NDAI0B01520 Chr2 complement(356566..357063) [498 bp, 165 aa] {ON}
           Anc_2.569
          Length = 165

 Score = 78.2 bits (191), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 82/141 (58%), Gaps = 18/141 (12%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           ++RRLLKE Q + K+  +   I++   P + ++L  W   + GPP+T Y G  F+ R+  
Sbjct: 5   AQRRLLKELQQLNKD--SPPGIVAG--PANENNLFVWDCLVQGPPDTAYEGGIFNARLDF 60

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL----DNAN--------WSPVWNLLT 109
             +YPL PP++TF+   + H NI +  G++C++IL    D+ N        WSPV ++  
Sbjct: 61  PKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 110 VVLAIYQLLSDPVTDSPLNID 130
           ++L++  +LS+P  +S  NID
Sbjct: 119 ILLSVMSMLSEPNIESGANID 139

>KNAG0M02150 Chr13 (400133..400645) [513 bp, 170 aa] {ON} Anc_2.569
           YMR022W
          Length = 170

 Score = 78.2 bits (191), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 77/141 (54%), Gaps = 18/141 (12%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           ++RRLLKE Q + ++      I++   P D  DL  W   + GPP++PY G  F+ ++  
Sbjct: 5   AQRRLLKELQQLMRD--PPPGIVAG--PQDESDLFLWDCLVQGPPDSPYEGGVFEAQLRF 60

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNI------------LDNANWSPVWNLLT 109
             +YPL PP++TF    + H N+ +  G++C++I            L    WSPV ++  
Sbjct: 61  PRDYPLSPPKLTFVPSVL-HPNV-YPNGEVCISILHAPGEDPNQYELAEERWSPVQSVEK 118

Query: 110 VVLAIYQLLSDPVTDSPLNID 130
           ++L++  +LS+P  +S  NID
Sbjct: 119 ILLSVVSMLSEPNVESGANID 139

>Kwal_23.6485 s23 (1608161..1608808) [648 bp, 215 aa] {ON} YDR177W
           (UBC1) - ubiquitin-conjugating enzyme [contig 18] FULL
          Length = 215

 Score = 79.0 bits (193), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 78/140 (55%), Gaps = 7/140 (5%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +R++KE Q +K    +       L+ ++ +D+     + LGPP TPY    + + I +  
Sbjct: 5   KRVMKELQAIK----DDPEARVDLQLVNENDIHLLKGSFLGPPGTPYENGKYIVDIEVPM 60

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVT 123
           EYP KPP++ F   K+ H N+   TG ICL+IL NA WSPV  L + ++++  LL  P  
Sbjct: 61  EYPFKPPKMKFQT-KVYHPNVSSVTGAICLDILKNA-WSPVITLKSALISLQALLQSPEP 118

Query: 124 DSPLNIDLSNILKIKDTSAY 143
           + P + +++    I+D +++
Sbjct: 119 NDPQDAEVAQHY-IRDKASF 137

>NCAS0A12740 Chr1 (2515651..2516148) [498 bp, 165 aa] {ON} Anc_2.569
          Length = 165

 Score = 77.8 bits (190), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 82/141 (58%), Gaps = 18/141 (12%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           ++RRLLKE Q + K+  +   I++   P + ++L  W   + GPP+T Y G  F+ R+  
Sbjct: 5   AQRRLLKELQQLTKD--SPPGIVAC--PKNENNLFIWDCLVQGPPDTAYEGGIFNARLEF 60

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL----DNAN--------WSPVWNLLT 109
             +YPL PP++TF+   + H NI +  G++C++IL    D+ N        WSPV ++  
Sbjct: 61  PKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSIEK 118

Query: 110 VVLAIYQLLSDPVTDSPLNID 130
           ++L++  +LS+P  +S  NID
Sbjct: 119 ILLSVMSMLSEPNIESGANID 139

>ZYRO0D04466g Chr4 complement(370627..371106) [480 bp, 159 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 159

 Score = 77.4 bits (189), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 40/100 (40%), Positives = 60/100 (60%), Gaps = 3/100 (3%)

Query: 29  PIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKT 88
           P + DDL +W+  I+GP  TPY    F + +H    YP  PP+V F +  M H N++  +
Sbjct: 36  PNNEDDLRDWSGMIVGPEGTPYESLKFKISLHFPDSYPYVPPKVKFIS-PMWHPNVDM-S 93

Query: 89  GKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLN 128
           G ICL+IL +  WS V+N+ T++L++  L  +P   SPLN
Sbjct: 94  GNICLDILKD-QWSAVYNVQTILLSLQSLFEEPNNSSPLN 132

>SAKL0D13552g Chr4 (1123716..1124213) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 77.4 bits (189), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 80/141 (56%), Gaps = 18/141 (12%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           +++RLLKE Q + ++  + + I++   P   D+L  W   I GPP++PY G  F+  +  
Sbjct: 5   AQKRLLKELQQLARD--SPEGIVAG--PKSEDNLFLWDCLITGPPDSPYEGGVFNAMLEF 60

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNAN------------WSPVWNLLT 109
             +YPL PP++TF+   + H NI +  G++C++IL +              WSPV ++  
Sbjct: 61  PKDYPLSPPRLTFTPSIL-HPNI-YPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEK 118

Query: 110 VVLAIYQLLSDPVTDSPLNID 130
           ++L++  +LS+P  +S  NID
Sbjct: 119 ILLSVTSMLSEPNVESGANID 139

>KAFR0A02160 Chr1 (452814..453311) [498 bp, 165 aa] {ON} Anc_2.569
           YMR022W
          Length = 165

 Score = 77.0 bits (188), Expect = 9e-18,   Method: Compositional matrix adjust.
 Identities = 44/141 (31%), Positives = 80/141 (56%), Gaps = 18/141 (12%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           +++RLLKE Q + K+  +   I++   P   D++  W   + GPP++PY G  F+ ++  
Sbjct: 5   AQKRLLKELQQLMKD--SPPGIVAG--PKTEDNIFQWDCLVQGPPDSPYEGGVFNAQLDF 60

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNAN------------WSPVWNLLT 109
             +YPL PP++TF+   + H NI +  G++C++IL +              WSPV ++  
Sbjct: 61  PKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGEDPNMYELAEERWSPVQSVEK 118

Query: 110 VVLAIYQLLSDPVTDSPLNID 130
           ++L++  +LS+P  +S  NID
Sbjct: 119 ILLSVMSMLSEPNIESGANID 139

>ABR059W Chr2 (503221..503718) [498 bp, 165 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR022W (QRI8)
          Length = 165

 Score = 76.6 bits (187), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 80/141 (56%), Gaps = 18/141 (12%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           +++RL+KE Q + ++  +   I++   P+  D+L  W   I GP ++PY G  F+ R+  
Sbjct: 5   AQKRLMKELQQLLRD--SPDGIVAG--PVSEDNLFLWDCLIEGPADSPYEGGVFNARLQF 60

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL------------DNANWSPVWNLLT 109
             +YPL PP++TF+   + H N+ +  G++C++IL             +  WSPV ++  
Sbjct: 61  PRDYPLSPPKLTFTPSIL-HPNV-YPNGEVCISILHAPGEDPNMYEEASERWSPVQSVEK 118

Query: 110 VVLAIYQLLSDPVTDSPLNID 130
           ++L++  +LS+P  +S  NID
Sbjct: 119 ILLSVMSMLSEPNVESGANID 139

>Kpol_1056.5 s1056 complement(8947..9444) [498 bp, 165 aa] {ON}
           complement(8947..9444) [498 nt, 166 aa]
          Length = 165

 Score = 76.6 bits (187), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 81/141 (57%), Gaps = 18/141 (12%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           +++RL KEYQ + ++  +   I++   P + +DL  W   I GPP+TPY    F+ ++  
Sbjct: 5   AQKRLFKEYQQLIRD--SPPGIVAG--PANENDLFLWDCLIQGPPDTPYEHGVFNAQLRF 60

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL----DNAN--------WSPVWNLLT 109
             +YPL PP +TF+   + H NI +  G++C++IL    D+ N        WSPV ++  
Sbjct: 61  PRDYPLSPPTLTFTPAIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 110 VVLAIYQLLSDPVTDSPLNID 130
           ++L++  +LS+P  +S  NID
Sbjct: 119 ILLSVMSMLSEPNVESGANID 139

>KNAG0F02570 Chr6 (482998..483453) [456 bp, 151 aa] {ON} Anc_6.109
           YGL058W
          Length = 151

 Score = 76.3 bits (186), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 64/104 (61%), Gaps = 3/104 (2%)

Query: 33  DDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKIC 92
           D++  W A I+GP +TPY   +F L +    +YP KPP V F + +M H N+ +  G+IC
Sbjct: 16  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLS-EMFHPNV-YANGEIC 73

Query: 93  LNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNILK 136
           L+IL N  W+P +++ +++ +I  L +DP   SP N++ + + K
Sbjct: 74  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>Suva_8.389 Chr8 complement(700070..700540) [471 bp, 156 aa] {ON}
           YOR339C (REAL)
          Length = 156

 Score = 76.6 bits (187), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 59/100 (59%), Gaps = 3/100 (3%)

Query: 29  PIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKT 88
           P D +DLT WT  I GP  TPY    F + ++    YP  PP+V F +  M H N++  +
Sbjct: 32  PEDDNDLTYWTGYITGPQGTPYSDLKFKISLNFPESYPFHPPKVKFVS-PMWHPNVDM-S 89

Query: 89  GKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLN 128
           G ICL+IL    WS V+N+ T++L++  LL +P   SPLN
Sbjct: 90  GNICLDIL-KEKWSAVYNVETILLSLQSLLGEPNNRSPLN 128

>CAGL0M07568g Chr13 complement(758110..758607) [498 bp, 165 aa] {ON}
           highly similar to uniprot|Q02159 Saccharomyces
           cerevisiae YMR022w E2 ubiquitin-conjugation enzyme
          Length = 165

 Score = 76.6 bits (187), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 48/141 (34%), Positives = 81/141 (57%), Gaps = 18/141 (12%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           +++RL KE Q + K+  +   I++   P   D+L  W   I GPP+TPY G  F+ ++  
Sbjct: 5   AQKRLYKELQQLIKD--SPPGIVAG--PKSDDNLFVWDCLIQGPPDTPYAGGVFNAQLEF 60

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL----DNAN--------WSPVWNLLT 109
             +YPL PP++TF+   + H NI +  G++C++IL    D+ N        WSPV ++  
Sbjct: 61  PKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYESAEERWSPVQSVEK 118

Query: 110 VVLAIYQLLSDPVTDSPLNID 130
           ++L++  +LS+P  +S  NID
Sbjct: 119 ILLSVMSMLSEPNIESGANID 139

>TBLA0H02610 Chr8 complement(617205..617702) [498 bp, 165 aa] {ON}
           Anc_2.569 YMR022W
          Length = 165

 Score = 75.9 bits (185), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 45/141 (31%), Positives = 77/141 (54%), Gaps = 18/141 (12%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           +++RLLKE Q + ++      II++  P    DL  W   + GPP+TPY G  F+ ++  
Sbjct: 5   AQKRLLKELQQLTRD--PPPGIIAA--PKTESDLFTWDCLVAGPPDTPYAGGLFNCQLQF 60

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNI------------LDNANWSPVWNLLT 109
             +YPL PP +TF+   + H N+ +  G++C++I            L    WSPV ++  
Sbjct: 61  PTDYPLSPPTLTFTPSIL-HPNV-YPNGEVCISILHAPGSDPNMYELPEERWSPVQSVEK 118

Query: 110 VVLAIYQLLSDPVTDSPLNID 130
           ++L++  +LS+P  +S  NID
Sbjct: 119 ILLSVVSMLSEPNVESGANID 139

>Kwal_14.1828 s14 (488274..488732) [459 bp, 152 aa] {ON} YGL058W
           (RAD6) - Ubiquitin conjugating (E2) enzyme. The
           C-terminal 23 residues are critical for sporulation and
           histone polyubiquitinating activity, but not UV repair
           or induced mutagenesis. [contig 237] FULL
          Length = 152

 Score = 75.9 bits (185), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 63/104 (60%), Gaps = 3/104 (2%)

Query: 33  DDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKIC 92
           D++  W A I+GP  TPY   +F L +    EYP KPP V F + ++ H N+ +  G+IC
Sbjct: 16  DNVMVWNAMIIGPAETPYEDGTFRLLLEFDEEYPNKPPHVKFLS-EIFHPNV-YANGEIC 73

Query: 93  LNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNILK 136
           L+IL N  W+P +++ +++ +I  L +DP   SP N++ + + K
Sbjct: 74  LDILQN-RWTPTYDVASILTSIQSLFNDPNPASPANVEAATLFK 116

>KAFR0A04700 Chr1 (930462..930923) [462 bp, 153 aa] {ON} Anc_6.109
           YGL058W
          Length = 153

 Score = 75.5 bits (184), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 38/104 (36%), Positives = 64/104 (61%), Gaps = 3/104 (2%)

Query: 33  DDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKIC 92
           D++  W A I+GP +TPY   +F L +    +YP KPP V F + +M H N+ +  G+IC
Sbjct: 16  DNVMVWNAMIIGPADTPYEDGTFRLLLEFDEDYPNKPPHVKFLS-EMFHPNV-YANGEIC 73

Query: 93  LNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNILK 136
           L+IL N  W+P +++ +++ +I  L +DP   SP N++ + + K
Sbjct: 74  LDILQN-RWTPTYDVSSILTSIQSLFNDPNPASPANVEAATLFK 116

>Kpol_1065.12 s1065 (25814..26293) [480 bp, 159 aa] {ON}
           (25814..26293) [480 nt, 160 aa]
          Length = 159

 Score = 75.1 bits (183), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 39/100 (39%), Positives = 61/100 (61%), Gaps = 3/100 (3%)

Query: 29  PIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKT 88
           P   ++LT W+ TI GP ++PY G  F + +     YP +PP+V F +  M H N++  +
Sbjct: 36  PDHEENLTKWSGTITGPDDSPYAGLRFKISLTFPDRYPYEPPKVKFVS-PMWHPNVDL-S 93

Query: 89  GKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLN 128
           G ICL++L    WS V+N+ T++L++  LL +P   SPLN
Sbjct: 94  GNICLDVL-KEKWSAVYNVQTILLSLQALLGEPNNSSPLN 132

>Kwal_26.8224 s26 (695345..695842) [498 bp, 165 aa] {ON} YMR022W
           (QRI8) - ubiquitin conjugating enzyme [contig 58] FULL
          Length = 165

 Score = 75.1 bits (183), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 80/141 (56%), Gaps = 18/141 (12%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           +++RL KE Q + K+  + + I++   P   D+L  W   I GPP++PY G  F+  +  
Sbjct: 5   AQKRLFKELQQLLKD--SPEGIVAG--PKSEDNLFVWDCLISGPPDSPYQGGVFNATLEF 60

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL----DNAN--------WSPVWNLLT 109
             +YPL PP++ F+   + H NI +  G++C++IL    D+ N        WSPV ++  
Sbjct: 61  PKDYPLSPPKLLFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 110 VVLAIYQLLSDPVTDSPLNID 130
           ++L++  +LS+P  +S  NID
Sbjct: 119 ILLSVMSMLSEPNVESGANID 139

>KLTH0D07986g Chr4 (679875..680372) [498 bp, 165 aa] {ON} highly
           similar to uniprot|Q02159 Saccharomyces cerevisiae
           YMR022W QRI8 Ubiquitin conjugating enzyme involved in
           the ER-associated protein degradation pathway requires
           Cue1p for recruitment to the ER membrane proposed to be
           involved in chromatin assembly
          Length = 165

 Score = 75.1 bits (183), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 80/141 (56%), Gaps = 18/141 (12%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           +++RL KE Q + K+  + + I++   P   D+L  W   I GPP++PY G  F+  +  
Sbjct: 5   AQKRLFKELQQLLKD--SPEGIVAG--PRSEDNLFLWDCLISGPPDSPYQGGVFNATLEF 60

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL----DNAN--------WSPVWNLLT 109
             +YPL PP++ F+   + H NI +  G++C++IL    D+ N        WSPV ++  
Sbjct: 61  PKDYPLSPPKLLFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 110 VVLAIYQLLSDPVTDSPLNID 130
           ++L++  +LS+P  +S  NID
Sbjct: 119 ILLSVMSMLSEPNVESGANID 139

>SAKL0H17930g Chr8 complement(1598218..1598649,1598712..1598741)
           [462 bp, 153 aa] {ON} highly similar to uniprot|P52490
           Saccharomyces cerevisiae YDR092W UBC13
           Ubiquitin-conjugating enzyme involved in the error-free
           DNA postreplication repair pathway interacts with Mms2p
           to assemble ubiquitin chains at the Ub Lys-63 residue
           DNA damage triggers redistribution from the cytoplasm to
           the nucleus
          Length = 153

 Score = 73.9 bits (180), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 44/107 (41%), Positives = 66/107 (61%), Gaps = 4/107 (3%)

Query: 26  SLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIE 85
           S EP D D+L  +  TI GP  +PY    F+L + L  +YP++ P+V F   K+ H NI+
Sbjct: 24  SAEPHD-DNLRYFQVTIEGPQQSPYENGVFELELFLPEDYPMEAPKVRFLT-KIYHPNID 81

Query: 86  FKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLS 132
            + G+ICL++L N NWSP   + TV+L+I  LL+ P  + PL  D++
Sbjct: 82  -RLGRICLDVLKN-NWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>KAFR0H01230 Chr8 (229718..230050) [333 bp, 110 aa] {ON} Anc_3.301
           YDR054C
          Length = 110

 Score = 72.8 bits (177), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 41/94 (43%), Positives = 59/94 (62%), Gaps = 3/94 (3%)

Query: 43  LGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWS 102
           +GPP++PY G  F L IH   +YP KPP+++F+  K+ H NI    G ICL+IL +  WS
Sbjct: 1   MGPPDSPYAGGVFFLSIHFPTDYPFKPPKISFTT-KIYHPNIN-ANGNICLDILKD-QWS 57

Query: 103 PVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNILK 136
           P   L  V+L+I  LL+D   D PL  ++++I K
Sbjct: 58  PALTLSKVLLSICSLLTDANPDDPLVPEIAHIYK 91

>Smik_13.186 Chr13 (310465..310962) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 73.2 bits (178), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 81/141 (57%), Gaps = 18/141 (12%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           +++RLLKE Q + K+  +   I++   P   +++  W   I GPP+TPY    F+ ++  
Sbjct: 5   AQKRLLKELQQLIKD--SPPGIVAG--PKSENNIFVWDCLIQGPPDTPYADGVFNAKLEF 60

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL----DNAN--------WSPVWNLLT 109
             +YPL PP++TF+   + H NI +  G++C++IL    D+ N        WSPV ++  
Sbjct: 61  PKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 110 VVLAIYQLLSDPVTDSPLNID 130
           ++L++  +LS+P  +S  NID
Sbjct: 119 ILLSVMSMLSEPNIESGANID 139

>YMR022W Chr13 (318680..319177) [498 bp, 165 aa] {ON}  UBC7Ubiquitin
           conjugating enzyme, involved in the ER-associated
           protein degradation pathway; requires Cue1p for
           recruitment to the ER membrane; proposed to be involved
           in chromatin assembly
          Length = 165

 Score = 73.2 bits (178), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 81/141 (57%), Gaps = 18/141 (12%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           +++RLLKE Q + K+  +   I++   P   +++  W   I GPP+TPY    F+ ++  
Sbjct: 5   AQKRLLKELQQLIKD--SPPGIVAG--PKSENNIFIWDCLIQGPPDTPYADGVFNAKLEF 60

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL----DNAN--------WSPVWNLLT 109
             +YPL PP++TF+   + H NI +  G++C++IL    D+ N        WSPV ++  
Sbjct: 61  PKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 110 VVLAIYQLLSDPVTDSPLNID 130
           ++L++  +LS+P  +S  NID
Sbjct: 119 ILLSVMSMLSEPNIESGANID 139

>Suva_13.189 Chr13 (309254..309751) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 72.8 bits (177), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 81/141 (57%), Gaps = 18/141 (12%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           +++RLLKE Q + K+  +   I++   P   +++  W   I GPP+TPY    F+ ++  
Sbjct: 5   AQKRLLKELQQLIKD--SPPGIVAG--PKSENNIFVWDCLIQGPPDTPYADGVFNTKLEF 60

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL----DNAN--------WSPVWNLLT 109
             +YPL PP++TF+   + H NI +  G++C++IL    D+ N        WSPV ++  
Sbjct: 61  PKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 110 VVLAIYQLLSDPVTDSPLNID 130
           ++L++  +LS+P  +S  NID
Sbjct: 119 ILLSVMSMLSEPNIESGANID 139

>Skud_13.176 Chr13 (305317..305814) [498 bp, 165 aa] {ON} YMR022W
           (REAL)
          Length = 165

 Score = 72.8 bits (177), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 81/141 (57%), Gaps = 18/141 (12%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           +++RLLKE Q + K+  +   I++   P   +++  W   I GPP+TPY    F+ ++  
Sbjct: 5   AQKRLLKELQQLIKD--SPPGIVAG--PKSENNIFVWDCLIQGPPDTPYADGIFNAKLEF 60

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL----DNAN--------WSPVWNLLT 109
             +YPL PP++TF+   + H NI +  G++C++IL    D+ N        WSPV ++  
Sbjct: 61  PKDYPLSPPKLTFTPSIL-HPNI-YPNGEVCISILHSPGDDPNMYELAEERWSPVQSVEK 118

Query: 110 VVLAIYQLLSDPVTDSPLNID 130
           ++L++  +LS+P  +S  NID
Sbjct: 119 ILLSVMSMLSEPNIESGANID 139

>ZYRO0B11682g Chr2 (920866..921321) [456 bp, 151 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092W UBC13 Ubiquitin-conjugating enzyme involved in
           the error-free DNA postreplication repair pathway
           interacts with Mms2p to assemble ubiquitin chains at the
           Ub Lys-63 residue DNA damage triggers redistribution
           from the cytoplasm to the nucleus
          Length = 151

 Score = 72.4 bits (176), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 66/107 (61%), Gaps = 4/107 (3%)

Query: 26  SLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIE 85
           S EP   D+L  +  TI GP  +PY    F+L ++L  +YP++ P+V F   ++ H NI+
Sbjct: 24  SAEP-HEDNLRYFAVTIEGPEESPYENGVFELELYLPDDYPMEAPKVRFLT-RIYHPNID 81

Query: 86  FKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLS 132
            + G+ICL++L N NWSP   + TV+L+I  LL+ P  + PL  D++
Sbjct: 82  -RLGRICLDVLKN-NWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>Kpol_1075.1b s1075 (1500..1958) [459 bp, 152 aa] {ON} (1500..1958)
           [459 nt, 153 aa]
          Length = 152

 Score = 72.0 bits (175), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 47/117 (40%), Positives = 70/117 (59%), Gaps = 5/117 (4%)

Query: 26  SLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIE 85
           + EP D D+L  +  TI GP  +PY    FDL + L  +YP++ P+V F   K+ H NI+
Sbjct: 24  TAEPHD-DNLRYFEVTIEGPQQSPYENGVFDLELFLPDDYPMEAPKVRFLT-KIYHPNID 81

Query: 86  FKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNILKIKDTSA 142
            + G+ICL++L   NWSP   + TV+L+I  LL+ P  + PL  D++    IKD S+
Sbjct: 82  -RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDW-IKDESS 135

>CAGL0M03399g Chr13 complement(389650..390294) [645 bp, 214 aa] {ON}
           highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012w UBC8 E2 ubiquitin-conjugating enzyme
          Length = 214

 Score = 73.2 bits (178), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 50/157 (31%), Positives = 86/157 (54%), Gaps = 12/157 (7%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           S+RR+  E  V+K  + +H+     +E ++ D +  +     GP +TPY G  + L + L
Sbjct: 5   SKRRI--ETDVMKLLMSDHE-----VELVE-DSMQEFHVKFYGPKDTPYEGGVWRLHVEL 56

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVV-LAIYQLLSD 120
              YP K P + F   K+ H NI+  +G ICL+++ N+ WSP+++LL +V   +  LL +
Sbjct: 57  PDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVI-NSTWSPLYDLLNIVEWMLPGLLKE 114

Query: 121 PVTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNKSDK 157
           P    PLN + +N L++KD   Y   +  Y++  + K
Sbjct: 115 PNGSDPLNNEAAN-LQLKDKKVYEEKVREYIDKYATK 150

>TPHA0B03410 Chr2 complement(793271..793729) [459 bp, 152 aa] {ON}
           Anc_8.230 YDR092W
          Length = 152

 Score = 71.2 bits (173), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 66/108 (61%), Gaps = 4/108 (3%)

Query: 26  SLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIE 85
           + EP D D+L  ++ TI GP  +PY    FDL + L  +YP++ P+V F   K+ H NI+
Sbjct: 24  TAEPHD-DNLRYFSVTIEGPEGSPYEHGIFDLELFLPDDYPMESPKVRFLT-KIYHPNID 81

Query: 86  FKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSN 133
            + G+ICL++L   NWSP   + TV+L+I  LL+ P  + PL  D++ 
Sbjct: 82  -RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 127

>Smik_4.335 Chr4 (596360..596788) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 70.5 bits (171), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 66/108 (61%), Gaps = 4/108 (3%)

Query: 26  SLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIE 85
           + EP D D+L  +  TI GP  +PY    F+L ++L  +YP++ P+V F   K+ H NI+
Sbjct: 14  TAEPHD-DNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLT-KIYHPNID 71

Query: 86  FKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSN 133
            + G+ICL++L   NWSP   + TV+L+I  LL+ P  + PL  D++ 
Sbjct: 72  -RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 117

>YDR092W Chr4 (629876..629905,630174..630605) [462 bp, 153 aa] {ON} 
           UBC13Ubiquitin-conjugating enzyme involved in the
           error-free DNA postreplication repair pathway; interacts
           with Mms2p to assemble ubiquitin chains at the Ub Lys-63
           residue; DNA damage triggers redistribution from the
           cytoplasm to the nucleus
          Length = 153

 Score = 70.5 bits (171), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 66/108 (61%), Gaps = 4/108 (3%)

Query: 26  SLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIE 85
           + EP D D+L  +  TI GP  +PY    F+L ++L  +YP++ P+V F   K+ H NI+
Sbjct: 24  TAEPHD-DNLRYFQVTIEGPEQSPYEDGIFELELYLPDDYPMEAPKVRFLT-KIYHPNID 81

Query: 86  FKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSN 133
            + G+ICL++L   NWSP   + TV+L+I  LL+ P  + PL  D++ 
Sbjct: 82  -RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 127

>Skud_4.352 Chr4 (607037..607465) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 70.1 bits (170), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/108 (37%), Positives = 66/108 (61%), Gaps = 4/108 (3%)

Query: 26  SLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIE 85
           + EP D D+L  +  TI GP  +PY    F+L ++L  +YP++ P+V F   ++ H NI+
Sbjct: 14  TAEPHD-DNLRYFQVTIEGPEQSPYEDGVFELELYLPDDYPMEAPKVRFLT-RIYHPNID 71

Query: 86  FKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSN 133
            + G+ICL++L   NWSP   + TV+L+I  LL+ P  + PL  D++ 
Sbjct: 72  -RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 117

>KLLA0C17622g Chr3 (1555873..1555902,1556004..1556453) [480 bp, 159
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus ,
          Length = 159

 Score = 70.5 bits (171), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/111 (37%), Positives = 67/111 (60%), Gaps = 4/111 (3%)

Query: 32  SDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKI 91
            D+L  +  TI GP  +PY    F L + L  +YP++ P+V F   K+ H NI+ + G+I
Sbjct: 29  EDNLRYFQVTIEGPQQSPYENGVFQLELFLPDDYPMEAPKVRFLT-KIYHPNID-RLGRI 86

Query: 92  CLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNI-LKIKDTS 141
           CL++L N NWSP   + TV+L++  LL+ P  + PL  D++   +K +DT+
Sbjct: 87  CLDVLKN-NWSPALQIRTVLLSVQALLASPNPNDPLANDVAEEWIKHEDTA 136

>SAKL0B10582g Chr2 complement(914784..915269) [486 bp, 161 aa] {ON}
           highly similar to uniprot|P52492 Saccharomyces
           cerevisiae YOR339C
          Length = 161

 Score = 70.1 bits (170), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 42/100 (42%), Positives = 60/100 (60%), Gaps = 3/100 (3%)

Query: 29  PIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKT 88
           P + DDLT W+  I GP  TPY G  F + +     YP   P+VTF +  M H N++  +
Sbjct: 38  PENEDDLTKWSGIITGPDGTPYEGLRFKISLQFPQSYPYTAPRVTFVS-PMWHPNVDM-S 95

Query: 89  GKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLN 128
           G ICL+IL +  WS V+N+ T++L++  LL +P   SPLN
Sbjct: 96  GNICLDILKD-QWSAVYNVQTILLSLQSLLEEPNNSSPLN 134

>TBLA0F03790 Chr6 (936410..936865) [456 bp, 151 aa] {ON} Anc_4.49
           YLR306W
          Length = 151

 Score = 69.7 bits (169), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 63/101 (62%), Gaps = 3/101 (2%)

Query: 32  SDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKI 91
            D+L  ++ TI GP ++ Y    F+L + L  +YP++ P+V F   K+ H NI+ + G+I
Sbjct: 29  EDNLRYFSVTIEGPKDSAYENGVFELELFLPDDYPMEAPKVRFLT-KIYHPNID-RLGRI 86

Query: 92  CLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLS 132
           CL++L N NWSP   + TV+L+I  LL+ P  + PL  D++
Sbjct: 87  CLDVLKN-NWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>TDEL0A01340 Chr1 complement(239400..239843,239923..239952) [474 bp,
           157 aa] {ON} Anc_3.308 YBR082C
          Length = 157

 Score = 69.7 bits (169), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 39/101 (38%), Positives = 61/101 (60%), Gaps = 3/101 (2%)

Query: 32  SDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKI 91
            D+L  +  TI GP  +PY    F+L + L  +YP++ P+V F   K+ H NI+ K G+I
Sbjct: 29  EDNLRYFQVTIEGPQQSPYENGVFNLELFLPDDYPMEAPKVRFLT-KIYHPNID-KLGRI 86

Query: 92  CLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLS 132
           CL++L   NWSP   + TV+L++  LL+ P  + PL  D++
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>Suva_2.253 Chr2 (429581..430009) [429 bp, 143 aa] {ON} YDR092W
           (REAL)
          Length = 143

 Score = 68.9 bits (167), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 42/108 (38%), Positives = 64/108 (59%), Gaps = 4/108 (3%)

Query: 26  SLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIE 85
           + EP D D+L  +  TI GP  +PY    F L + L  +YP++ P+V F   K+ H NI+
Sbjct: 14  TAEPHD-DNLRYFQVTIEGPEQSPYEDGVFKLELFLPDDYPMEAPKVRFLT-KIYHPNID 71

Query: 86  FKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSN 133
            + G+ICL++L   NWSP   + TV+L+I  LL+ P  + PL  D++ 
Sbjct: 72  -RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 117

>AGR121C Chr7 complement(977481..977915,977965..977994) [465 bp, 154
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDR092W (UBC13); 1-intron
          Length = 154

 Score = 69.3 bits (168), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 64/108 (59%), Gaps = 4/108 (3%)

Query: 26  SLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIE 85
           S EP   D+L  +  +I GP  +PY    F L + L  EYP++PP+V F   K+ H NI+
Sbjct: 24  SAEP-HEDNLRYFDVSIEGPQQSPYEHGVFRLELFLPDEYPMEPPKVRFLT-KIYHPNID 81

Query: 86  FKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSN 133
            + G+ICL++L   NWSP   + TV+L+I  LL+ P  + PL  D++ 
Sbjct: 82  -RLGRICLDVL-KTNWSPALQIRTVLLSIQALLATPNPNDPLANDVAK 127

>CAGL0G08063g Chr7 (761662..762111) [450 bp, 149 aa] {ON} highly
           similar to uniprot|P52490 Saccharomyces cerevisiae
           YDR092w UBC13 E2 ubiquitin-conjugating enzyme
          Length = 149

 Score = 68.9 bits (167), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 39/102 (38%), Positives = 61/102 (59%), Gaps = 3/102 (2%)

Query: 32  SDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKI 91
            D+L  +  TI GP  +PY    F L ++L  +YP++ P+V F   K+ H NI+ + G+I
Sbjct: 29  EDNLRYFDVTIEGPSQSPYEKGIFKLELYLPEDYPMEAPKVRFLT-KIYHPNID-RLGRI 86

Query: 92  CLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSN 133
           CL++L   NWSP   + TV+L+I  LL+ P  + PL  D++ 
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAE 127

>KNAG0H02980 Chr8 (551453..551482,551689..552117) [459 bp, 152 aa]
           {ON} Anc_8.230 YDR092W
          Length = 152

 Score = 68.9 bits (167), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 45/117 (38%), Positives = 69/117 (58%), Gaps = 5/117 (4%)

Query: 26  SLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIE 85
           + EP D D+L  +  T+ GP  +PY    F L ++L  +YP++ P+V F   K+ H NI+
Sbjct: 24  TAEPHD-DNLRYFEVTVEGPVGSPYENGIFQLELYLPDDYPMEAPKVRFLT-KIYHPNID 81

Query: 86  FKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNILKIKDTSA 142
            + G+ICL++L   NWSP   + TV+L+I  LL+ P  + PL  D++    IKD  A
Sbjct: 82  -RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVAEDW-IKDEEA 135

>NDAI0J01540 Chr10 complement(362018..362452,362599..362628) [465
           bp, 154 aa] {ON} Anc_8.230
          Length = 154

 Score = 68.9 bits (167), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 65/107 (60%), Gaps = 4/107 (3%)

Query: 26  SLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIE 85
           + EP D D+L  +  T+ GP  +PY    F L ++L  +YP++ P+V F   K+ H NI+
Sbjct: 24  TAEPHD-DNLRYFNVTVEGPTQSPYENGIFKLELYLPDDYPMEAPKVRFLT-KIYHPNID 81

Query: 86  FKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLS 132
            + G+ICL++L   NWSP   + TV+L+I  LL+ P  + PL  D++
Sbjct: 82  -RLGRICLDVL-KTNWSPALQIRTVLLSIQALLASPNPNDPLANDVA 126

>KLTH0G14366g Chr7 (1251249..1251278,1251389..1251808) [450 bp, 149
           aa] {ON} highly similar to uniprot|P52490 Saccharomyces
           cerevisiae YDR092W UBC13 Ubiquitin-conjugating enzyme
           involved in the error-free DNA postreplication repair
           pathway interacts with Mms2p to assemble ubiquitin
           chains at the Ub Lys-63 residue DNA damage triggers
           redistribution from the cytoplasm to the nucleus
          Length = 149

 Score = 68.6 bits (166), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 38/102 (37%), Positives = 60/102 (58%), Gaps = 3/102 (2%)

Query: 32  SDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKI 91
            D+L  +  TI GP  +PY    F L + L  +YP++ P+V F   K+ H NI+ + G+I
Sbjct: 29  EDNLRYFQVTIEGPQQSPYESGVFQLELFLPDDYPMEAPKVRFLT-KIYHPNID-RLGRI 86

Query: 92  CLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSN 133
           CL++L   NWSP   + TV+L++  LL+ P  + PL  D++ 
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVAE 127

>KLTH0D01760g Chr4 (171356..171841) [486 bp, 161 aa] {ON} highly
           similar to uniprot|P52492 Saccharomyces cerevisiae
           YOR339C
          Length = 161

 Score = 68.6 bits (166), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 58/100 (58%), Gaps = 3/100 (3%)

Query: 29  PIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKT 88
           P D +DLT W   I GP  TPY G  F + +     YP   P+V F +  M H N++  +
Sbjct: 38  PEDEEDLTKWCGIITGPDGTPYEGMRFKIALEFAQTYPYTAPKVRFVS-PMWHPNVDM-S 95

Query: 89  GKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLN 128
           G ICL+IL +  WS V+N+ T++L++  LL +P   SPLN
Sbjct: 96  GNICLDILKD-QWSAVYNVQTILLSLQSLLEEPNNSSPLN 134

>NCAS0B04010 Chr2 complement(724414..724845,724986..725015) [462 bp,
           153 aa] {ON} Anc_8.230
          Length = 153

 Score = 68.2 bits (165), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 61/101 (60%), Gaps = 3/101 (2%)

Query: 32  SDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKI 91
            D+L  +  T+ GP  +PY    F L ++L  +YP++ P+V F   K+ H NI+ + G+I
Sbjct: 29  EDNLRYFNVTVEGPAGSPYENGIFQLELYLPDDYPMEAPKVRFLT-KIYHPNID-RLGRI 86

Query: 92  CLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLS 132
           CL++L   NWSP   + TV+L++  LL+ P  + PL  D++
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>KAFR0A02420 Chr1 complement(506887..507330) [444 bp, 147 aa] {ON}
           Anc_8.230 YDR092W
          Length = 147

 Score = 68.2 bits (165), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 41/107 (38%), Positives = 65/107 (60%), Gaps = 4/107 (3%)

Query: 26  SLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIE 85
           + EP D D+L  +  +I GP  +PY    F L ++L  +YP++ P+V F   K+ H NI+
Sbjct: 20  TAEPHD-DNLRYFKVSIEGPEQSPYEKGIFQLELYLPDDYPMEAPKVRFLT-KIYHPNID 77

Query: 86  FKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLS 132
            + G+ICL+IL   NWSP   + TV+L++  LL+ P  + PL  D++
Sbjct: 78  -RLGRICLDIL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 122

>Smik_5.98 Chr5 (138141..138145,138263..138905) [648 bp, 215 aa]
           {ON} YEL012W (REAL)
          Length = 215

 Score = 69.7 bits (169), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 86/158 (54%), Gaps = 14/158 (8%)

Query: 2   SERRLLKEYQVVKKELGNHK-NIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIH 60
           S+RR+  E  V+K  + +H+ ++I+       D +  +    LGP +TPY    + L + 
Sbjct: 4   SKRRI--ETDVMKLLMSDHQVDLIN-------DSMQEFHVKFLGPKDTPYENGVWRLHVE 54

Query: 61  LTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVV-LAIYQLLS 119
           L   YP K P + F   K+ H NI+  +G ICL+++ N+ WSP+++L+ +V   I  LL 
Sbjct: 55  LPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVI-NSTWSPLYDLINIVEWMIPGLLK 112

Query: 120 DPVTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNKSDK 157
           +P    PLN + +  L+++D   Y   I+ Y++  + K
Sbjct: 113 EPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYIDKYATK 149

>YEL012W Chr5 (131772..131776,131900..132551) [657 bp, 218 aa] {ON} 
           UBC8Ubiquitin-conjugating enzyme that negatively
           regulates gluconeogenesis by mediating the
           glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 218

 Score = 69.3 bits (168), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 86/158 (54%), Gaps = 14/158 (8%)

Query: 2   SERRLLKEYQVVKKELGNHK-NIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIH 60
           S+RR+  E  V+K  + +H+ ++I+       D +  +    LGP +TPY    + L + 
Sbjct: 4   SKRRI--ETDVMKLLMSDHQVDLIN-------DSMQEFHVKFLGPKDTPYENGVWRLHVE 54

Query: 61  LTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVV-LAIYQLLS 119
           L   YP K P + F   K+ H NI+  +G ICL+++ N+ WSP+++L+ +V   I  LL 
Sbjct: 55  LPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVI-NSTWSPLYDLINIVEWMIPGLLK 112

Query: 120 DPVTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNKSDK 157
           +P    PLN + +  L+++D   Y   I+ Y++  + K
Sbjct: 113 EPNGSDPLNNEAAT-LQLRDKKLYEEKIKEYIDKYATK 149

>Suva_5.53 Chr5 complement(95600..96242,96354..96358) [648 bp, 215
           aa] {ON} YEL012W (REAL)
          Length = 215

 Score = 68.9 bits (167), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 82/152 (53%), Gaps = 12/152 (7%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           S+RR+  E  V+K  + +H+  + +      D +  +    LGP +TPY    + L + L
Sbjct: 4   SKRRI--ETDVMKLLMSDHEVDLVN------DSMQEFHVKFLGPKDTPYENGVWRLHVEL 55

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVV-LAIYQLLSD 120
              YP K P + F   K+ H NI+  +G ICL+++ N+ WSP+++L+ +V   I  LL +
Sbjct: 56  PDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVI-NSTWSPLYDLINIVEWMIPGLLKE 113

Query: 121 PVTDSPLNIDLSNILKIKDTSAYYGLIEYYLN 152
           P    PLN + +  L+++D   Y   I+ Y++
Sbjct: 114 PNGSDPLNNEAAT-LQLRDKKLYEEKIKEYID 144

>KNAG0H01870 Chr8 complement(332441..333073) [633 bp, 210 aa] {ON}
           Anc_1.436 YEL012W
          Length = 210

 Score = 68.9 bits (167), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 83/152 (54%), Gaps = 12/152 (7%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           S+RR+  E  V+K  + +H+     +E I +D +  +     GP +TPY    + L + L
Sbjct: 5   SKRRI--ETDVMKLLMSDHE-----VELI-NDSMQEFHIKFHGPKDTPYENGVWRLHVEL 56

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVV-LAIYQLLSD 120
              YP K P + F   K+ H NI+  +G ICL+++ N+ WSP+++LL +V   I  LL +
Sbjct: 57  PDNYPFKSPSIGF-VNKIYHPNIDIASGSICLDVI-NSTWSPLYDLLNIVEWMIPGLLKE 114

Query: 121 PVTDSPLNIDLSNILKIKDTSAYYGLIEYYLN 152
           P    PLN + +  L+++D   Y   I+ Y++
Sbjct: 115 PNGSDPLNNEAA-TLQLRDKKMYEEKIKEYID 145

>Ecym_1348 Chr1 complement(720137..720767,720872..720876) [636 bp,
           211 aa] {ON} similar to Ashbya gossypii AEL045W
           1-intron
          Length = 211

 Score = 68.6 bits (166), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 84/152 (55%), Gaps = 12/152 (7%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           S+RR+  E  V+K  + +H+     +E +D D++  +    LGP  TPY    + L + L
Sbjct: 4   SKRRI--ETDVMKLLMSDHE-----VELVD-DNMQEFHVKFLGPRGTPYERGVWRLHVEL 55

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVV-LAIYQLLSD 120
              YP K P + F   K+ H NI+  +G ICL+++ N+ WSP+++L+ +V   I  LL +
Sbjct: 56  PDNYPYKSPSIGF-VNKIFHPNIDAASGSICLDVI-NSTWSPLYDLINIVEWMIPGLLKE 113

Query: 121 PVTDSPLNIDLSNILKIKDTSAYYGLIEYYLN 152
           P    PLN + +  L++K+   Y   I+ Y++
Sbjct: 114 PNGSDPLNNEAAT-LQLKNPKMYEEKIQEYID 144

>Ecym_5563 Chr5 (1146448..1146477,1146598..1147062) [495 bp, 164 aa]
           {ON} similar to Ashbya gossypii AGR121C
          Length = 164

 Score = 67.8 bits (164), Expect = 3e-14,   Method: Compositional matrix adjust.
 Identities = 42/107 (39%), Positives = 63/107 (58%), Gaps = 4/107 (3%)

Query: 26  SLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIE 85
           S EP   D+L  +  +I GP  + Y    F L + L  EYP++PP+V F   K+ H NI+
Sbjct: 24  SAEP-HEDNLRYFDVSIEGPQQSAYENGVFRLELFLPDEYPMEPPKVRFLT-KIYHPNID 81

Query: 86  FKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLS 132
            + G+ICL++L   NWSP   + TV+L+I  LL+ P  + PL  D++
Sbjct: 82  -RLGRICLDVL-KTNWSPALQIRTVLLSIQALLATPNPNDPLANDVA 126

>KLLA0A11198g Chr1 complement(973755..974358,974525..974529) [609
           bp, 202 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of
           fructose-1,6-bisphosphatase (FBPase); cytoplasmic enzyme
           that catalyzes the ubiquitination of histones in vitro
          Length = 202

 Score = 68.2 bits (165), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 51/157 (32%), Positives = 83/157 (52%), Gaps = 12/157 (7%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           S+RR+  E  V+K  + +H      +E ++ D +  +     GP +TPY    + L + L
Sbjct: 5   SKRRI--ETDVMKLLMSDH-----DVELVE-DKMQEFHIKFHGPKDTPYEKGVWRLHVEL 56

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVV-LAIYQLLSD 120
              YP K P + F   K+ H NI+  +G ICL+++ N+ WSP+++LL +V   I  LL +
Sbjct: 57  PDNYPYKSPSIGF-VNKIFHPNIDAASGSICLDVI-NSTWSPLYDLLNIVEWMIPGLLKE 114

Query: 121 PVTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNKSDK 157
           P    PLN + +  L++KD   Y   I  Y+N  + K
Sbjct: 115 PNGSDPLNNEAA-TLQLKDKDMYEQKIHEYINKYATK 150

>TPHA0O00920 Chr15 (170342..171022) [681 bp, 226 aa] {ON} Anc_1.436
           YEL012W
          Length = 226

 Score = 68.6 bits (166), Expect = 4e-14,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 67/121 (55%), Gaps = 4/121 (3%)

Query: 33  DDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKIC 92
           D++  +     GP +TPY G  + L + L   YP K P + F   K+ H NI+  +G IC
Sbjct: 29  DNMQEFYVKFHGPKDTPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSIC 87

Query: 93  LNILDNANWSPVWNLLTVV-LAIYQLLSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYYL 151
           L+++ N+ WSP+++LL ++   I  LL +P    PLN + +  L++ D   Y   I+ Y+
Sbjct: 88  LDVI-NSTWSPLYDLLNIIEWMIPGLLKEPNGSDPLNNEAAG-LQLHDKKIYEEKIKEYI 145

Query: 152 N 152
           +
Sbjct: 146 D 146

>Skud_5.87 Chr5 (131751..132380) [630 bp, 210 aa] {ON} YEL012W
           (REAL)
          Length = 210

 Score = 67.8 bits (164), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 46/152 (30%), Positives = 82/152 (53%), Gaps = 12/152 (7%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           S+RR+  E  V+K  + +H+  + +      D +  +    LGP +TPY    + L + L
Sbjct: 3   SKRRI--ETDVMKLLMSDHQVDLVN------DSMQEFHVKFLGPKDTPYENGVWRLHVEL 54

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVV-LAIYQLLSD 120
              YP K P + F   K+ H NI+  +G ICL+++ N+ WSP+++L+ ++   I  LL +
Sbjct: 55  PDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVI-NSTWSPLYDLINILEWMIPGLLKE 112

Query: 121 PVTDSPLNIDLSNILKIKDTSAYYGLIEYYLN 152
           P    PLN + +  L+++D   Y   I+ Y++
Sbjct: 113 PNGSDPLNNEAAT-LQLRDKKLYEEKIKEYID 143

>Kwal_26.7009 s26 (162391..162876) [486 bp, 161 aa] {ON} YOR339C
           (UBC11) - homolog of ubiquitin carrier protein E2-C
           [contig 46] FULL
          Length = 161

 Score = 67.0 bits (162), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 41/100 (41%), Positives = 57/100 (57%), Gaps = 3/100 (3%)

Query: 29  PIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKT 88
           P   DDLT W   I GP  TPY G  F + +     YP   P+V F +  M H N++  +
Sbjct: 38  PESEDDLTKWCGIITGPDGTPYEGLRFKIALEFAQTYPYTAPKVRFVS-PMWHPNVDM-S 95

Query: 89  GKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLN 128
           G ICL+IL +  WS V+N+ T++L++  LL +P   SPLN
Sbjct: 96  GNICLDILKD-QWSAVYNVQTILLSLQSLLEEPNNSSPLN 134

>Kpol_1030.18 s1030 (30890..30894,31122..31788) [672 bp, 223 aa]
           {ON} (30890..30894,31122..31788) [672 nt, 224 aa]
          Length = 223

 Score = 68.2 bits (165), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 40/122 (32%), Positives = 68/122 (55%), Gaps = 4/122 (3%)

Query: 32  SDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKI 91
           +D++  +     GP +TPY    + L + L   YP K P + F   K+ H NI+  +G I
Sbjct: 27  NDNMQEFYVKFCGPKDTPYENGCWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 85

Query: 92  CLNILDNANWSPVWNLLTVV-LAIYQLLSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYY 150
           CL+++ N+ WSP+++LL +V   I  LL +P    PLN + +  L++ D + Y   I+ Y
Sbjct: 86  CLDVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAAG-LQLHDKTLYEQKIKEY 143

Query: 151 LN 152
           ++
Sbjct: 144 ID 145

>TBLA0A01290 Chr1 complement(306004..306658,306780..306784) [660 bp,
           219 aa] {ON} Anc_1.436 YEL012W
          Length = 219

 Score = 67.8 bits (164), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 48/152 (31%), Positives = 82/152 (53%), Gaps = 12/152 (7%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           S+RR+  E  V+K  + NH      +E ++ D++  +     GP  TPY    + L + L
Sbjct: 4   SKRRI--ETDVMKLLMSNH-----DVELVN-DNMQEFFIKFFGPDETPYEKGVWRLHVEL 55

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVV-LAIYQLLSD 120
              YP K P + F   K+ H NI+  +G ICL+++ N+ WSP+++L+ +V   I  LL +
Sbjct: 56  PDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVI-NSTWSPLYDLINIVEWMIPGLLKE 113

Query: 121 PVTDSPLNIDLSNILKIKDTSAYYGLIEYYLN 152
           P    PLN + +  L+++D   Y   I+ Y++
Sbjct: 114 PNGTDPLNNEAAG-LQLRDKKLYEEKIKEYID 144

>NDAI0D01140 Chr4 (259072..259076,259218..259950) [738 bp, 245 aa]
           {ON} 
          Length = 245

 Score = 68.2 bits (165), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 41/121 (33%), Positives = 67/121 (55%), Gaps = 4/121 (3%)

Query: 32  SDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKI 91
           +D++  +     GP +TPY    + L + L   YP K P + F   K+ H NI+  +G I
Sbjct: 44  NDNMQEFYIKFCGPKDTPYENGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 102

Query: 92  CLNILDNANWSPVWNLLTVV-LAIYQLLSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYY 150
           CL+++ N+ WSP+++LL +V   I  LL +P    PLN + +  L++KD   Y   I+ Y
Sbjct: 103 CLDVI-NSTWSPLYDLLNIVEWMIPGLLKEPNGSDPLNNEAA-TLELKDKKLYEERIKEY 160

Query: 151 L 151
           +
Sbjct: 161 I 161

>Kwal_56.23482 s56 complement(559955..560404) [450 bp, 149 aa] {ON}
           YDR092W (UBC13) - ubiquitin-conjugating enzyme [contig
           176] FULL
          Length = 149

 Score = 66.2 bits (160), Expect = 8e-14,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 60/101 (59%), Gaps = 3/101 (2%)

Query: 32  SDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKI 91
            ++L  +  TI GP  +PY    F L + L  +YP++ P+V F   K+ H NI+ + G+I
Sbjct: 29  EENLRYFQVTIEGPQQSPYENGVFKLELFLPDDYPMEAPKVRFLT-KIYHPNID-RLGRI 86

Query: 92  CLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLS 132
           CL++L   NWSP   + TV+L++  LL+ P  + PL  D++
Sbjct: 87  CLDVL-KTNWSPALQIRTVLLSVQALLASPNPNDPLANDVA 126

>KAFR0H02960 Chr8 complement(566019..566582) [564 bp, 187 aa] {ON}
           Anc_1.436 YEL012W
          Length = 187

 Score = 67.0 bits (162), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 82/152 (53%), Gaps = 12/152 (7%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           S+RR+  E  V+K  + +HK  + +      D++  +     GP +TPY    + L + L
Sbjct: 4   SKRRI--ETDVMKLLMSDHKVTLVN------DNMQEFHVKFHGPKDTPYEHGVWRLHVEL 55

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVV-LAIYQLLSD 120
              YP K P + F   K+ H NI+  +G ICL+++ N+ WSP+++L+ +V   I  LL +
Sbjct: 56  PDNYPYKSPSIGF-VNKIFHPNIDVASGSICLDVI-NSTWSPLYDLINIVEWMIPGLLKE 113

Query: 121 PVTDSPLNIDLSNILKIKDTSAYYGLIEYYLN 152
           P    PLN + +  L+++D   Y   I+ Y++
Sbjct: 114 PNGSDPLNNEAA-TLQLRDKVLYEQKIKEYID 144

>AEL045W Chr5 (549376..549380,549444..550074) [636 bp, 211 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YEL012W
           (UBC8); 1-intron
          Length = 211

 Score = 66.6 bits (161), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 49/152 (32%), Positives = 82/152 (53%), Gaps = 12/152 (7%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           S+RR+  E  V+K  + +H      +E +D D++  +     GP  TPY    + L + L
Sbjct: 4   SKRRI--ETDVMKLLMSDH-----DVELVD-DNMQEFHVKFHGPKGTPYERGVWRLHVEL 55

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVV-LAIYQLLSD 120
              YP K P + F   K+ H NI+  +G ICL+++ N+ WSP+++LL +V   I  LL +
Sbjct: 56  PDNYPYKSPSIGF-VNKIFHPNIDAASGSICLDVI-NSTWSPLYDLLNIVEWMIPGLLKE 113

Query: 121 PVTDSPLNIDLSNILKIKDTSAYYGLIEYYLN 152
           P    PLN + +  L++K+   Y   I+ Y++
Sbjct: 114 PNGSDPLNNEAA-TLQLKNPQMYEEKIQEYID 144

>TDEL0B05670 Chr2 (1001037..1001648) [612 bp, 203 aa] {ON} Anc_1.436
           YEL012W
          Length = 203

 Score = 65.1 bits (157), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 67/122 (54%), Gaps = 4/122 (3%)

Query: 32  SDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKI 91
           +D++  +     GP +TPY    + L + L   YP K P + F   K+ H NI+  +G I
Sbjct: 14  NDNMQEFHVKFRGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKILHPNIDVASGSI 72

Query: 92  CLNILDNANWSPVWNLLTVV-LAIYQLLSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYY 150
           CL+++ N+ WSP+++L  +V   I  LL +P    PLN + +  L+++D   Y   I+ Y
Sbjct: 73  CLDVI-NSTWSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAAT-LQLRDKKLYEEKIKEY 130

Query: 151 LN 152
           ++
Sbjct: 131 ID 132

>ZYRO0E03806g Chr5 (288494..288498,288563..289187) [630 bp, 209 aa]
           {ON} highly similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1 6-
           bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 209

 Score = 64.7 bits (156), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 67/122 (54%), Gaps = 4/122 (3%)

Query: 32  SDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKI 91
           +D++  +     GP +TPY    + L + L   YP K P + F   K+ H NI+  +G I
Sbjct: 28  NDNMQEFHVKFHGPKDTPYETGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSI 86

Query: 92  CLNILDNANWSPVWNLLTVV-LAIYQLLSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYY 150
           CL+++ N+ WSP+++L  +V   I  LL +P    PLN + +  L+++D   Y   I+ Y
Sbjct: 87  CLDVI-NSTWSPLYDLKNIVEWMIPGLLKEPNGSDPLNNEAA-TLQLRDKKLYEEKIKEY 144

Query: 151 LN 152
           ++
Sbjct: 145 ID 146

>KLTH0H13816g Chr8 complement(1208214..1208910,1209008..1209012)
           [702 bp, 233 aa] {ON} highly similar to uniprot|P28263
           Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin-conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6- bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 233

 Score = 65.1 bits (157), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 47/152 (30%), Positives = 81/152 (53%), Gaps = 12/152 (7%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           S+RR+  E  V+K  + +H      +E +D D++  +     GP  TPY    + L + L
Sbjct: 4   SKRRI--ETDVMKLLMSDH-----DVELVD-DNMQEFHIKFHGPQGTPYEAGVWRLHVEL 55

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVV-LAIYQLLSD 120
              YP K P + F   K+ H NI+  +G ICL+++ N+ WSP+++L+ +V   I  LL +
Sbjct: 56  PDNYPYKSPSIGF-VNKIFHPNIDAASGSICLDVI-NSTWSPLYDLINIVEWMIPGLLKE 113

Query: 121 PVTDSPLNIDLSNILKIKDTSAYYGLIEYYLN 152
           P    PLN + +  L++K+   Y   I  +++
Sbjct: 114 PNGSDPLNNEAA-TLQLKNKELYEQKIREFID 144

>SAKL0D10560g Chr4 complement(885746..886369) [624 bp, 207 aa] {ON}
           highly similar to gnl|GLV|KLLA0A11198g Kluyveromyces
           lactis KLLA0A11198g and similar to YEL012W
           uniprot|P28263 Saccharomyces cerevisiae YEL012W UBC8
           Ubiquitin- conjugating enzyme that negatively regulates
           gluconeogenesis by mediating the glucose-induced
           ubiquitination of fructose-1 6-bisphosphatase (FBPase)
           cytoplasmic enzyme that catalyzes the ubiquitination of
           histones in vitro
          Length = 207

 Score = 64.7 bits (156), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 67/122 (54%), Gaps = 4/122 (3%)

Query: 32  SDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKI 91
           +D +  +     GP +TPY    + L + L   YP K P + F   K+ H NI+  +G I
Sbjct: 14  NDSMQEFHVKFHGPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSI 72

Query: 92  CLNILDNANWSPVWNLLTVV-LAIYQLLSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYY 150
           CL+++ N+ WSP+++L+ +V   I  LL +P    PLN + +  L++K+   Y   I+ Y
Sbjct: 73  CLDVI-NSTWSPLYDLINIVEWMIPGLLKEPNGSDPLNNEAA-TLQLKNKELYEEKIQEY 130

Query: 151 LN 152
           ++
Sbjct: 131 ID 132

>NCAS0G03130 Chr7 (575808..576503) [696 bp, 231 aa] {ON} 
          Length = 231

 Score = 64.7 bits (156), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 39/110 (35%), Positives = 62/110 (56%), Gaps = 4/110 (3%)

Query: 44  GPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSP 103
           GP +TPY    + L + L   YP K P + F   K+ H NI+  +G ICL+++ N+ WSP
Sbjct: 61  GPKDTPYEKGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDIASGSICLDVI-NSTWSP 118

Query: 104 VWNLLTVV-LAIYQLLSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYYLN 152
           +++LL +V   I  LL +P    PLN + +  L+++D   Y   I  Y++
Sbjct: 119 LYDLLNIVEWMIPGLLKEPNGSDPLNNEAAT-LELRDKKLYEEKIREYID 167

>Kwal_34.16174 s34 (229678..230319) [642 bp, 213 aa] {ON} YEL012W
           (UBC8) - ubiquitin-conjugating enzyme; ubiquitin-protein
           ligase [contig 267] FULL
          Length = 213

 Score = 63.9 bits (154), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 66/122 (54%), Gaps = 4/122 (3%)

Query: 32  SDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKI 91
           +D++  +     GP  TPY G  + L + L   YP K P + F   K+ H NI+  +G I
Sbjct: 14  NDNMQEFHVKFHGPRETPYEGGVWRLHVELPDNYPYKSPSIGF-VNKIFHPNIDAASGSI 72

Query: 92  CLNILDNANWSPVWNLLTVV-LAIYQLLSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYY 150
           CL+++ N+ WSP+++LL ++   I  LL +P    PLN + +  L++K    Y   I  +
Sbjct: 73  CLDVI-NSAWSPLYDLLNILEWMIPGLLKEPNGSDPLNNEAA-TLQLKSKELYERKIREF 130

Query: 151 LN 152
           ++
Sbjct: 131 ID 132

>NCAS0I01430 Chr9 (264456..265232) [777 bp, 258 aa] {ON} 
          Length = 258

 Score = 63.2 bits (152), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 44/144 (30%), Positives = 74/144 (51%), Gaps = 26/144 (18%)

Query: 6   LLKEYQVVKKELGNHKNIISS--LEPIDSDDLTNWTATILG-PPNTPYHGHSFDLRIHLT 62
           LL++Y    +EL + K  I S  +E  D  ++  W   ++    ++ YHG  F  ++   
Sbjct: 19  LLRQY----RELTDPKRAIPSFHIELEDDSNIFTWNIGVMVLNKDSIYHGGYFQSQMKFP 74

Query: 63  PEYPLKPPQVTFSAYKMP---HCNIEFKTGKICLNIL-----------DNANWSPVWNLL 108
            ++P  PPQ  F    +P   H N+ ++ GK+C++IL           DN  WSPV ++ 
Sbjct: 75  KDFPFSPPQFKF----IPPIYHPNV-YRDGKLCISILHQSGDAMTSEPDNETWSPVQSVE 129

Query: 109 TVVLAIYQLLSDPVTDSPLNIDLS 132
           +V+++I  LL DP   SP N+D +
Sbjct: 130 SVLISIVSLLEDPNVSSPANVDAA 153

>NDAI0A05530 Chr1 (1251593..1252414) [822 bp, 273 aa] {ON} Anc_3.301
           YDR054C
          Length = 273

 Score = 62.4 bits (150), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 73/142 (51%), Gaps = 22/142 (15%)

Query: 6   LLKEYQVVKKELGNHKNIISSLEPIDSDDLTN---WTATILG-PPNTPYHGHSFDLRIHL 61
           LL++Y    +EL + K  I S   I+ DD +N   W   ++    ++ YHG  F  ++  
Sbjct: 12  LLRQY----RELTDPKKAIPSFH-IELDDDSNLFVWNIGVMVLNEDSIYHGGYFKAQMRF 66

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-----------DNANWSPVWNLLTV 110
             ++P  PPQ  F+   + H N+ ++ G++C++IL           D   WSPV  + +V
Sbjct: 67  PEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQGGDPMTDEPDAETWSPVQTVESV 124

Query: 111 VLAIYQLLSDPVTDSPLNIDLS 132
           +++I  LL DP   SP N+D +
Sbjct: 125 LISIVSLLEDPNISSPANVDAA 146

>NCAS0A10770 Chr1 complement(2142376..2143197) [822 bp, 273 aa] {ON}
           Anc_3.301
          Length = 273

 Score = 62.4 bits (150), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/142 (30%), Positives = 73/142 (51%), Gaps = 22/142 (15%)

Query: 6   LLKEYQVVKKELGNHKNIISSLEPIDSDDLTN---WTATILG-PPNTPYHGHSFDLRIHL 61
           LL++Y    +EL + K  I S   I+ DD +N   W   ++    ++ YHG  F  ++  
Sbjct: 12  LLRQY----RELTDPKKAIPSFH-IELDDDSNLFVWNIGVMVLNEDSIYHGGYFKAQMRF 66

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-----------DNANWSPVWNLLTV 110
             ++P  PPQ  F+   + H N+ ++ G++C++IL           D   WSPV  + +V
Sbjct: 67  PEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQGGDPMTDEPDAETWSPVQTVESV 124

Query: 111 VLAIYQLLSDPVTDSPLNIDLS 132
           +++I  LL DP   SP N+D +
Sbjct: 125 LISIVSLLEDPNISSPANVDAA 146

>Skud_4.306 Chr4 complement(537399..538292) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 62.4 bits (150), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 73/141 (51%), Gaps = 20/141 (14%)

Query: 6   LLKEYQVVKKELGNHKNIISS--LEPIDSDDLTNWTATILG-PPNTPYHGHSFDLRIHLT 62
           LL++Y    +EL + K  I S  +E  D  ++  W   ++    ++ YHG  F  ++   
Sbjct: 12  LLRQY----RELTDPKKAIPSFHIELEDDSNIFTWNIGVMVLNEDSIYHGGFFKAQMRFP 67

Query: 63  PEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-----------DNANWSPVWNLLTVV 111
            ++P  PPQ  F+   + H N+ ++ G++C++IL           D   WSPV  + +V+
Sbjct: 68  EDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQTVESVL 125

Query: 112 LAIYQLLSDPVTDSPLNIDLS 132
           ++I  LL DP  +SP N+D +
Sbjct: 126 ISIVSLLEDPNINSPANVDAA 146

>YDR054C Chr4 complement(561440..562327) [888 bp, 295 aa] {ON}
           CDC34Ubiquitin-conjugating enzyme (E2) and catalytic
           subunit of SCF ubiquitin-protein ligase complex
           (together with Skp1p, Rbx1p, Cdc53p, and an F-box
           protein) that regulates cell cycle progression by
           targeting key substrates for degradation
          Length = 295

 Score = 62.0 bits (149), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 77/152 (50%), Gaps = 26/152 (17%)

Query: 1   MSERR------LLKEYQVVKKELGNHKNIISS--LEPIDSDDLTNWTATILG-PPNTPYH 51
           MS R+      LL++Y    +EL + K  I S  +E  D  ++  W   ++    ++ YH
Sbjct: 1   MSSRKSTASSLLLRQY----RELTDPKKAIPSFHIELEDDSNIFTWNIGVMVLNEDSIYH 56

Query: 52  GHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-----------DNAN 100
           G  F  ++    ++P  PPQ  F+   + H N+ ++ G++C++IL           D   
Sbjct: 57  GGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAET 114

Query: 101 WSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLS 132
           WSPV  + +V+++I  LL DP  +SP N+D +
Sbjct: 115 WSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>Smik_4.290 Chr4 complement(527854..528747) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 62.0 bits (149), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 44/152 (28%), Positives = 77/152 (50%), Gaps = 26/152 (17%)

Query: 1   MSERR------LLKEYQVVKKELGNHKNIISS--LEPIDSDDLTNWTATILG-PPNTPYH 51
           MS R+      LL++Y    +EL + K  I S  +E  D  ++  W   ++    ++ YH
Sbjct: 1   MSSRKSTASSLLLRQY----RELTDPKKAIPSFHIELEDDSNIFTWNIGVMVLNEDSIYH 56

Query: 52  GHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-----------DNAN 100
           G  F  ++    ++P  PPQ  F+   + H N+ ++ G++C++IL           D   
Sbjct: 57  GGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAET 114

Query: 101 WSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLS 132
           WSPV  + +V+++I  LL DP  +SP N+D +
Sbjct: 115 WSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>KAFR0H01270 Chr8 (239005..239868) [864 bp, 287 aa] {ON} 
          Length = 287

 Score = 62.0 bits (149), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 77/153 (50%), Gaps = 28/153 (18%)

Query: 1   MSERR------LLKEYQVVKKELGNHKNIISSLEPIDSDDLTN---WTATILG-PPNTPY 50
           MS R+      LL++Y    +EL + K  I S   I+ DD +N   W   ++    ++ Y
Sbjct: 1   MSSRKSTAASLLLRQY----RELTDPKKAIPSFN-IELDDDSNIFVWNIGVMVLNEDSIY 55

Query: 51  HGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-----------DNA 99
           HG  F  ++    ++P  PPQ  F+   + H N+ ++ G++C++IL           D  
Sbjct: 56  HGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAE 113

Query: 100 NWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLS 132
            WSPV  + +V+++I  LL DP   SP N+D +
Sbjct: 114 TWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Smik_4.171 Chr4 (313921..313958,314069..314504) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 60.1 bits (144), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 36/96 (37%), Positives = 51/96 (53%), Gaps = 3/96 (3%)

Query: 32  SDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKI 91
           S DL  W A I G   T + G  + + +    EYP KPP+V F A    H N+ + +G I
Sbjct: 35  SMDLQKWEAGIPGKEGTNWAGGVYPISVEYPNEYPSKPPKVKFPA-GFYHPNV-YPSGTI 92

Query: 92  CLNIL-DNANWSPVWNLLTVVLAIYQLLSDPVTDSP 126
           CL+IL ++ +W P   L  +VL +  LL  P  +SP
Sbjct: 93  CLSILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSP 128

>Kwal_27.10444 s27 (347585..348421) [837 bp, 278 aa] {ON} YDR054C
           (CDC34) - ubiquitin-conjugating enzyme, E2 [contig 36]
           FULL
          Length = 278

 Score = 61.6 bits (148), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 73/142 (51%), Gaps = 22/142 (15%)

Query: 6   LLKEYQVVKKELGNHKNIISSLEPIDSDDLTN---WTATILG-PPNTPYHGHSFDLRIHL 61
           LL++Y    +EL + K  I S   I+ DD +N   W   ++    ++ YHG  F  ++  
Sbjct: 12  LLRQY----RELTDAKKAIPSFH-IELDDDSNIFLWNVGVMVLNEDSIYHGGYFKAQMRF 66

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-----------DNANWSPVWNLLTV 110
             ++P  PP   F+   + H N+ ++ G++C++IL           D+  WSPV  + +V
Sbjct: 67  PEDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHTSGDPTSEEPDSETWSPVQTVESV 124

Query: 111 VLAIYQLLSDPVTDSPLNIDLS 132
           +++I  LL DP   SP N+D +
Sbjct: 125 LISIVSLLEDPNISSPANVDAA 146

>YDL064W Chr4 (337487..337524,337635..338070) [474 bp, 157 aa] {ON} 
           UBC9SUMO-conjugating enzyme involved in the Smt3p
           conjugation pathway; nuclear protein required for S- and
           M-phase cyclin degradation and mitotic control; involved
           in proteolysis mediated by the anaphase-promoting
           complex cyclosome (APCC)
          Length = 157

 Score = 59.7 bits (143), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 64/126 (50%), Gaps = 7/126 (5%)

Query: 4   RRLLKEYQVVKKE--LGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           +RL +E +  +K+   G +   +   +   S DL  W A I G   T + G  + + +  
Sbjct: 7   QRLQEERKKWRKDHPFGFYAKPVKKAD--GSMDLQKWEAGIPGKEGTNWAGGVYPITVEY 64

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-DNANWSPVWNLLTVVLAIYQLLSD 120
             EYP KPP+V F A    H N+ + +G ICL+IL ++ +W P   L  +VL +  LL  
Sbjct: 65  PNEYPSKPPKVKFPA-GFYHPNV-YPSGTICLSILNEDQDWRPAITLKQIVLGVQDLLDS 122

Query: 121 PVTDSP 126
           P  +SP
Sbjct: 123 PNPNSP 128

>ZYRO0G12650g Chr7 complement(1002296..1003153) [858 bp, 285 aa]
           {ON} highly similar to uniprot|Q750Z0 Ashbya gossypii
           AGL203C AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 285

 Score = 61.2 bits (147), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 45/152 (29%), Positives = 76/152 (50%), Gaps = 26/152 (17%)

Query: 1   MSERR------LLKEYQVVKKELGNHKNIISS--LEPIDSDDLTNWTATILG-PPNTPYH 51
           MS RR      LL++Y    +EL + K  I S  +E  D  ++  W   ++    ++ YH
Sbjct: 1   MSGRRNTAANLLLRQY----RELTDPKKAIPSFHIELEDDSNIFVWNIGVMVLNEDSIYH 56

Query: 52  GHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-----------DNAN 100
           G  F  ++    ++P  PPQ  F+   + H N+ ++ G++C++IL           D   
Sbjct: 57  GGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAET 114

Query: 101 WSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLS 132
           WSPV  + +V+++I  LL DP   SP N+D +
Sbjct: 115 WSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>KLTH0C04818g Chr3 (416167..416994) [828 bp, 275 aa] {ON} highly
           similar to uniprot|P14682 Saccharomyces cerevisiae
           YDR054C CDC34 Ubiquitin-conjugating enzyme or E2
           together with Skp1p Rbx1p Cdc53p and an F-box protein
           forms a ubiquitin-protein ligase called the SCF complex
           which regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 275

 Score = 61.2 bits (147), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 73/142 (51%), Gaps = 22/142 (15%)

Query: 6   LLKEYQVVKKELGNHKNIISSLEPIDSDDLTN---WTATILG-PPNTPYHGHSFDLRIHL 61
           LL++Y    +EL + K  I S   I+ DD +N   W   ++    ++ YHG  F  ++  
Sbjct: 12  LLRQY----RELTDAKKAIPSFH-IELDDDSNIFLWNIGVMVLNEDSIYHGGYFKAQMRF 66

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-----------DNANWSPVWNLLTV 110
             ++P  PP   F+   + H N+ ++ G++C++IL           D+  WSPV  + +V
Sbjct: 67  PEDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHTSGDPTSEEPDSETWSPVQTVESV 124

Query: 111 VLAIYQLLSDPVTDSPLNIDLS 132
           +++I  LL DP   SP N+D +
Sbjct: 125 LISIVSLLEDPNISSPANVDAA 146

>Suva_4.186 Chr4 (327039..327076,327179..327614) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 59.3 bits (142), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 64/126 (50%), Gaps = 7/126 (5%)

Query: 4   RRLLKEYQVVKKE--LGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           +RL +E +  +K+   G +   +   +   S DL  W A I G   T + G  + + +  
Sbjct: 7   QRLQEERKKWRKDHPFGFYAKPVKKAD--GSMDLQKWEAGIPGREGTNWAGGVYPITVEY 64

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-DNANWSPVWNLLTVVLAIYQLLSD 120
             EYP KPP+V F A    H N+ + +G ICL+IL ++ +W P   L  +VL +  LL  
Sbjct: 65  PNEYPSKPPKVKFPA-GFYHPNV-YPSGTICLSILNEDQDWRPAITLKQIVLGVQDLLDS 122

Query: 121 PVTDSP 126
           P  +SP
Sbjct: 123 PNPNSP 128

>NCAS0A05940 Chr1 (1171599..1172180) [582 bp, 193 aa] {ON} Anc_4.49
          Length = 193

 Score = 60.1 bits (144), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 80/162 (49%), Gaps = 12/162 (7%)

Query: 1   MSERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYH--GHSFDLR 58
           +S  R+  +  +   EL    ++   + P D   L N    ++  P+  Y+  GH F   
Sbjct: 32  ISAARIRLQRDIDDLELPPTVSLTICISPTDPSSLDNPLLDVIISPDEGYYKNGH-FRFS 90

Query: 59  IHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLL 118
           +     YP++PP+V     ++ H NI+ + GK+CLNIL   +WSP  +L ++++ +  L 
Sbjct: 91  LEFNDNYPMEPPKVV-CRNRIYHPNIDVQ-GKVCLNIL-REDWSPALDLQSIIVGLLFLF 147

Query: 119 SDPVTDSPLNIDLSNILKIKDTSAYYGLIE-----YYLNNKS 155
            +P    PLN D + +   KD++A+   +      Y LN+ S
Sbjct: 148 LEPNAKDPLNTDAAAVFS-KDSNAFAKFVRKTMEGYSLNSVS 188

>Kpol_1065.45 s1065 (121426..122397) [972 bp, 323 aa] {ON}
           (121426..122397) [972 nt, 324 aa]
          Length = 323

 Score = 60.8 bits (146), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 46/153 (30%), Positives = 77/153 (50%), Gaps = 28/153 (18%)

Query: 1   MSERR------LLKEYQVVKKELGNHKNIISSLEPIDSDDLTN---WTATILG-PPNTPY 50
           MS R+      LL++Y    +EL N K  I S   I+ +D +N   W   ++    ++ Y
Sbjct: 1   MSNRKSTAASLLLRQY----RELTNPKKAIPSFH-INLEDDSNIFVWNIGVMVLNEDSIY 55

Query: 51  HGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-----------DNA 99
           HG  F  ++    ++P  PPQ  F+   + H N+ ++ G++C++IL           D  
Sbjct: 56  HGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDELDAE 113

Query: 100 NWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLS 132
            WSPV  + +V+++I  LL DP   SP N+D +
Sbjct: 114 TWSPVQTVESVLISIVSLLEDPNISSPANVDAA 146

>Suva_2.211 Chr2 complement(361071..361964) [894 bp, 297 aa] {ON}
           YDR054C (REAL)
          Length = 297

 Score = 60.8 bits (146), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 45/153 (29%), Positives = 78/153 (50%), Gaps = 28/153 (18%)

Query: 1   MSERR------LLKEYQVVKKELGNHKNIISSLEPIDSDDLTN---WTATILG-PPNTPY 50
           MS R+      LL++Y    +EL + K  I S   I+ +D +N   W   ++    ++ Y
Sbjct: 1   MSSRKSTASSLLLRQY----RELTDPKKAIPSFH-IELEDDSNIFIWNIGVMVLNEDSIY 55

Query: 51  HGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-----------DNA 99
           HG  F  ++    ++P  PPQ  F+   + H N+ ++ G++C++IL           D  
Sbjct: 56  HGGFFKAQMRFPEDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAE 113

Query: 100 NWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLS 132
            WSPV  + +V+++I  LL DP  +SP N+D +
Sbjct: 114 TWSPVQTVESVLISIVSLLEDPNINSPANVDAA 146

>TBLA0I02960 Chr9 complement(706068..706503,706636..706673) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 58.9 bits (141), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 37/96 (38%), Positives = 53/96 (55%), Gaps = 3/96 (3%)

Query: 32  SDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKI 91
           S +L  W A I G  +T +HG  + + I    EYP KPP+V F A    H NI + +G +
Sbjct: 35  SMNLQLWEAGIPGKESTIWHGALYPITIEYPDEYPSKPPKVKFPA-GFYHPNI-YPSGTV 92

Query: 92  CLNIL-DNANWSPVWNLLTVVLAIYQLLSDPVTDSP 126
           CL+IL ++ +W P   L  +VL +  LL  P  +SP
Sbjct: 93  CLSILNEDQDWRPAITLKQIVLGVQDLLDTPNPNSP 128

>TDEL0D03260 Chr4 (610053..610922) [870 bp, 289 aa] {ON} Anc_3.301
           YDR054C
          Length = 289

 Score = 60.5 bits (145), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 71/141 (50%), Gaps = 20/141 (14%)

Query: 6   LLKEYQVVKKELGNHKNIISS--LEPIDSDDLTNWTATILG-PPNTPYHGHSFDLRIHLT 62
           LL++Y    +EL + K  I S  +E  D  ++  W   ++     + YHG  F  ++   
Sbjct: 12  LLRQY----RELTDPKKAIPSFHIELEDDSNIFVWNIGVMVLNEESIYHGGYFKAQMRFP 67

Query: 63  PEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-----------DNANWSPVWNLLTVV 111
            ++P  PPQ  F+   + H N+ ++ G++C++IL           D   WSPV  + +V+
Sbjct: 68  EDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQTVESVL 125

Query: 112 LAIYQLLSDPVTDSPLNIDLS 132
           ++I  LL DP   SP N+D +
Sbjct: 126 ISIVSLLEDPNISSPANVDAA 146

>KNAG0H01040 Chr8 (174417..175307) [891 bp, 296 aa] {ON} 
          Length = 296

 Score = 60.5 bits (145), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 40/141 (28%), Positives = 72/141 (51%), Gaps = 20/141 (14%)

Query: 6   LLKEYQVVKKELGNHKNIISS--LEPIDSDDLTNWTATILG-PPNTPYHGHSFDLRIHLT 62
           LL++Y    +EL + +  I S  +E  D  ++  W   ++    ++ YHG  F  ++   
Sbjct: 12  LLRQY----RELTDPRKCIPSFNIELEDDSNIFVWNVGVMVLNEDSLYHGGYFKAQMRFP 67

Query: 63  PEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-----------DNANWSPVWNLLTVV 111
            ++P  PPQ  F+   + H N+ ++ G++C++IL           D   WSPV  + +V+
Sbjct: 68  EDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQTVESVL 125

Query: 112 LAIYQLLSDPVTDSPLNIDLS 132
           ++I  LL DP   SP N+D +
Sbjct: 126 ISIVSLLEDPNISSPANVDAA 146

>Skud_4.191 Chr4 (332944..332981,333094..333529) [474 bp, 157 aa]
           {ON} YDL064W (REAL)
          Length = 157

 Score = 58.5 bits (140), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 41/126 (32%), Positives = 64/126 (50%), Gaps = 7/126 (5%)

Query: 4   RRLLKEYQVVKKE--LGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           +RL +E +  +K+   G +   +   +   S DL  W A I G   T + G  + + +  
Sbjct: 7   QRLQEERKKWRKDHPFGFYAKPVKKAD--GSMDLQKWEAGIPGKDATNWAGGVYPITVEY 64

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-DNANWSPVWNLLTVVLAIYQLLSD 120
             EYP KPP+V F A    H N+ + +G ICL+IL ++ +W P   L  +VL +  LL  
Sbjct: 65  PNEYPSKPPKVKFPA-GFYHPNV-YPSGTICLSILNEDQDWRPAITLKQIVLGVQDLLDS 122

Query: 121 PVTDSP 126
           P  +SP
Sbjct: 123 PNPNSP 128

>Ecym_4683 Chr4 complement(1330525..1331256) [732 bp, 243 aa] {ON}
           similar to Ashbya gossypii AGR372W
          Length = 243

 Score = 60.1 bits (144), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 37/119 (31%), Positives = 63/119 (52%), Gaps = 13/119 (10%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +RL KEY+++   + N    I ++ P D +++  W   I GPP+TPY G  +   +H  P
Sbjct: 8   KRLSKEYKMI---MENTPPYIIAV-PND-ENILEWHYVITGPPDTPYEGGQYHGTLHFPP 62

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKT-GKICLNILDNA--NWSPVWNLLTVVLAIYQLLS 119
           EYP KPP +  S       N  FK   ++CL++ D     W+P W++ T++  +   ++
Sbjct: 63  EYPFKPPAIRIST-----PNGRFKQHTRLCLSMSDYHPDTWNPSWSVATILNGLLSFMT 116

>Ecym_2669 Chr2 (1289437..1290243) [807 bp, 268 aa] {ON} similar to
           Ashbya gossypii AGL203C
          Length = 268

 Score = 60.1 bits (144), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 73/142 (51%), Gaps = 22/142 (15%)

Query: 6   LLKEYQVVKKELGNHKNIISSLEPIDSDDLTN---WTATILG-PPNTPYHGHSFDLRIHL 61
           LL++Y    +EL + K  I S   I+ DD +N   W   ++    ++ YHG  F  ++  
Sbjct: 12  LLRQY----RELTDPKKAIPSFH-IELDDDSNIFLWNIGVMVLNEDSIYHGGYFKAQMRF 66

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-----------DNANWSPVWNLLTV 110
             ++P  PP   F+   + H N+ ++ G++C++IL           D+  WSPV  + +V
Sbjct: 67  PEDFPFSPPSFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDSETWSPVQTVESV 124

Query: 111 VLAIYQLLSDPVTDSPLNIDLS 132
           +++I  LL DP   SP N+D +
Sbjct: 125 LISIVSLLEDPNISSPANVDAA 146

>AGL203C Chr7 complement(317749..318561) [813 bp, 270 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR054C
           (CDC34)
          Length = 270

 Score = 60.1 bits (144), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 73/142 (51%), Gaps = 22/142 (15%)

Query: 6   LLKEYQVVKKELGNHKNIISSLEPIDSDDLTN---WTATILG-PPNTPYHGHSFDLRIHL 61
           LL++Y    +EL + K  I S   I+ DD +N   W   ++    ++ YHG  F  ++  
Sbjct: 12  LLRQY----RELTDPKKAIPSFH-IELDDDSNIFSWNIGVMVLNEDSIYHGGYFKAQMRF 66

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-----------DNANWSPVWNLLTV 110
             ++P  PP   F+   + H N+ ++ G++C++IL           D+  WSPV  + +V
Sbjct: 67  PEDFPFSPPSFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDSETWSPVQTVESV 124

Query: 111 VLAIYQLLSDPVTDSPLNIDLS 132
           +++I  LL DP   SP N+D +
Sbjct: 125 LISIVSLLEDPNISSPANVDAA 146

>CAGL0E04598g Chr5 complement(444525..445412) [888 bp, 295 aa] {ON}
           highly similar to uniprot|P14682 Saccharomyces
           cerevisiae YDR054c CDC34 E2 ubiquitin-conjugating enzyme
          Length = 295

 Score = 60.1 bits (144), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 72/141 (51%), Gaps = 20/141 (14%)

Query: 6   LLKEYQVVKKELGNHKNIISS--LEPIDSDDLTNWTATILG-PPNTPYHGHSFDLRIHLT 62
           LL++Y    +EL + K  I S  +E  D  ++  W   ++    ++ YHG  F  ++   
Sbjct: 12  LLRQY----RELTDPKKAIPSFHIELEDDSNIFVWNIGVMVLNEDSIYHGGYFKAQMRFP 67

Query: 63  PEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-----------DNANWSPVWNLLTVV 111
            ++P  PPQ  F+   + H N+ ++ G++C++IL           D   WSPV  + +V+
Sbjct: 68  DDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDEPDAETWSPVQTVESVL 125

Query: 112 LAIYQLLSDPVTDSPLNIDLS 132
           ++I  LL DP   SP N+D +
Sbjct: 126 ISIVSLLEDPNISSPANVDAA 146

>TBLA0G03270 Chr7 complement(866771..867763) [993 bp, 330 aa] {ON}
           Anc_3.301 YDR054C
          Length = 330

 Score = 60.1 bits (144), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 72/141 (51%), Gaps = 20/141 (14%)

Query: 6   LLKEYQVVKKELGNHKNIISS--LEPIDSDDLTNWTATILG-PPNTPYHGHSFDLRIHLT 62
           LL++Y    +EL + +  I S  +E  D  +L  W   ++    ++ YHG  F  ++   
Sbjct: 12  LLRQY----RELTDPRKAIPSFHIELEDESNLFIWNIGVMVLNEDSIYHGGYFKSQMRFP 67

Query: 63  PEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-----------DNANWSPVWNLLTVV 111
            ++P  PPQ  F+   + H N+ ++ G++C++IL           D   WSPV  + +V+
Sbjct: 68  EDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTTDEPDAETWSPVQTVESVL 125

Query: 112 LAIYQLLSDPVTDSPLNIDLS 132
           ++I  LL DP   SP N+D +
Sbjct: 126 ISIVSLLEDPNISSPANVDAA 146

>SAKL0D02530g Chr4 (200047..200865) [819 bp, 272 aa] {ON} highly
           similar to uniprot|Q750Z0 Ashbya gossypii AGL203C
           AGL203Cp and similar to YDR054C uniprot|P14682
           Saccharomyces cerevisiae YDR054C CDC34 Ubiquitin-
           conjugating enzyme or E2 together with Skp1p Rbx1p
           Cdc53p and an F-box protein forms a ubiquitin-protein
           ligase called the SCF complex which regulates cell cycle
           progression by targeting key substrates for degradation
          Length = 272

 Score = 59.7 bits (143), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 73/142 (51%), Gaps = 22/142 (15%)

Query: 6   LLKEYQVVKKELGNHKNIISSLEPIDSDDLTN---WTATILG-PPNTPYHGHSFDLRIHL 61
           LL++Y    +EL + K  I S   I+ DD +N   W   ++    ++ YHG  F  ++  
Sbjct: 12  LLRQY----RELTDPKKAIPSFH-IELDDDSNIFLWNIGVMVLNEDSIYHGGYFKAQMKF 66

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-----------DNANWSPVWNLLTV 110
             ++P  PP   F+   + H N+ ++ G++C++IL           D+  WSPV  + +V
Sbjct: 67  PEDFPFSPPNFRFTP-AIYHPNV-YRDGRLCISILHQSGDPTSDEPDSETWSPVQTVESV 124

Query: 111 VLAIYQLLSDPVTDSPLNIDLS 132
           +++I  LL DP   SP N+D +
Sbjct: 125 LISIVSLLEDPNISSPANVDAA 146

>Suva_7.182 Chr7 complement(339292..339694,339786..339796) [414 bp,
           137 aa] {ON} YGL087C (REAL)
          Length = 137

 Score = 57.4 bits (137), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/121 (32%), Positives = 60/121 (49%), Gaps = 8/121 (6%)

Query: 5   RLLKEYQVVKKELGNHKNIISSLEPIDSDD--LTNWTATILGPPNTPYHGHSFDLRIHLT 62
           RLL+E +  +K  G       S    DSDD  +T W  TILGPP++ +    + L I   
Sbjct: 9   RLLEELEKGEKGFGPES---CSYGLADSDDITMTKWNGTILGPPHSNHENRIYSLSIECG 65

Query: 63  PEYPLKPPQVTF-SAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
           P YP  PP+VTF S   +P  N    TG+I  +     +W   + + T++L + + ++ P
Sbjct: 66  PNYPDSPPKVTFISKINLPCVNQ--TTGEIQTDFHTLRDWKRAYTMETLLLDLRKEMATP 123

Query: 122 V 122
            
Sbjct: 124 A 124

>ZYRO0G08228g Chr7 complement(670807..671212,671271..671281) [417
           bp, 138 aa] {ON} similar to uniprot|P28263 Saccharomyces
           cerevisiae YEL012W UBC8 Ubiquitin-conjugating enzyme
           that negatively regulates gluconeogenesis by mediating
           the glucose-induced ubiquitination of fructose-1
           6-bisphosphatase (FBPase) cytoplasmic enzyme that
           catalyzes the ubiquitination of histones in vitro
          Length = 138

 Score = 57.4 bits (137), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 39/122 (31%), Positives = 63/122 (51%), Gaps = 9/122 (7%)

Query: 5   RLLKEYQVVKKELGNHKNIISSLEPIDSDD--LTNWTATILGPPNTPYHGHSFDLRIHLT 62
           RLL+E +  +K LG       S    DSDD  +T W  TILGPP++ +    + L I   
Sbjct: 9   RLLEELEKGEKGLGPES---CSYGLADSDDISMTTWNGTILGPPHSNHENRIYSLSIECG 65

Query: 63  PEYPLKPPQVTF-SAYKMPHCNIEFKTGKICLNILDN-ANWSPVWNLLTVVLAIYQLLSD 120
           P YP  PP + F S   +P C ++ KTG++  +      +W   +N+ T++L + + ++ 
Sbjct: 66  PNYPDHPPTIKFISKINLP-C-VDSKTGQVTPSTFHTLRDWKRAYNMETILLELRKEMAT 123

Query: 121 PV 122
           P 
Sbjct: 124 PA 125

>CAGL0H03157g Chr8 complement(297272..297680,297881..297891) [420
           bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087c MMS2 part of the
           error-free postreplication repair pathway
          Length = 139

 Score = 56.6 bits (135), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 66/122 (54%), Gaps = 9/122 (7%)

Query: 5   RLLKEYQVVKKELGNHKNIISSLEPIDSDD--LTNWTATILGPPNTPYHGHSFDLRIHLT 62
           RLL+E +  +K LG       S    D+DD  +T W  TILGPP++ +    + + I   
Sbjct: 9   RLLEELEKGEKGLGPES---CSYGLADADDITMTRWNGTILGPPHSNHENRIYSVSIECG 65

Query: 63  PEYPLKPPQVTF-SAYKMPHCNIEFKTGKICLNILDN-ANWSPVWNLLTVVLAIYQLLSD 120
           P+YP +PP +TF S   +P C ++  TG++     +   +W  ++N+ T++L + + ++ 
Sbjct: 66  PKYPDEPPTITFISKINLP-C-VDQSTGEVNKEKFNTLKDWKRLYNMETILLDLRKEMAS 123

Query: 121 PV 122
           P 
Sbjct: 124 PA 125

>TPHA0B00770 Chr2 (173656..174129) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 57.0 bits (136), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 35/96 (36%), Positives = 50/96 (52%), Gaps = 3/96 (3%)

Query: 34  DLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICL 93
           DL +W A I G   T +    + + I    EYP KPP+V F A    H NI + +G +CL
Sbjct: 37  DLQHWEAGIPGKAGTLWADAVYPISIEYPDEYPSKPPKVKFPA-GFYHPNI-YPSGTVCL 94

Query: 94  NIL-DNANWSPVWNLLTVVLAIYQLLSDPVTDSPLN 128
           +IL ++ +W P   L  +VL +  LL  P  +SP  
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSPAQ 130

>TPHA0M01280 Chr13 complement(262582..263889) [1308 bp, 435 aa] {ON}
           Anc_3.301 YDR054C
          Length = 435

 Score = 58.5 bits (140), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 51/94 (54%), Gaps = 13/94 (13%)

Query: 50  YHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-----------DN 98
           YHG  F  ++    ++P  PPQ  F+   + H N+ ++ G++C++IL           D 
Sbjct: 55  YHGGYFKAQMRFPDDFPFSPPQFRFTP-AIYHPNV-YRDGRLCISILHQSGDPMTDELDA 112

Query: 99  ANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLS 132
             WSPV ++ +V+++I  LL DP   SP N+D +
Sbjct: 113 ETWSPVQSVESVLISIVSLLEDPNISSPANVDAA 146

>TDEL0G01580 Chr7 (311978..311988,312055..312460) [417 bp, 138 aa]
           {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 55.8 bits (133), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 35/121 (28%), Positives = 63/121 (52%), Gaps = 7/121 (5%)

Query: 5   RLLKEYQVVKKELGNHKNIISSLEPIDSDD--LTNWTATILGPPNTPYHGHSFDLRIHLT 62
           RLL+E +  +K LG       S    DSDD  +TNW  TILGPP++ +    + + I   
Sbjct: 9   RLLEELEKGEKGLGPES---CSYGLADSDDITMTNWNGTILGPPHSNHENRIYSVSIECG 65

Query: 63  PEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDN-ANWSPVWNLLTVVLAIYQLLSDP 121
           P YP +PP++ F +     C ++  TG++  ++     +W   + + T++L + + ++ P
Sbjct: 66  PNYPDEPPKIKFVSKVNVPC-VDSTTGEVKSSVFHTLRDWKRAYTMETLLLDLRKEMATP 124

Query: 122 V 122
            
Sbjct: 125 A 125

>CAGL0D00814g Chr4 (98589..99062) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064w UBC9 E2 ubiquitin-conjugating enzyme
          Length = 157

 Score = 56.2 bits (134), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 49/96 (51%), Gaps = 3/96 (3%)

Query: 34  DLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICL 93
           +L  W A I G   T +    F + +    EYP KPP+V F A    H NI + +G +CL
Sbjct: 37  NLQKWEAGIPGKEGTIWQDGVFPITVEYPDEYPSKPPKVKFPA-GFYHPNI-YPSGTVCL 94

Query: 94  NIL-DNANWSPVWNLLTVVLAIYQLLSDPVTDSPLN 128
           +IL ++ +W P   L  +VL +  LL  P  +SP  
Sbjct: 95  SILNEDQDWRPAITLKQIVLGVQDLLDSPNPNSPAQ 130

>TPHA0J02250 Chr10 complement(501615..502017,502181..502191) [414
           bp, 137 aa] {ON} Anc_6.187 YGL087C
          Length = 137

 Score = 55.8 bits (133), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 36/119 (30%), Positives = 61/119 (51%), Gaps = 6/119 (5%)

Query: 5   RLLKEYQVVKKELGNHKNIISSLEPIDSDD--LTNWTATILGPPNTPYHGHSFDLRIHLT 62
           RLL+E +  +K +G       S    DSDD  +TNW  TILGPP++ +    + L I   
Sbjct: 9   RLLEELEKGEKGMGPES---CSYGLADSDDISMTNWNGTILGPPHSNHSNRIYSLSIECG 65

Query: 63  PEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
           P YP +PP + F +    +C ++  TG +  +     NW   + + T++L + + ++ P
Sbjct: 66  PSYPDEPPTLKFISKINLNC-VDSATGVVKPDFNPIKNWKRSYTMETILLELRKEMAHP 123

>YGL087C Chr7 complement(346406..346808,346894..346904) [414 bp, 137
           aa] {ON}  MMS2Ubiquitin-conjugating enzyme variant
           involved in error-free postreplication repair; forms a
           heteromeric complex with Ubc13p, an active
           ubiquitin-conjugating enzyme; cooperates with
           chromatin-associated RING finger proteins, Rad18p and
           Rad5p
          Length = 137

 Score = 55.8 bits (133), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 60/121 (49%), Gaps = 8/121 (6%)

Query: 5   RLLKEYQVVKKELGNHKNIISSLEPIDSDD--LTNWTATILGPPNTPYHGHSFDLRIHLT 62
           RLL+E +  +K  G       S    DSDD  +T W  TILGPP++ +    + L I   
Sbjct: 9   RLLEELEKGEKGFGPES---CSYGLADSDDITMTKWNGTILGPPHSNHENRIYSLSIDCG 65

Query: 63  PEYPLKPPQVTF-SAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDP 121
           P YP  PP+VTF S   +P  N    TG++  +     +W   + + T++L + + ++ P
Sbjct: 66  PNYPDSPPKVTFISKINLPCVNP--TTGEVQTDFHTLRDWKRAYTMETLLLDLRKEMATP 123

Query: 122 V 122
            
Sbjct: 124 A 124

>TPHA0F00390 Chr6 complement(90730..91308,91376..91378) [582 bp, 193
           aa] {ON} Anc_4.49 YLR306W
          Length = 193

 Score = 56.6 bits (135), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 34/109 (31%), Positives = 55/109 (50%), Gaps = 4/109 (3%)

Query: 43  LGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWS 102
           + P   PY G +F   +     YP++PP       K+ H NI+   GKICLNIL   +WS
Sbjct: 75  ISPREGPYLGGAFKFNLKFNEMYPIEPPSA-ICLNKIFHPNIDL-NGKICLNIL-REDWS 131

Query: 103 PVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYYL 151
           P  +L ++V+ +  L  D  +  PLN   + +L   D + +  L++  +
Sbjct: 132 PALDLTSIVIGLLYLFLDFTSTDPLNQQAAEVLA-NDRNRFCELVQRAM 179

>KAFR0C02140 Chr3 complement(427907..428312,428412..428422) [417 bp,
           138 aa] {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 55.5 bits (132), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 40/121 (33%), Positives = 61/121 (50%), Gaps = 7/121 (5%)

Query: 5   RLLKEYQVVKKELGNHKNIISSLEPIDSDD--LTNWTATILGPPNTPYHGHSFDLRIHLT 62
           RLL+E +  +K  G       S    DSDD  +TNW  TILGPP++ +    + L I   
Sbjct: 9   RLLEELEKGEKGFGPES---CSYGLADSDDITMTNWNGTILGPPHSNHENRIYSLEIVCG 65

Query: 63  PEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDN-ANWSPVWNLLTVVLAIYQLLSDP 121
           P YP +PP+V F +     C I+ KTG+I         +W   + + TV+L + + ++ P
Sbjct: 66  PNYPDEPPKVKFVSKVNLPC-IDDKTGEIKEKEFHTLRDWKRSYTMQTVLLELRKEMALP 124

Query: 122 V 122
            
Sbjct: 125 A 125

>KLLA0D09196g Chr4 (772795..773673) [879 bp, 292 aa] {ON} similar to
           uniprot|P14682 Saccharomyces cerevisiae YDR054C CDC34
           Ubiquitin-conjugating enzyme or E2 together with Skp1p
           Rbx1p Cdc53p and an F-box protein forms a
           ubiquitin-protein ligase called the SCF complex which
           regulates cell cycle progression by targeting key
           substrates for degradation
          Length = 292

 Score = 57.4 bits (137), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 42/142 (29%), Positives = 68/142 (47%), Gaps = 22/142 (15%)

Query: 6   LLKEYQVVKKELGNHKNIISSLEPIDSDD----LTNWTATILGPPNTPYHGHSFDLRIHL 61
           LL++Y    +EL + K  I S      DD    L N    +L   +  YHG  F  ++  
Sbjct: 11  LLRQY----RELTDPKKAIPSFHIALEDDSNIFLWNIGVMVLNEESI-YHGGYFKAQMKF 65

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-----------DNANWSPVWNLLTV 110
             ++P  PP   F+   + H N+ ++ G++C++IL           D   WSPV  + +V
Sbjct: 66  PDDFPFSPPTFRFTP-AIYHPNV-YRDGRLCISILHQSGNPTSDEPDEETWSPVQTVESV 123

Query: 111 VLAIYQLLSDPVTDSPLNIDLS 132
           +++I  LL DP   SP N+D +
Sbjct: 124 LISIVSLLEDPNISSPANVDAA 145

>SAKL0H03058g Chr8 (288751..288788,288851..289286) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 55.8 bits (133), Expect = 9e-10,   Method: Compositional matrix adjust.
 Identities = 35/98 (35%), Positives = 51/98 (52%), Gaps = 3/98 (3%)

Query: 32  SDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKI 91
           S +L  W A I G   T +    + + I    +YP KPP+V F A    H NI + +G +
Sbjct: 35  SMNLQKWEAGIPGKEGTIWKEGVYPITIEYPDDYPSKPPKVKFPA-GFYHPNI-YPSGTV 92

Query: 92  CLNIL-DNANWSPVWNLLTVVLAIYQLLSDPVTDSPLN 128
           CL+IL ++ +W P   L  +VL +  LL+ P  DSP  
Sbjct: 93  CLSILNEDQDWRPAITLKQIVLGVQDLLNSPNPDSPAQ 130

>Smik_12.389 Chr12 (682460..683020) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 55.8 bits (133), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/114 (35%), Positives = 62/114 (54%), Gaps = 8/114 (7%)

Query: 27  LEPIDSDDLTNWTAT----ILGPPNTPYHGH-SFDLRIHLTPEYPLKPPQVTFSAYKMPH 81
           L+ I S D TN T +    I   P+  Y+ H S +  +     YP++PP+V     ++ H
Sbjct: 46  LDVITSPDSTNRTHSPKLEITVNPDEGYYTHGSINFSLDFNEVYPIEPPKVA-CLKRIFH 104

Query: 82  CNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNIL 135
            NI+FK G +CLNIL   +WSP  +L ++V  +  L  +P  + PLN D + +L
Sbjct: 105 PNIDFK-GNVCLNIL-REDWSPALDLQSIVTGLLFLFLEPNPNDPLNKDAAKLL 156

>KLTH0D14344g Chr4 complement(1178849..1179284,1179376..1179413)
           [474 bp, 157 aa] {ON} highly similar to uniprot|P50623
           Saccharomyces cerevisiae YDL064W UBC9 SUMO-conjugating
           enzyme involved in the Smt3p conjugation pathway nuclear
           protein required for S- and M-phase cyclin degradation
           and mitotic control involved in proteolysis mediated by
           the anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 55.5 bits (132), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 39/126 (30%), Positives = 61/126 (48%), Gaps = 3/126 (2%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +RL +E +  +K+         + +P  S +L  W A I G   T +    F + I    
Sbjct: 7   QRLQEERKKWRKDHPFGFFAKPTKKPDGSMNLQKWEAGIPGKEGTIWKDGVFPITIEYPD 66

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-DNANWSPVWNLLTVVLAIYQLLSDPV 122
           +YP KPP+V F A    H NI + +G +CL+IL ++ +W P   L  + L +  LL  P 
Sbjct: 67  DYPSKPPKVKFPA-GFYHPNI-YPSGTVCLSILNEDQDWRPAITLKQIALGVQDLLDSPN 124

Query: 123 TDSPLN 128
            +SP  
Sbjct: 125 PNSPAQ 130

>KAFR0G03240 Chr7 complement(673831..674304) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 55.1 bits (131), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 35/94 (37%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 34  DLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICL 93
           +L  W A I G   T +H   + L I    EYP KPP+V   A    H N+ + +G ICL
Sbjct: 37  NLQRWEAGIPGKEGTLWHEGVYPLTIEYPDEYPSKPPKVKLPA-GFYHPNV-YPSGTICL 94

Query: 94  NIL-DNANWSPVWNLLTVVLAIYQLLSDPVTDSP 126
           +IL ++ +W P   L  + L I  LL  P  +SP
Sbjct: 95  SILNEDQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>KAFR0F03040 Chr6 complement(599277..599786) [510 bp, 169 aa] {ON}
           Anc_4.49 YLR306W
          Length = 169

 Score = 55.5 bits (132), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 60/113 (53%), Gaps = 10/113 (8%)

Query: 50  YHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLT 109
           Y+G  F   +  +  YP+ PP V     K+ H NI+   GKICLNIL   +WSP  ++ +
Sbjct: 58  YNGGRFKFNLTTSESYPIDPPSVV-CLQKIYHPNIDLN-GKICLNIL-REDWSPALDIQS 114

Query: 110 VVLAIYQLLSDPVTDSPLNIDLSNILKIKDTSAYYGLIEY------YLNNKSD 156
           V++ +  L  +P    PLN D ++ L I+++  +  L+E       Y+N K D
Sbjct: 115 VIVGLLFLFLEPNPRDPLNKDAASTL-IRNSHDFARLVEKTMQGGNYMNVKYD 166

>CAGL0D06468g Chr4 (615364..615927) [564 bp, 187 aa] {ON} similar to
           uniprot|P52491 Saccharomyces cerevisiae YLR306w UBC12 E2
           ubiquitin-conjugating enzyme
          Length = 187

 Score = 55.1 bits (131), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/112 (33%), Positives = 56/112 (50%), Gaps = 4/112 (3%)

Query: 42  ILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANW 101
           I+ P    Y G  F         YP+ PP+V  +  K+ H NI+   GKICLNIL   +W
Sbjct: 68  IIIPDEGFYKGGKFRFTATFLETYPIDPPKVICNN-KIFHPNID-PHGKICLNIL-REDW 124

Query: 102 SPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYYLNN 153
           SP  +L  +VL +  L  +P  + PLN + + +L  KD   +  L+   ++ 
Sbjct: 125 SPALDLQCIVLGLLSLFQEPNGNDPLNKEAAEVLN-KDKLEFGNLVRLAMSG 175

>NCAS0D03660 Chr4 complement(683552..683957,684062..684072) [417 bp,
           138 aa] {ON} Anc_6.187 YGL087C
          Length = 138

 Score = 54.3 bits (129), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 38/122 (31%), Positives = 62/122 (50%), Gaps = 9/122 (7%)

Query: 5   RLLKEYQVVKKELGNHKNIISSLEPIDSDD--LTNWTATILGPPNTPYHGHSFDLRIHLT 62
           RLL+E +  +K LG       S    DSDD  +T W  TILGPP++ +    + + IH  
Sbjct: 9   RLLEELEKGEKGLGPES---CSYGLADSDDITMTKWNGTILGPPHSNHENRIYSVAIHCG 65

Query: 63  PEYPLKPPQVTF-SAYKMPHCNIEFKTGKICLNILDN-ANWSPVWNLLTVVLAIYQLLSD 120
           P YP  PP + F S   +P C ++ KTG++         +W   + + T++L + + ++ 
Sbjct: 66  PHYPDAPPTIKFVSKINLP-C-VDEKTGEVKQASFHTLRDWKRSYTMETLLLDLRKEMAS 123

Query: 121 PV 122
           P 
Sbjct: 124 PA 125

>ZYRO0B12386g Chr2 complement(1001376..1001849) [474 bp, 157 aa]
           {ON} highly similar to uniprot|P50623 Saccharomyces
           cerevisiae YDL064W UBC9 SUMO-conjugating enzyme involved
           in the Smt3p conjugation pathway nuclear protein
           required for S- and M-phase cyclin degradation and
           mitotic control involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 54.3 bits (129), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 49/98 (50%), Gaps = 3/98 (3%)

Query: 32  SDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKI 91
           S +L  W A I G   T +    + + I    EYP KPP+V F A    H NI + +G +
Sbjct: 35  SMNLQKWEAGIPGKEGTIWQDGVYPITIEYPDEYPSKPPKVKFPA-GFYHPNI-YPSGTV 92

Query: 92  CLNIL-DNANWSPVWNLLTVVLAIYQLLSDPVTDSPLN 128
           CL+IL ++ +W P   L  + L +  LL  P  +SP  
Sbjct: 93  CLSILNEDQDWRPAITLKQIALGVQDLLDSPNPNSPAQ 130

>KNAG0D04390 Chr4 complement(797747..798220) [474 bp, 157 aa] {ON}
           Anc_4.249 YDL064W
          Length = 157

 Score = 54.3 bits (129), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 40/124 (32%), Positives = 60/124 (48%), Gaps = 3/124 (2%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +RL +E +  +K+         + +P  + DL  W A I G   T +    + L I    
Sbjct: 7   QRLQEERKKWRKDHPFGFFAKPTRKPDGTMDLQRWEAGIPGKQGTLWADGLYPLTIEYPD 66

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-DNANWSPVWNLLTVVLAIYQLLSDPV 122
           EYP KPP+V   A    H N+ + +G ICL+IL ++ +W P   L  + L I  LL  P 
Sbjct: 67  EYPSKPPKVKLPA-NFYHPNV-YPSGTICLSILNEDQDWRPAITLKQICLGIQDLLDSPN 124

Query: 123 TDSP 126
            +SP
Sbjct: 125 PNSP 128

>Kpol_483.16 s483 complement(45694..46062) [369 bp, 122 aa] {ON}
           complement(45694..46062) [369 nt, 123 aa]
          Length = 122

 Score = 53.5 bits (127), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 47/96 (48%), Gaps = 3/96 (3%)

Query: 34  DLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICL 93
           DL  W A I G   T +    + + I    EYP KPP+V F      H N+ + +G ICL
Sbjct: 2   DLQRWEAGIPGRTGTLWAEGVYPITIEYPDEYPSKPPKVMFPK-GFYHPNV-YPSGTICL 59

Query: 94  NIL-DNANWSPVWNLLTVVLAIYQLLSDPVTDSPLN 128
           +IL +  +W P   L  +VL +  LL  P  +SP  
Sbjct: 60  SILNEEQDWRPAITLKQIVLGVQDLLDSPNPNSPAQ 95

>Ecym_3270 Chr3 (511488..511525,511617..512052) [474 bp, 157 aa]
           {ON} similar to Ashbya gossypii AER056C
          Length = 157

 Score = 53.9 bits (128), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 51/98 (52%), Gaps = 3/98 (3%)

Query: 32  SDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKI 91
           S +L  W A I G   T +    + + I    +YP KPP+V F A    H NI + +G +
Sbjct: 35  SMNLQKWEAGIPGREGTIWKDAVYPITIEYPDDYPSKPPKVKFPA-GFYHPNI-YPSGTV 92

Query: 92  CLNIL-DNANWSPVWNLLTVVLAIYQLLSDPVTDSPLN 128
           CL+IL ++ +W P   +  ++L +  LL+ P  DSP  
Sbjct: 93  CLSILNEDQDWKPAITMKQILLGVQDLLTSPNPDSPAQ 130

>Kwal_23.4227 s23 (626678..627046) [369 bp, 122 aa] {ON} YDL064W
           (UBC9) - ubiquitin-conjugating enzyme [contig 1] FULL
          Length = 122

 Score = 53.1 bits (126), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 34  DLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICL 93
           +L  W A I G   T +    F + I    +YP KPP+V F A    H NI + +G +CL
Sbjct: 2   NLQKWEAGIPGKEGTIWKEGVFPITIEYPDDYPSKPPKVKFPA-GFYHPNI-YPSGTVCL 59

Query: 94  NIL-DNANWSPVWNLLTVVLAIYQLLSDPVTDSP 126
           +IL ++ +W P   L  + L +  LL  P  +SP
Sbjct: 60  SILNEDQDWRPAITLKQIALGVQDLLDSPNPNSP 93

>TDEL0E05560 Chr5 complement(1024888..1025448,1025504..1025506) [564
           bp, 187 aa] {ON} Anc_4.49 YLR306W
          Length = 187

 Score = 54.3 bits (129), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 60/121 (49%), Gaps = 12/121 (9%)

Query: 42  ILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANW 101
           I+ P    Y    F   +  T +YP++PPQV     ++ H NI+ + GKICLNIL   +W
Sbjct: 67  IVSPDEGFYRKGHFTFEMTFTEKYPIEPPQVR-CMNQIFHPNIDLQ-GKICLNIL-REDW 123

Query: 102 SPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNILK---------IKDTSAYYGLIEYYLN 152
           SP  +L +V++ I  L  +     PLN   +++L          ++ T A Y L   + +
Sbjct: 124 SPALDLQSVIIGILFLFLEVSGRDPLNKQAASLLDENPNKFSRLVQQTMAGYSLDGQHYD 183

Query: 153 N 153
           N
Sbjct: 184 N 184

>NDAI0A07570 Chr1 complement(1734788..1735507) [720 bp, 239 aa] {ON}
          Length = 239

 Score = 54.3 bits (129), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 32/94 (34%), Positives = 48/94 (51%), Gaps = 13/94 (13%)

Query: 50  YHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-----------DN 98
           Y+G  F   +     +P  PP   F    + H N+ +K GK+C++IL           DN
Sbjct: 56  YNGGYFKSEMKFPSNFPYSPPHFKFVP-PIYHPNV-YKDGKLCISILHQSGDSMTSEPDN 113

Query: 99  ANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLS 132
             WSPV ++ +V+++I  LL DP   SP N+D S
Sbjct: 114 ETWSPVQSVESVLISIISLLEDPNISSPANVDAS 147

>SAKL0F12474g Chr6 (974485..975240) [756 bp, 251 aa] {ON} similar to
           uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 54.3 bits (129), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 65/127 (51%), Gaps = 14/127 (11%)

Query: 1   MSERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIH 60
            + +RL KEY+ +   + N    I++ +P + D++  W   I GPP+TPY    +   + 
Sbjct: 5   QAHKRLTKEYKAI---IENPPQFINA-QP-NEDNILEWHYIITGPPDTPYTDGQYHGTLV 59

Query: 61  LTPEYPLKPPQVTFSAYKMPHCNIEFKTG-KICLNILDN--ANWSPVWNLLTVVLAIYQL 117
              +YP KPP     A +M   N  FK   ++C+ + D     W+P W++ T+++ +   
Sbjct: 60  FPADYPFKPP-----AIRMITPNGRFKENTRLCMTMSDYHPDTWNPAWSVATILMGLLSF 114

Query: 118 LS-DPVT 123
           ++ D VT
Sbjct: 115 MTGDEVT 121

>TDEL0E01220 Chr5 (240860..241333) [474 bp, 157 aa] {ON} Anc_4.249
           YDL064W
          Length = 157

 Score = 52.8 bits (125), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 33/96 (34%), Positives = 49/96 (51%), Gaps = 3/96 (3%)

Query: 34  DLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICL 93
           +L  W A I G   T +    + + I    EYP KPP+V F A    H NI + +G +CL
Sbjct: 37  NLQKWEAGIPGREGTLWDHGVYPISIEYPDEYPSKPPKVRFPA-GFYHPNI-YPSGTVCL 94

Query: 94  NIL-DNANWSPVWNLLTVVLAIYQLLSDPVTDSPLN 128
           +IL ++ +W P   L  +V+ +  LL  P  +SP  
Sbjct: 95  SILNEDQDWRPAITLKQIVIGVQDLLDTPNPNSPAQ 130

>AER056C Chr5 complement(741224..741659,741718..741755) [474 bp, 157
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YDL064W (UBC9); 1-intron
          Length = 157

 Score = 52.4 bits (124), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/96 (33%), Positives = 51/96 (53%), Gaps = 3/96 (3%)

Query: 32  SDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKI 91
           S +L  W A I G   T +    + + I    +YP KPP+V F A    H NI + +G +
Sbjct: 35  SMNLQKWEAGIPGREGTIWKDGVYPITIEYPDDYPSKPPRVKFPA-GFYHPNI-YPSGTV 92

Query: 92  CLNIL-DNANWSPVWNLLTVVLAIYQLLSDPVTDSP 126
           CL+IL ++ +W P   +  ++L +  LL+ P  +SP
Sbjct: 93  CLSILNEDQDWKPAITMKQILLGVQDLLTSPNPNSP 128

>TBLA0E01570 Chr5 complement(371348..371929,372031..372033) [585 bp,
           194 aa] {ON} 
          Length = 194

 Score = 52.8 bits (125), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 32/87 (36%), Positives = 47/87 (54%), Gaps = 3/87 (3%)

Query: 50  YHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLT 109
           Y    F   +     YP++PP V F   K+ H NI+   GKICLNIL   +WSPV +L +
Sbjct: 80  YKDGYFPFSMVFKDSYPIEPPVVKFLK-KIYHPNIDL-NGKICLNIL-REDWSPVLDLQS 136

Query: 110 VVLAIYQLLSDPVTDSPLNIDLSNILK 136
           +++ +  L  +P    PLN+    +LK
Sbjct: 137 IIIGLMFLFLEPNPRDPLNLKAGELLK 163

>KLLA0E19119g Chr5 complement(1702717..1703125,1703226..1703236)
           [420 bp, 139 aa] {ON} highly similar to uniprot|P53152
           Saccharomyces cerevisiae YGL087C MMS2 Protein involved
           in error-free postreplication DNA repair forms a
           heteromeric complex with Ubc13p that has a
           ubiquitin-conjugating activity cooperates with
           chromatin-associated RING finger proteins Rad18p and
           Rad5p
          Length = 139

 Score = 51.6 bits (122), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 38/121 (31%), Positives = 59/121 (48%), Gaps = 9/121 (7%)

Query: 5   RLLKEYQVVKKELGNHKNIISSLEPIDSDD--LTNWTATILGPPNTPYHGHSFDLRIHLT 62
           RLL+E +  +K LG       S    DSDD  +T W  TILGPP++ +    + + I   
Sbjct: 9   RLLEELEKGEKGLGPES---CSYGLSDSDDITMTKWNGTILGPPHSNHENRIYSVLIECG 65

Query: 63  PEYPLKPPQVTF-SAYKMPHCNIEFKTGKICLNILDN-ANWSPVWNLLTVVLAIYQLLSD 120
           P YP +PP+V F S   +P  N    TG++          W   + + TV+L + + ++ 
Sbjct: 66  PSYPDEPPKVKFVSKINLPCVN--STTGEVVKEKFHTLKEWKRSYTMETVLLELRKEMAT 123

Query: 121 P 121
           P
Sbjct: 124 P 124

>NCAS0A02490 Chr1 complement(474534..474969,475041..475078) [474 bp,
           157 aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 52.0 bits (123), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 39/124 (31%), Positives = 59/124 (47%), Gaps = 3/124 (2%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +RL +E +  +K+         +  P  S +L  W A I G   T +    + + I    
Sbjct: 7   QRLQEERKKWRKDHPFGFFAKPTRHPDGSMNLQKWEAGIPGKEGTIWAEGVYPITIEYPN 66

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-DNANWSPVWNLLTVVLAIYQLLSDPV 122
           EYP KPP+V   A    H N+ + +G ICL+IL ++ +W P   L  + L I  LL  P 
Sbjct: 67  EYPSKPPKVKLPA-NFYHPNV-YPSGTICLSILNEDQDWRPAITLKQICLGIQDLLDSPN 124

Query: 123 TDSP 126
            +SP
Sbjct: 125 PNSP 128

>NDAI0D02910 Chr4 (685459..686028) [570 bp, 189 aa] {ON} Anc_4.49
          Length = 189

 Score = 52.4 bits (124), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 42/127 (33%), Positives = 68/127 (53%), Gaps = 7/127 (5%)

Query: 22  NIISSLEPIDSDDLTNWTATILGPPNTP-YHGHSFDLRIHLTPEYPLKPPQVTFSAYKMP 80
           NI+SS  PID    +     I   P+   Y G  F  ++     YP++PP V  ++ K+ 
Sbjct: 51  NILSS--PIDPGSRSPPLLEITAYPDEGFYKGGHFTFKLEFNDAYPIEPPTVICTS-KLY 107

Query: 81  HCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNILKIKDT 140
           H NI+   GK+CLNIL   +WSP  ++ ++++ +  LL +P    PLN D + +L   DT
Sbjct: 108 HPNIDID-GKVCLNIL-REDWSPALDVQSIIIGLLFLLLEPNAKDPLNKDAAMMLST-DT 164

Query: 141 SAYYGLI 147
           + +  L+
Sbjct: 165 ARFASLV 171

>KLLA0E05039g Chr5 (443446..443919) [474 bp, 157 aa] {ON} highly
           similar to uniprot|P50623 Saccharomyces cerevisiae
           YDL064W UBC9 SUMO-conjugating enzyme involved in the
           Smt3p conjugation pathway nuclear protein required for
           S- and M-phase cyclin degradation and mitotic control
           involved in proteolysis mediated by the
           anaphase-promoting complex cyclosome (APCC)
          Length = 157

 Score = 51.6 bits (122), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 50/96 (52%), Gaps = 3/96 (3%)

Query: 32  SDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKI 91
           S +L  W A I G   T +    + L I    +YP KPP+V F A    H N+ + +G I
Sbjct: 35  SMNLQKWEAGIPGRDGTLWKNGLYPLTIEYPDDYPSKPPKVKFPA-GFYHPNV-YPSGTI 92

Query: 92  CLNIL-DNANWSPVWNLLTVVLAIYQLLSDPVTDSP 126
           CL+IL ++ +W P   L  ++L +  LL  P  +SP
Sbjct: 93  CLSILNEDQDWRPAITLKQLLLGVQDLLDSPNPNSP 128

>Kpol_YGOB_414.2 s414 complement(6958..7536,7733..7735) [582 bp, 193
           aa] {ON} ANNOTATED BY YGOB -
          Length = 193

 Score = 52.0 bits (123), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 42  ILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANW 101
           ++ P    Y    F   +     YP++PP +     K+ H NI+   GKICLNIL   +W
Sbjct: 74  LISPDEGYYKSGKFKFDLKFNENYPIEPP-IVLCMNKIFHPNIDL-DGKICLNIL-REDW 130

Query: 102 SPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNIL 135
           SP  +L ++++ +  L  +     PLN + +NIL
Sbjct: 131 SPALDLNSIIIGLLYLFLECNAKDPLNKEAANIL 164

>Kpol_414.2 s414 complement(6958..7536) [579 bp, 192 aa] {OFF}
           complement(6958..7536) [579 nt, 193 aa]
          Length = 192

 Score = 52.0 bits (123), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 48/94 (51%), Gaps = 3/94 (3%)

Query: 42  ILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANW 101
           ++ P    Y    F   +     YP++PP +     K+ H NI+   GKICLNIL   +W
Sbjct: 73  LISPDEGYYKSGKFKFDLKFNENYPIEPP-IVLCMNKIFHPNIDL-DGKICLNIL-REDW 129

Query: 102 SPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNIL 135
           SP  +L ++++ +  L  +     PLN + +NIL
Sbjct: 130 SPALDLNSIIIGLLYLFLECNAKDPLNKEAANIL 163

>KLTH0C06688g Chr3 complement(581697..582437) [741 bp, 246 aa] {ON}
           similar to uniprot|P33296 Saccharomyces cerevisiae
           YER100W UBC6 Ubiquitin-conjugating enzyme involved in
           ER- associated protein degradation located at the
           cytosolic side of the ER membrane tail region contains a
           transmembrane segment at the C-terminus substrate of the
           ubiquitin-proteasome pathway
          Length = 246

 Score = 52.4 bits (124), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/153 (25%), Positives = 69/153 (45%), Gaps = 24/153 (15%)

Query: 1   MSERRLLKEYQVVKKELGNHKNIISSLEPI-----DSDDLTNWTATILGPPNTPYHGHSF 55
            +++RL KEY          K+++ +  P      + D++  W   I GPP+TPY G  +
Sbjct: 5   QAQKRLTKEY----------KSMVENPPPFIIAQPNEDNILEWHYVITGPPDTPYEGGQY 54

Query: 56  DLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTG-KICLNILD--NANWSPVWNLLTVVL 112
              +    +YP KPP     A +M   +  FK   ++CL++ D     W+P W++ T++ 
Sbjct: 55  HGTLVFPSDYPFKPP-----AIRMVTPSGRFKEDTRLCLSMSDYHPDTWNPSWSVSTILT 109

Query: 113 AIYQLL-SDPVTDSPLNIDLSNILKIKDTSAYY 144
            +   + SD  T   +     +  K+   S  Y
Sbjct: 110 GLLSFMTSDESTTGAITTTSDHKKKMARVSKEY 142

>Skud_7.195 Chr7 complement(349627..349929) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 50.1 bits (118), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 28/89 (31%), Positives = 46/89 (51%), Gaps = 3/89 (3%)

Query: 35  LTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTF-SAYKMPHCNIEFKTGKICL 93
           +T W  TILGPP++ +    + L I   P YP  PP VTF S   +P C +   TG++  
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPNVTFISKINLP-C-VSQTTGEVQT 58

Query: 94  NILDNANWSPVWNLLTVVLAIYQLLSDPV 122
           N     +W   + + T++L + + ++ P 
Sbjct: 59  NFHTLRDWKRAYTMETLLLDLRKEMATPA 87

>Suva_10.401 Chr10 (705317..705877) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 51.2 bits (121), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 56/108 (51%), Gaps = 4/108 (3%)

Query: 29  PIDSDDLTNWTATILGPPNTPYHGH-SFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFK 87
           P  +D +      ++  P+  Y+ H S    +     YP++PP+VT    K+ H NI+  
Sbjct: 52  PQSTDRMQPPKLEVVVSPDEGYYNHGSISFSLDFNEVYPIEPPKVT-CLKKIFHPNIDL- 109

Query: 88  TGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNIL 135
            G +CLNIL   +WSP  +L ++++ +  L  +P  + PLN D + + 
Sbjct: 110 NGNVCLNIL-REDWSPALDLQSIIIGLLFLFLEPNPNDPLNKDAAKLF 156

>KNAG0I02940 Chr9 (581958..582063,582240..582727) [594 bp, 197 aa]
           {ON} Anc_4.49 YLR306W
          Length = 197

 Score = 51.2 bits (121), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 33/104 (31%), Positives = 58/104 (55%), Gaps = 5/104 (4%)

Query: 52  GHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVV 111
           GH F  +  +   YP++PP+V     K+ H NI  +TG+ICLNIL   +WSP  +L +V+
Sbjct: 89  GH-FRFQFTINENYPIEPPKVV-CLTKIYHPNIN-RTGEICLNIL-REDWSPALDLQSVI 144

Query: 112 LAIYQLLSDPVTDSPLNIDLSNILKIKDTSAYYGLIEYYLNNKS 155
           + +  L  +P    PLN   ++ L + D + +  +++  +  +S
Sbjct: 145 IGLLFLFIEPNPKDPLNKQAADTL-LHDPAVFKHIVQKSMAGES 187

>Skud_12.389 Chr12 (685275..685835) [561 bp, 187 aa] {ON} YLR306W
           (REAL)
          Length = 187

 Score = 51.2 bits (121), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 32/108 (29%), Positives = 56/108 (51%), Gaps = 4/108 (3%)

Query: 29  PIDSDDLTNWTATILGPPNTPYHGH-SFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFK 87
           P  +D + +    +   P+  Y+ H S +  +     YP++PP+V     K+ H NI+ K
Sbjct: 52  PDSTDRMQSPKLEVTVSPDEGYYNHGSINFGLDFNEVYPIEPPKVA-CLKKIFHPNIDLK 110

Query: 88  TGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNIL 135
            G +CLNIL   +WSP  +L +++  +  L  +P  + PLN D + + 
Sbjct: 111 -GNVCLNIL-REDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLF 156

>YLR306W Chr12 (744151..744153,744288..744851) [567 bp, 188 aa] {ON}
            UBC12Enzyme that mediates the conjugation of Rub1p, a
           ubiquitin-like protein, to other proteins; related to E2
           ubiquitin-conjugating enzymes
          Length = 188

 Score = 50.8 bits (120), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 35/115 (30%), Positives = 62/115 (53%), Gaps = 6/115 (5%)

Query: 22  NIISSLEPIDSDDLTNWTATILGPPNTPYHGH-SFDLRIHLTPEYPLKPPQVTFSAYKMP 80
           N+I+S  P  +D   +    ++  P+  Y+ + S +  +     YP++PP+V     K+ 
Sbjct: 48  NVITS--PDSADRSQSPKLEVIVRPDEGYYNYGSINFNLDFNEVYPIEPPKVV-CLKKIF 104

Query: 81  HCNIEFKTGKICLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNIL 135
           H NI+ K G +CLNIL   +WSP  +L +++  +  L  +P  + PLN D + +L
Sbjct: 105 HPNIDLK-GNVCLNIL-REDWSPALDLQSIITGLLFLFLEPNPNDPLNKDAAKLL 157

>KLLA0E20395g Chr5 (1814618..1815373) [756 bp, 251 aa] {ON} similar
           to uniprot|P33296 Saccharomyces cerevisiae YER100W UBC6
           Ubiquitin-conjugating enzyme involved in ER- associated
           protein degradation located at the cytosolic side of the
           ER membrane tail region contains a transmembrane segment
           at the C-terminus substrate of the ubiquitin-proteasome
           pathway
          Length = 251

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 59/127 (46%), Gaps = 23/127 (18%)

Query: 1   MSERRLLKEYQVVKKELGNHKNIISSLEPI-----DSDDLTNWTATILGPPNTPYHGHSF 55
            + +RL KEY          KNI+++  P        D++  W   I GPP+TPY    +
Sbjct: 5   QANKRLTKEY----------KNIVNNPPPFIIAAPHEDNILEWHYVITGPPSTPYENGQY 54

Query: 56  DLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTG-KICLNILD--NANWSPVWNLLTVVL 112
              +    +YP  PP     A +M   N  FK   ++CL++ D     W+P W+++T++ 
Sbjct: 55  HGTLTFPSDYPFNPP-----AIRMITPNGRFKENTRLCLSMSDYHPEAWNPAWSVVTILN 109

Query: 113 AIYQLLS 119
            +   ++
Sbjct: 110 GLLSFMT 116

>KNAG0B02360 Chr2 complement(462478..463233) [756 bp, 251 aa] {ON}
           Anc_7.392 YER100W
          Length = 251

 Score = 50.8 bits (120), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/119 (27%), Positives = 60/119 (50%), Gaps = 13/119 (10%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +RL KEY+++   + N    +++    + D++  W   I GPP TPY G  +   +    
Sbjct: 8   KRLTKEYKLI---VENPPPYVTARP--NEDNILEWHYVITGPPETPYEGGQYHGTLTFPS 62

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTG-KICLNILDNAN--WSPVWNLLTVVLAIYQLLS 119
           +YP KPP     A +M   N  FK   ++CL++ D     W+P W++ T++  +   ++
Sbjct: 63  DYPYKPP-----AIRMVTPNGRFKENTRLCLSMSDYHPDLWNPGWSVSTILTGLLSFMT 116

>NDAI0A01650 Chr1 complement(365515..366270) [756 bp, 251 aa] {ON}
           Anc_7.392
          Length = 251

 Score = 50.8 bits (120), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 60/127 (47%), Gaps = 23/127 (18%)

Query: 1   MSERRLLKEYQVVKKELGNHKNIISSLEPI-----DSDDLTNWTATILGPPNTPYHGHSF 55
            + +RL KEY++          ++ S  P      + D++  W   I GPP+TPY G  +
Sbjct: 5   QAHKRLTKEYKL----------LVESSPPFILARPNEDNILEWHYIITGPPDTPYDGGQY 54

Query: 56  DLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTG-KICLNILDN--ANWSPVWNLLTVVL 112
              +    +YP KPP     A +M   N  FK   ++CL++ D     W+P W++ T++ 
Sbjct: 55  HGTLTFPNDYPYKPP-----AIRMITPNGRFKENTRLCLSMSDYHPDTWNPGWSVSTILN 109

Query: 113 AIYQLLS 119
            +   ++
Sbjct: 110 GLLSFMT 116

>NDAI0D04380 Chr4 (1027182..1027219,1027322..1027757) [474 bp, 157
           aa] {ON} Anc_4.249 YDL064W
          Length = 157

 Score = 49.7 bits (117), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 33/94 (35%), Positives = 46/94 (48%), Gaps = 3/94 (3%)

Query: 34  DLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICL 93
           +L  W A I G   T +    + + I    EYP KPP+V   A    H N+ + +G ICL
Sbjct: 37  NLQKWEAGIPGKEGTLWAEGVYPITIEYPNEYPSKPPKVKLPA-GFYHPNV-YPSGTICL 94

Query: 94  NIL-DNANWSPVWNLLTVVLAIYQLLSDPVTDSP 126
           +IL +  +W P   L  + L I  LL  P  +SP
Sbjct: 95  SILNEEQDWRPAITLKQICLGIQDLLDSPNPNSP 128

>Smik_7.196 Chr7 complement(340809..341111) [303 bp, 100 aa] {ON}
           YGL087C (REAL)
          Length = 100

 Score = 48.5 bits (114), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 27/89 (30%), Positives = 45/89 (50%), Gaps = 3/89 (3%)

Query: 35  LTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTF-SAYKMPHCNIEFKTGKICL 93
           +T W  TILGPP++ +    + L I   P YP  PP+VTF S   +P  N    TG++  
Sbjct: 1   MTKWNGTILGPPHSNHENRIYSLSIECGPNYPDSPPKVTFISKINLPCVNP--TTGEVQT 58

Query: 94  NILDNANWSPVWNLLTVVLAIYQLLSDPV 122
           +      W   + + T++L + + ++ P 
Sbjct: 59  DFHTLRGWKRAYTMETLLLDLRKEMATPA 87

>Kwal_27.10837 s27 complement(519750..520490) [741 bp, 246 aa] {ON}
           YER100W (UBC6) - ubiquitin-conjugating enzyme [contig
           33] FULL
          Length = 246

 Score = 50.4 bits (119), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 61/127 (48%), Gaps = 23/127 (18%)

Query: 1   MSERRLLKEYQVVKKELGNHKNIISSLEPI-----DSDDLTNWTATILGPPNTPYHGHSF 55
            +++RL KEY          K+++ +  P      + D++  W   I GPP+TPY G  +
Sbjct: 5   QAQKRLSKEY----------KSMVENPPPFIIAQPNEDNVLEWHYVITGPPDTPYMGGQY 54

Query: 56  DLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTG-KICLNILDN--ANWSPVWNLLTVVL 112
              +    +YP KPP     A +M   +  FK   ++CL++ D     W+P W++ T++ 
Sbjct: 55  HGTLVFPSDYPFKPP-----AIRMVTPSGRFKEDTRLCLSMSDYHPDTWNPSWSVSTILT 109

Query: 113 AIYQLLS 119
            +   ++
Sbjct: 110 GLLSFMT 116

>CAGL0I05478g Chr9 complement(518933..519673) [741 bp, 246 aa] {ON}
           highly similar to uniprot|P33296 Saccharomyces
           cerevisiae YER100w UBC6 E2 ubiquitin-conjugating enzyme
          Length = 246

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 33/121 (27%), Positives = 62/121 (51%), Gaps = 13/121 (10%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           +++RL KEY+++   + N    I  +   + +++  W   I GPP+TPY G  +   +  
Sbjct: 6   AQKRLTKEYKMM---VENPPPFI--IARPNEENILEWHYVISGPPDTPYDGGQYHGTLTF 60

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFKTG-KICLNILD--NANWSPVWNLLTVVLAIYQLL 118
             +YP KPP     A +M   N  FK   ++CL++ D     W+P W++ T++  +   +
Sbjct: 61  PSDYPYKPP-----AIRMITPNGRFKENTRLCLSMSDYHPDTWNPGWSVATILNGLLSFM 115

Query: 119 S 119
           +
Sbjct: 116 T 116

>KLTH0H09504g Chr8 complement(817855..818406,818463..818465) [555
           bp, 184 aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 48.5 bits (114), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 31/92 (33%), Positives = 53/92 (57%), Gaps = 6/92 (6%)

Query: 46  PNTPYH--GHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSP 103
           P+  Y+  GH F         YP++PP+VT  + K+ H NI+ + G +CLNIL   +WSP
Sbjct: 68  PDEGYYKCGH-FKFCATFKDTYPIEPPKVTLLS-KIFHPNIDLQ-GNVCLNIL-REDWSP 123

Query: 104 VWNLLTVVLAIYQLLSDPVTDSPLNIDLSNIL 135
           V ++ ++++ +  L  +P    PLN   +++L
Sbjct: 124 VLDVQSILIGLLMLFLEPNATDPLNKVAADVL 155

>Kpol_1045.39 s1045 complement(92062..92823) [762 bp, 253 aa] {ON}
           complement(92064..92825) [762 nt, 254 aa]
          Length = 253

 Score = 48.5 bits (114), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 63/122 (51%), Gaps = 13/122 (10%)

Query: 1   MSERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIH 60
            + +RL KEY+++ +    +  II+   P +S+ L  W   I GPP++PYH   +   + 
Sbjct: 5   QAHKRLTKEYKMMMENPTPY--IIA--RPNESNIL-EWHYVITGPPDSPYHDGQYHGTLT 59

Query: 61  LTPEYPLKPPQVTFSAYKMPHCNIEFKTG-KICLNILDNA--NWSPVWNLLTVVLAIYQL 117
              +YP KPP     A +M   N  FK   ++CL++ D     W+P W++ T++  +   
Sbjct: 60  FPSDYPYKPP-----AIRMVTPNGRFKENTRLCLSMSDYHPDTWNPGWSVATILNGLLSF 114

Query: 118 LS 119
           ++
Sbjct: 115 MT 116

>KLLA0C17248g Chr3 complement(1509885..1510439) [555 bp, 184 aa]
           {ON} similar to uniprot|P52491 Saccharomyces cerevisiae
           YLR306W UBC12 Enzyme that mediates the conjugation of
           Rub1p a ubiquitin-like protein to other proteins related
           to E2 ubiquitin-conjugating enzymes
          Length = 184

 Score = 47.8 bits (112), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 25/86 (29%), Positives = 47/86 (54%), Gaps = 3/86 (3%)

Query: 50  YHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLT 109
           Y G ++   + +   YP++PP V    +++ H NI+   G +CLN+L   +W+P  ++ +
Sbjct: 72  YAGGTYYFNVFIKDTYPMEPPVVK-CMHRIYHPNIDID-GNVCLNLL-REDWTPALDIQS 128

Query: 110 VVLAIYQLLSDPVTDSPLNIDLSNIL 135
           +++ I  L  +P    PLN D +  L
Sbjct: 129 IIIGILFLFHEPNGRDPLNKDAAKTL 154

>KNAG0J02280 Chr10 complement(424795..425448) [654 bp, 217 aa] {ON} 
          Length = 217

 Score = 48.1 bits (113), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 30/94 (31%), Positives = 44/94 (46%), Gaps = 13/94 (13%)

Query: 50  YHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNIL-----------DN 98
           YHG      +     +P  PP   F    + H N+ F  G +C++IL           D+
Sbjct: 56  YHGAYLTGLLCFPRNFPFSPPTFLFCP-PIYHPNV-FSNGSLCISILHECGDDTNEEPDS 113

Query: 99  ANWSPVWNLLTVVLAIYQLLSDPVTDSPLNIDLS 132
             WSPV  + TV+++I  LL DP   SP N+D +
Sbjct: 114 ETWSPVQTVETVLISIISLLDDPNVSSPANVDAA 147

>KNAG0F02130 Chr6 (405648..406064) [417 bp, 138 aa] {ON} Anc_6.187
           YGL087C
          Length = 138

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/122 (30%), Positives = 57/122 (46%), Gaps = 9/122 (7%)

Query: 5   RLLKEYQVVKKELGNHKNIISSLEPIDSDD--LTNWTATILGPPNTPYHGHSFDLRIHLT 62
           RLL+E +  +K  G       S    DSDD  +T W  TILGPP++ +    + L I   
Sbjct: 9   RLLEELEKGEKGFGPES---CSYGLADSDDITMTKWNGTILGPPHSNHENRIYSLEIVCG 65

Query: 63  PEYPLKPPQVTF-SAYKMPHCNIEFKTGKICLNILDN-ANWSPVWNLLTVVLAIYQLLSD 120
             YP +PP V F S   +P C ++  TG +         +W   + + TV+L + + +  
Sbjct: 66  DRYPDEPPLVKFISKVNLP-C-VDQTTGVVSAEKFHTLRDWKRSYTMQTVLLDLRKEMGT 123

Query: 121 PV 122
           P 
Sbjct: 124 PA 125

>NCAS0A14390 Chr1 (2833944..2834666) [723 bp, 240 aa] {ON} Anc_7.392
           YER100W
          Length = 240

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 61/122 (50%), Gaps = 13/122 (10%)

Query: 1   MSERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIH 60
            + +RL KEY+++   + N    I  L   + +++  W   I GPP+TPY G  +   + 
Sbjct: 5   QAHKRLSKEYKLI---IENPTPYI--LARPNENNILEWHYIITGPPDTPYVGGQYHGTLT 59

Query: 61  LTPEYPLKPPQVTFSAYKMPHCNIEFKTG-KICLNILDNAN--WSPVWNLLTVVLAIYQL 117
              +YP KPP     A +M   N  FK   ++CL++ D     W+P W++ T++  +   
Sbjct: 60  FPSDYPFKPP-----AIRMITPNGRFKENTRLCLSMSDYHPDLWNPGWSVATILNGLLSF 114

Query: 118 LS 119
           ++
Sbjct: 115 MT 116

>Ecym_2230 Chr2 (447891..447901,447985..448390) [417 bp, 138 aa]
           {ON} similar to Ashbya gossypii AFL064W 1-intron
          Length = 138

 Score = 46.6 bits (109), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 34/117 (29%), Positives = 61/117 (52%), Gaps = 5/117 (4%)

Query: 5   RLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTPE 64
           RLL+E +  +K LG  ++    L   +   +T W  TILGPP++ +    + + I    E
Sbjct: 9   RLLEELEKGEKGLG-PESCSYGLANGEDITMTTWNGTILGPPHSNHENRIYSVVIKCGDE 67

Query: 65  YPLKPPQVTF-SAYKMPHCNIEFKTGKICLNILDN-ANWSPVWNLLTVVLAIYQLLS 119
           YP KPP V F S   +P C ++  TG++  N+     +W   + + T++L + + ++
Sbjct: 68  YPDKPPTVKFISKINLP-C-VDQATGEVETNMFHTLRDWKRSYTMETLLLDLRKEMA 122

>Smik_5.246 Chr5 (368531..369283) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 47.8 bits (112), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/126 (29%), Positives = 62/126 (49%), Gaps = 14/126 (11%)

Query: 2   SERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHL 61
           + +RL KEY+++   + N    I  L   + D++  W   I GP +TPY G  +   +  
Sbjct: 6   AHKRLTKEYKLM---VENPPPYI--LARPNEDNILEWHYIITGPADTPYKGGQYHGTLTF 60

Query: 62  TPEYPLKPPQVTFSAYKMPHCNIEFK-TGKICLNILDN--ANWSPVWNLLTVVLAIYQLL 118
             +YP KPP     A +M   N  FK   ++CL++ D     W+P W++ T++  +   +
Sbjct: 61  PSDYPYKPP-----AIRMVTPNGRFKPNTRLCLSMSDYHPDTWNPGWSVSTILNGLLSFM 115

Query: 119 -SDPVT 123
            SD  T
Sbjct: 116 TSDEAT 121

>AFL064W Chr6 (314210..314220,314273..314678) [417 bp, 138 aa]
          {ON} Syntenic homolog of Saccharomyces cerevisiae
          YGL087C (MMS2); 1-intron
          Length = 138

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 26/72 (36%), Positives = 39/72 (54%), Gaps = 5/72 (6%)

Query: 5  RLLKEYQVVKKELGNHKNIISSLEPIDSDD--LTNWTATILGPPNTPYHGHSFDLRIHLT 62
          RLL+E +  +K +G       S    D DD  +T+W  TILGPP++ +    + + I   
Sbjct: 9  RLLEELEKGEKGMGPES---CSYGLADGDDISMTHWNGTILGPPHSSHENRIYSVVIECG 65

Query: 63 PEYPLKPPQVTF 74
           EYP +PP+V F
Sbjct: 66 AEYPDRPPKVRF 77

>YER100W Chr5 (359562..360314) [753 bp, 250 aa] {ON}
           UBC6Ubiquitin-conjugating enzyme involved in
           ER-associated protein degradation; located at the
           cytosolic side of the ER membrane; tail region contains
           a transmembrane segment at the C-terminus; substrate of
           the ubiquitin-proteasome pathway
          Length = 250

 Score = 47.4 bits (111), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 62/127 (48%), Gaps = 14/127 (11%)

Query: 1   MSERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIH 60
            + +RL KEY+++   + N    I  L   + D++  W   I GP +TPY G  +   + 
Sbjct: 5   QAHKRLTKEYKLM---VENPPPYI--LARPNEDNILEWHYIITGPADTPYKGGQYHGTLT 59

Query: 61  LTPEYPLKPPQVTFSAYKMPHCNIEFK-TGKICLNILD--NANWSPVWNLLTVVLAIYQL 117
              +YP KPP     A +M   N  FK   ++CL++ D     W+P W++ T++  +   
Sbjct: 60  FPSDYPYKPP-----AIRMITPNGRFKPNTRLCLSMSDYHPDTWNPGWSVSTILNGLLSF 114

Query: 118 L-SDPVT 123
           + SD  T
Sbjct: 115 MTSDEAT 121

>SAKL0A05192g Chr1 (468949..468959,469039..469450) [423 bp, 140 aa]
           {ON} highly similar to uniprot|P53152 Saccharomyces
           cerevisiae YGL087C MMS2 Protein involved in error-free
           postreplication DNA repair forms a heteromeric complex
           with Ubc13p that has a ubiquitin-conjugating activity
           cooperates with chromatin-associated RING finger
           proteins Rad18p and Rad5p
          Length = 140

 Score = 46.2 bits (108), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 35/122 (28%), Positives = 60/122 (49%), Gaps = 9/122 (7%)

Query: 5   RLLKEYQVVKKELGNHKNIISSLEPIDSDD--LTNWTATILGPPNTPYHGHSFDLRIHLT 62
           RLL+E +  +K LG       S    D DD  +TNW  TILGPP++ +    + + I   
Sbjct: 11  RLLEELEKGEKGLGPES---CSYGLADGDDITMTNWNGTILGPPHSNHENRIYSVAIECG 67

Query: 63  PEYPLKPPQVTF-SAYKMPHCNIEFKTGKICLNILDN-ANWSPVWNLLTVVLAIYQLLSD 120
             YP +PP + F S   +P C ++  TG++  +      +W   + + T++L + + +  
Sbjct: 68  ANYPDEPPLIKFVSKINLP-C-VDQTTGEVKHDQFHTLRDWKRSYTMETLLLDLRKEMGT 125

Query: 121 PV 122
           P 
Sbjct: 126 PT 127

>Skud_5.225 Chr5 (355576..356328) [753 bp, 250 aa] {ON} YER100W
           (REAL)
          Length = 250

 Score = 47.4 bits (111), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 61/127 (48%), Gaps = 14/127 (11%)

Query: 1   MSERRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIH 60
            + +RL KEY+++   + N    I  L   + D++  W   I GP  TPY G  +   + 
Sbjct: 5   QAHKRLTKEYKLM---VENPPPYI--LARPNEDNILEWHYIITGPAETPYKGGQYHGTLT 59

Query: 61  LTPEYPLKPPQVTFSAYKMPHCNIEFK-TGKICLNILDN--ANWSPVWNLLTVVLAIYQL 117
              +YP KPP     A +M   N  FK   ++CL++ D     W+P W++ T++  +   
Sbjct: 60  FPSDYPYKPP-----AIRMVTPNGRFKPNTRLCLSMSDYHPDTWNPGWSVSTILNGLLSF 114

Query: 118 L-SDPVT 123
           + SD  T
Sbjct: 115 MTSDEAT 121

>SAKL0H24112g Chr8 (2080968..2080970,2081030..2081584) [558 bp, 185
           aa] {ON} similar to uniprot|P52491 Saccharomyces
           cerevisiae YLR306W UBC12 Enzyme that mediates the
           conjugation of Rub1p a ubiquitin-like protein to other
           proteins related to E2 ubiquitin-conjugating enzymes
          Length = 185

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 28/74 (37%), Positives = 41/74 (55%), Gaps = 3/74 (4%)

Query: 55  FDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTVVLAI 114
           F   +     YP++PP V     K+ H NI+ + G +CLNIL   +WSPV +L +VV+ +
Sbjct: 78  FRFSLFFKDTYPIEPPAVK-CVNKIYHPNIDTQ-GNVCLNIL-REDWSPVLDLQSVVIGL 134

Query: 115 YQLLSDPVTDSPLN 128
             L  +P    PLN
Sbjct: 135 LFLFLEPNDKDPLN 148

>NCAS0E02600 Chr5 complement(519792..520559) [768 bp, 255 aa] {ON}
           Anc_7.392
          Length = 255

 Score = 47.0 bits (110), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 69/145 (47%), Gaps = 15/145 (10%)

Query: 4   RRLLKEYQVVKKELGNHKNIISSLEPIDSDDLTNWTATILGPPNTPYHGHSFDLRIHLTP 63
           +RL KEY+++   + N    I  L   + D++  W   I GPP+TPY    +   +    
Sbjct: 8   KRLTKEYKLM---VENPPPYI--LARPNEDNILEWHYIITGPPDTPYKDGQYHGTLTFPS 62

Query: 64  EYPLKPPQVTFSAYKMPHCNIEFKTG-KICLNILDNAN--WSPVWNLLTVVLAIYQLLS- 119
           +YP KPP     A +M   N  FK   ++CL++ D     W+P W++ T++  +   ++ 
Sbjct: 63  DYPYKPP-----AIRMITPNGRFKENTRLCLSMSDYHPDLWNPGWSVNTILNGLLSFMTG 117

Query: 120 -DPVTDSPLNIDLSNILKIKDTSAY 143
            D  T S +  D    L  K++  +
Sbjct: 118 DDSTTGSIVTTDSQKRLLAKNSVEF 142

>Ecym_8371 Chr8 (747395..748198) [804 bp, 267 aa] {ON} similar to
           Ashbya gossypii ADL035C 1-intron
          Length = 267

 Score = 46.2 bits (108), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 48/89 (53%), Gaps = 5/89 (5%)

Query: 51  HGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWSPVWNLLTV 110
           HGH F   +     YP+ PP V      + H NI++  G ICLN+L   +W+PV +L T+
Sbjct: 157 HGH-FGFSVSFKDSYPIDPPIVK-CLTTIYHPNIDY-NGNICLNVL-REDWTPVLDLQTI 212

Query: 111 VLAIYQLLSDPVTDSPLNIDLSNILKIKD 139
           V+ +  L  +P    PLN   ++ + +KD
Sbjct: 213 VIGLLFLFLEPNPKDPLNKHAAHTM-VKD 240

>ZYRO0G19910g Chr7 (1650667..1651206) [540 bp, 179 aa] {ON} similar
           to uniprot|P52491 Saccharomyces cerevisiae YLR306W UBC12
           Enzyme that mediates the conjugation of Rub1p a
           ubiquitin-like protein to other proteins related to E2
           ubiquitin-conjugating enzymes
          Length = 179

 Score = 45.4 bits (106), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 28/97 (28%), Positives = 49/97 (50%), Gaps = 3/97 (3%)

Query: 32  SDDLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKI 91
           +DD        + P    Y G +F   +    +YP++PP+V     ++ H NI+   G++
Sbjct: 48  TDDSIPLLQLAVKPDEGYYKGGNFTFELLFNEQYPMEPPKVK-CLNRIYHPNID-TDGRV 105

Query: 92  CLNILDNANWSPVWNLLTVVLAIYQLLSDPVTDSPLN 128
           CLNIL   +W+P  +L +V++ +  L  +     PLN
Sbjct: 106 CLNIL-RQDWTPALDLQSVIIGLLFLFLEISGVDPLN 141

>TBLA0D00600 Chr4 complement(156677..157447) [771 bp, 256 aa] {ON}
           Anc_7.392 YER100W
          Length = 256

 Score = 45.8 bits (107), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 25/89 (28%), Positives = 45/89 (50%), Gaps = 8/89 (8%)

Query: 34  DLTNWTATILGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTG-KIC 92
           ++  W   I+GP +TPY G  +   +    +YP KPP     A +M   N  FK   ++C
Sbjct: 33  NILEWHYIIIGPQDTPYDGGQYHGTLTFPSDYPYKPP-----AIRMITPNGRFKENTRLC 87

Query: 93  LNILDN--ANWSPVWNLLTVVLAIYQLLS 119
           L++ D     W+P W++ T++  +   ++
Sbjct: 88  LSMSDYHPDTWNPGWSVATILNGLLSFMT 116

>TBLA0A01900 Chr1 complement(463994..464402,464500..464510) [420 bp,
           139 aa] {ON} Anc_6.187 YGL087C
          Length = 139

 Score = 44.3 bits (103), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 36/123 (29%), Positives = 60/123 (48%), Gaps = 13/123 (10%)

Query: 5   RLLKEYQVVKKELGNHKNIISSLEPIDSDD--LTNWTATILGPPNTPYHGHSFDLRIHLT 62
           RLL+E +  +K +G       S    D DD  +T W  TILGPP++ +    + L I   
Sbjct: 9   RLLEELEKGEKGMGPES---CSYGLADGDDITMTRWNGTILGPPHSNHENRIYSLSIECG 65

Query: 63  PEYPLKPPQVTF-SAYKMPHCNIEFKTGKIC---LNILDNANWSPVWNLLTVVLAIYQLL 118
           P YP  PP + F S   +P C +  KTG++     ++L   +W     +  ++L + + +
Sbjct: 66  PNYPDAPPVLFFISKINLP-C-VSPKTGQVMPSEFHLL--RDWKRSCTMEKILLELRKEM 121

Query: 119 SDP 121
           + P
Sbjct: 122 ASP 124

>ADL035C Chr4 complement(634056..634607,634660..634710) [603 bp, 200
           aa] {ON} Syntenic homolog of Saccharomyces cerevisiae
           YLR306W (UBC12); 1-intron
          Length = 200

 Score = 44.7 bits (104), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 32/93 (34%), Positives = 48/93 (51%), Gaps = 3/93 (3%)

Query: 43  LGPPNTPYHGHSFDLRIHLTPEYPLKPPQVTFSAYKMPHCNIEFKTGKICLNILDNANWS 102
           + P    Y G  F   +     YP++PP V      + H NI++ +G ICLN+L   +WS
Sbjct: 81  ISPEEGVYRGGHFRFSVVFRDTYPIEPPTVK-CLNTIYHPNIDY-SGNICLNVL-REDWS 137

Query: 103 PVWNLLTVVLAIYQLLSDPVTDSPLNIDLSNIL 135
           PV +L TVVL +  L  +P    PLN   ++ +
Sbjct: 138 PVMDLQTVVLGLLFLFLEPNGSDPLNRQAADTM 170

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.417 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,899,099
Number of extensions: 889151
Number of successful extensions: 2883
Number of sequences better than 10.0: 279
Number of HSP's gapped: 2623
Number of HSP's successfully gapped: 279
Length of query: 157
Length of database: 53,481,399
Length adjustment: 100
Effective length of query: 57
Effective length of database: 42,014,799
Effective search space: 2394843543
Effective search space used: 2394843543
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 61 (28.1 bits)