Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_480.123.497ON1114111454960.0
ZYRO0D09790g3.497ON1180115520130.0
TDEL0D056503.497ON1077112019900.0
TPHA0A056803.497ON1074110919830.0
Suva_7.4223.497ON1127117219370.0
KAFR0C020003.497ON1066108318480.0
YGR134W (CAF130)3.497ON1122113018490.0
Smik_6.2303.497ON1124112918380.0
Skud_7.4453.497ON1123115518250.0
NCAS0E007703.497ON115085618090.0
SAKL0F02596g3.497ON1132111616510.0
KLTH0G02442g3.497ON1113111916020.0
NDAI0G009003.497ON127986716090.0
Kwal_47.188863.497ON1105111515720.0
TBLA0C045103.497ON1307129915780.0
KNAG0B007703.497ON1038111515400.0
Ecym_12323.497ON1204118015220.0
AFR316W3.497ON1191120915100.0
CAGL0I10428g3.497ON1163109814001e-174
KLLA0E03961g3.497ON11326006805e-73
ZYRO0C16390g3.362ON43678791.1
Kpol_543.538.298ON539167744.5
ZYRO0G19954g2.441ON700108727.3
TDEL0C050403.362ON45468718.8
Kwal_23.5946singletonOFF246106709.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_480.12
         (1114 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON...  2121   0.0  
ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] ...   780   0.0  
TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_...   771   0.0  
TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_...   768   0.0  
Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W...   750   0.0  
KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3....   716   0.0  
YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Par...   716   0.0  
Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W...   712   0.0  
Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W...   707   0.0  
NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {...   701   0.0  
SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] ...   640   0.0  
KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] ...   621   0.0  
NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {...   624   0.0  
Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR...   610   0.0  
TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_...   612   0.0  
KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {...   597   0.0  
Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON...   590   0.0  
AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic...   586   0.0  
CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa...   543   e-174
KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa] ...   266   5e-73
ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]...    35   1.1  
Kpol_543.53 s543 complement(117707..119326) [1620 bp, 539 aa] {O...    33   4.5  
ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} high...    32   7.3  
TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {O...    32   8.8  
Kwal_23.5946 s23 complement(1381399..1382139) [741 bp, 246 aa] {...    32   9.0  

>Kpol_480.12 s480 complement(23340..26684) [3345 bp, 1114 aa] {ON}
            complement(23340..26684) [3345 nt, 1115 aa]
          Length = 1114

 Score = 2121 bits (5496), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1044/1114 (93%), Positives = 1044/1114 (93%)

Query: 1    MAKVAHVSKLKRIAEILSPNYKPSIYQLEQLLRDENQVLDLLADIEVKGSFITEVTVIAL 60
            MAKVAHVSKLKRIAEILSPNYKPSIYQLEQLLRDENQVLDLLADIEVKGSFITEVTVIAL
Sbjct: 1    MAKVAHVSKLKRIAEILSPNYKPSIYQLEQLLRDENQVLDLLADIEVKGSFITEVTVIAL 60

Query: 61   FTTRPGISLLNCLTDNFGIDEDNKDFNPNSLLPRMPQLALKWMHDELILIKFLRFIIDNR 120
            FTTRPGISLLNCLTDNFGIDEDNKDFNPNSLLPRMPQLALKWMHDELILIKFLRFIIDNR
Sbjct: 61   FTTRPGISLLNCLTDNFGIDEDNKDFNPNSLLPRMPQLALKWMHDELILIKFLRFIIDNR 120

Query: 121  NMDINFKNKNDILSKLQLDFLIKNETSDFISLNLLTNEVDVVREYLTAIWPKLKNIIKIS 180
            NMDINFKNKNDILSKLQLDFLIKNETSDFISLNLLTNEVDVVREYLTAIWPKLKNIIKIS
Sbjct: 121  NMDINFKNKNDILSKLQLDFLIKNETSDFISLNLLTNEVDVVREYLTAIWPKLKNIIKIS 180

Query: 181  LNGENEYIDCEDSFFVRTILSYKRLYETLLHFEFYDYSSMKTNGSDIYVKALMKHLTGLS 240
            LNGENEYIDCEDSFFVRTILSYKRLYETLLHFEFYDYSSMKTNGSDIYVKALMKHLTGLS
Sbjct: 181  LNGENEYIDCEDSFFVRTILSYKRLYETLLHFEFYDYSSMKTNGSDIYVKALMKHLTGLS 240

Query: 241  NFSFQLFKLSGYFYNTIDNQSYNPSKFGFIPLSVDPDDGEVEENQETDNILQPSLLDFPD 300
            NFSFQLFKLSGYFYNTIDNQSYNPSKFGFIPLSVDPDDGEVEENQETDNILQPSLLDFPD
Sbjct: 241  NFSFQLFKLSGYFYNTIDNQSYNPSKFGFIPLSVDPDDGEVEENQETDNILQPSLLDFPD 300

Query: 301  LMNETAKRHLALSKLIIDSKLEKQISNSPLLQIQYKTLLALIDPLTQPVPNDTHVISIDL 360
            LMNETAKRHLALSKLIIDSKLEKQISNSPLLQIQYKTLLALIDPLTQPVPNDTHVISIDL
Sbjct: 301  LMNETAKRHLALSKLIIDSKLEKQISNSPLLQIQYKTLLALIDPLTQPVPNDTHVISIDL 360

Query: 361  LCNMFLGLMKPYIDNQLNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERLGTVDESKD 420
            LCNMFLGLMKPYIDNQLNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERLGTVDESKD
Sbjct: 361  LCNMFLGLMKPYIDNQLNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERLGTVDESKD 420

Query: 421  WRSQLHLWLPRGLNTQNLELVYMSCILAVYTIYKLYSDSPVHFNPFLSSLISLWKSLTCV 480
            WRSQLHLWLPRGLNTQNLELVYMSCILAVYTIYKLYSDSPVHFNPFLSSLISLWKSLTCV
Sbjct: 421  WRSQLHLWLPRGLNTQNLELVYMSCILAVYTIYKLYSDSPVHFNPFLSSLISLWKSLTCV 480

Query: 481  VLYGLQIDRLEESNQSFDTPIIVRATIRGAAALRSIVATVLNEQMELKRHDFIHESLNTF 540
            VLYGLQIDRLEESNQSFDTPIIVRATIRGAAALRSIVATVLNEQMELKRHDFIHESLNTF
Sbjct: 481  VLYGLQIDRLEESNQSFDTPIIVRATIRGAAALRSIVATVLNEQMELKRHDFIHESLNTF 540

Query: 541  MSPHGRKLCDGALYADLKAYTASILALGAEFQEVTDLVSYLQAGDQFDEDVKYMFXXXXX 600
            MSPHGRKLCDGALYADLKAYTASILALGAEFQEVTDLVSYLQAGDQFDEDVKYMF     
Sbjct: 541  MSPHGRKLCDGALYADLKAYTASILALGAEFQEVTDLVSYLQAGDQFDEDVKYMFEYEYE 600

Query: 601  XXXXXXXXXXXXXXXXXXXXYAFNKRRCNCIFXXXXXXXXXXXXXXXXXXXXXXXIDGEI 660
                                YAFNKRRCNCIF                       IDGEI
Sbjct: 601  DYNEIYEDSSNENEENEEIDYAFNKRRCNCIFSDDNLIEEEEDDEEESDVEKTSDIDGEI 660

Query: 661  ATKSKEHTEKTIESDSGLSNQLSKPHAVRSKSNFEFDYSGKDWRDIPREYNLYYSPFYNF 720
            ATKSKEHTEKTIESDSGLSNQLSKPHAVRSKSNFEFDYSGKDWRDIPREYNLYYSPFYNF
Sbjct: 661  ATKSKEHTEKTIESDSGLSNQLSKPHAVRSKSNFEFDYSGKDWRDIPREYNLYYSPFYNF 720

Query: 721  IDRPDLNTVFVLTLKATSXXXXXXXXXXXXCSVASTVKNEQDRMIFGNLLEQDKSSTADE 780
            IDRPDLNTVFVLTLKATS            CSVASTVKNEQDRMIFGNLLEQDKSSTADE
Sbjct: 721  IDRPDLNTVFVLTLKATSEKLTKEEAALLLCSVASTVKNEQDRMIFGNLLEQDKSSTADE 780

Query: 781  HEDTKKEATPDDIYEIWCEESAFERILHFNPDLAWKLMDEMLMCSGYRRVLIWFITHMEL 840
            HEDTKKEATPDDIYEIWCEESAFERILHFNPDLAWKLMDEMLMCSGYRRVLIWFITHMEL
Sbjct: 781  HEDTKKEATPDDIYEIWCEESAFERILHFNPDLAWKLMDEMLMCSGYRRVLIWFITHMEL 840

Query: 841  SHSLIIYIFDLMMGSRGINKTDTSKNVKSTFITENISDSNSNSLKFSRMGHLKLSELETR 900
            SHSLIIYIFDLMMGSRGINKTDTSKNVKSTFITENISDSNSNSLKFSRMGHLKLSELETR
Sbjct: 841  SHSLIIYIFDLMMGSRGINKTDTSKNVKSTFITENISDSNSNSLKFSRMGHLKLSELETR 900

Query: 901  MILQELFTNAAIYFSDKARKSNQSILTPDYSTXXXXXXXXXXGGYSIYSVGLMKLICIMV 960
            MILQELFTNAAIYFSDKARKSNQSILTPDYST          GGYSIYSVGLMKLICIMV
Sbjct: 901  MILQELFTNAAIYFSDKARKSNQSILTPDYSTEEEEFDEENEGGYSIYSVGLMKLICIMV 960

Query: 961  SKLIENSKFNVNESDCVFELQTLLMGWISILPEAKELSFKINSSLSEFSHVENSELASIE 1020
            SKLIENSKFNVNESDCVFELQTLLMGWISILPEAKELSFKINSSLSEFSHVENSELASIE
Sbjct: 961  SKLIENSKFNVNESDCVFELQTLLMGWISILPEAKELSFKINSSLSEFSHVENSELASIE 1020

Query: 1021 GASTKSHKQLVDKNSESYKYNEILLKLIPPTFGGKEENIIFNTFRDYIKDYSFDSEVSTM 1080
            GASTKSHKQLVDKNSESYKYNEILLKLIPPTFGGKEENIIFNTFRDYIKDYSFDSEVSTM
Sbjct: 1021 GASTKSHKQLVDKNSESYKYNEILLKLIPPTFGGKEENIIFNTFRDYIKDYSFDSEVSTM 1080

Query: 1081 CRKIIHQSDEILPLQDSEKPFSFHDYLTEYGKAV 1114
            CRKIIHQSDEILPLQDSEKPFSFHDYLTEYGKAV
Sbjct: 1081 CRKIIHQSDEILPLQDSEKPFSFHDYLTEYGKAV 1114

>ZYRO0D09790g Chr4 complement(828446..831988) [3543 bp, 1180 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1180

 Score =  780 bits (2013), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/1155 (40%), Positives = 655/1155 (56%), Gaps = 125/1155 (10%)

Query: 28   LEQLLRDENQVLDLLADIEVKGSFITEVTVIALFTTRPGISLLNCLTDNFGIDEDNKDFN 87
            L++LLRD         D ++K S + E+ ++AL TTR G+S+L  L              
Sbjct: 68   LDRLLRDSKS----WKDPQLKYSLLLEMVIVALLTTRAGLSVLALL-------------K 110

Query: 88   PNSLLPRMPQ---------------------LALKWMHDELILIKFLRFIIDNRNMDINF 126
            P+   P +P+                     L  +W  D+ I +KFL F++ N ++ +  
Sbjct: 111  PSGSNPSIPKCISNQRKWLAQVERKGKLHSDLISQWQSDDDIFLKFLHFLLKNEDVWLPC 170

Query: 127  KNKNDILSKLQLDFLIKNETSDFISLNLLTN-EVDVVREYLTAIWPKLKNIIKISLNGEN 185
            +N N    K+ L FLI+   S + +  L+ +   +++ +Y  A+ P  +  ++ +++  N
Sbjct: 171  ENVNQCEWKVPLSFLIQ---SKYRAAELILDPSYNLLVDYFLAVVPLCEKWLRRAISYGN 227

Query: 186  EYIDCEDSFFVRTILSYKRLYETLLHFEFYDYSSMKTNGSDIYVKALM-------KHLTG 238
                       RT+++Y R+Y+   +F +Y   +  +N   +  + L        K +  
Sbjct: 228  ------GVHLKRTVINYNRVYDFSGYFTWYTLQTRGSNHPFVSQQILFDLIDSDDKEIEA 281

Query: 239  LSNFS-------FQLFKLSGYFYNTIDNQSYNPSKFGFIPLSVDPDDGEVEE-------- 283
            +S           Q+          I + S N   +G      D D   +EE        
Sbjct: 282  VSQIESNDQEERIQIIDQIRSAIQDISSASLNSGFYG------DEDRSALEEYSDNYHHQ 335

Query: 284  -NQETD----NILQPSLLDFPDLMNETAKRHLALSKLIIDSKLEKQISNSPLLQIQYKTL 338
             NQ       ++ Q   L+ P+LM+  A RH  L K++   KL    S+SPLLQ+Q+K +
Sbjct: 336  VNQNEQVFSFDLNQDGSLELPNLMSHAAVRHEILMKVL---KLNN--SSSPLLQLQFKIV 390

Query: 339  LALIDPLTQPVPNDTHVISIDLLCNMFLGLMKPYIDNQLNNDDGVDWRFHICFNMQQIII 398
              L+DPLTQP PND HVIS+DLL  MFLG + P I   L  ++G DWRFH+CFNMQ+II 
Sbjct: 391  AGLVDPLTQPAPNDKHVISLDLLYQMFLGFLTPEIQQTLEFEEGCDWRFHVCFNMQKIID 450

Query: 399  ASLFVLNCNDFERLGTV---DESKDWRSQLHLWLPRGLNTQNLELVYMSCILAVYTIYKL 455
            ASL  LN +DFERL ++   D++ DWRSQL  WLP G NTQ+LEL+ M  I+AVYTIYKL
Sbjct: 451  ASLVRLNFDDFERLNSINNSDDNVDWRSQLDKWLPHGFNTQDLELICMVDIIAVYTIYKL 510

Query: 456  YSDSPVHFNPFLSSLISLWKSLTCVVLYGLQIDRLEESNQSFDTPIIVRATIRGAAALRS 515
            Y   P+  NPFLSSLISLWK+LTCV+L GL+IDR+EE  ++FDTP++VRATIRGAAALR+
Sbjct: 511  YEHLPIQLNPFLSSLISLWKNLTCVILLGLEIDRIEEELETFDTPLMVRATIRGAAALRA 570

Query: 516  IVATVLNEQMELKRHDFIHESLNTFMSPHGRKLCDGALYADLKAYTASILALGAEFQEVT 575
            IVATVLN  +E  +HD  HESLNTFMSPHGRKLC GALYA+L+++ A++LALG+E ++VT
Sbjct: 571  IVATVLNGHVEATKHDIKHESLNTFMSPHGRKLCQGALYAELRSHAAALLALGSELEDVT 630

Query: 576  DLVSYLQAGDQFDEDVKYMFXXXXXXXXXXXXXXXXXXXXXXXXXYAFNK---------R 626
             L S LQ GD+FDEDV+YMF                         Y  +          R
Sbjct: 631  SLFSDLQPGDRFDEDVRYMFEYEFEDYNDLSSREEDYSGFDKYDDYTDSSKTHARKGFGR 690

Query: 627  RCNCIFXXXXXXXXXXXXXXXXXXXXXXXIDGEIATKSKEHTEKTIESDSGLSNQLSKPH 686
            RCNCIF                       I        +  T     S +G      KPH
Sbjct: 691  RCNCIFDDDEMLEDEDYENEYEGHKAPKQI-----LPQQNPTTSVSMSTTG------KPH 739

Query: 687  AVRSKSNFEFDYSGKDWRDIPREYNLYYSPFYNFIDRPDLNTVFVLTLKATSXXXXXXXX 746
            A+RS  +FEFDYSGKDWRDIPR  NLYYSP Y+F++  D NT+  LT KAT         
Sbjct: 740  AIRSGGSFEFDYSGKDWRDIPRMSNLYYSPNYHFVEDLDPNTIISLTNKATKQSLSKIES 799

Query: 747  XXXXCSVASTVKNEQDRMIFGNL--LEQDKSSTADEHEDTKKEATPDDIYEIWCEESAFE 804
                 SVA+ VKNEQD ++ GN+  L     S   +  D  K+ +PDDIYE+WC++S FE
Sbjct: 800  LLLLGSVATCVKNEQDEIVLGNITELHHQNGSRGSQVIDKLKDISPDDIYEMWCKDSTFE 859

Query: 805  RILHFNPDLAWKLMDEMLMCSGYRRVLIWFITHMELSHSLIIYIFDLMMGSRGINKTDTS 864
            ++++ N ++AW+LMDEMLMCSG+RRVLIWFITHMEL+HSLI YIF+L+MG R     +  
Sbjct: 860  KMVYCNHEVAWRLMDEMLMCSGFRRVLIWFITHMELNHSLIHYIFELVMGLRKSFDENNE 919

Query: 865  KNVKSTFITENISDSNS--NSLKFSRMGHLKLSELETRMILQELFTNAAIYFSDKARKSN 922
             +     I+E   ++     SL FSR G ++LS +ET+M+LQE FTNAAI+ ++K+++  
Sbjct: 920  NDNGDESISEMTKEAPEVRTSLPFSRQGSIQLSSIETKMLLQEFFTNAAIFLTEKSKEWI 979

Query: 923  QSILTPDYSTXXXXXXXXXXGGYSIYSVGLMKLICIMVSKLIENSKFNVNESDCVFELQT 982
                  D +T          G  S+Y+VGLMKLIC+MV   I+  KF+  ES+CVFELQT
Sbjct: 980  GEEPMEDEAT----INDGENGNVSLYAVGLMKLICLMVRAFIKKGKFDFRESECVFELQT 1035

Query: 983  LLMGWISILPEAKELSFKINSSLSEFSH--VENSELASIEGASTKSHKQLVDKN------ 1034
            LLM WI+I+PEAK+L F++ + ++E     +++ EL++    S K    +V+ +      
Sbjct: 1036 LLMNWIAIIPEAKDLFFELKALVAEVHSDPMDDEELSNNPPDSNKKLSSMVENDNINGNE 1095

Query: 1035 SESYKYNEILLKLIPPTFGGKEENIIFNTFRDYIKDYSFDSEVSTMCRKIIHQSDEILPL 1094
            +   +YN  L+ L+ P    KEEN      R++IK YSFD+ V  + RK++++ +EILPL
Sbjct: 1096 AVDSEYNRKLISLLSPVMHRKEENAAVVALRNFIKKYSFDTTVPLIGRKVVYEGNEILPL 1155

Query: 1095 QDSEKPFSFHDYLTE 1109
             +SE P S  DYL +
Sbjct: 1156 PESETPMSLLDYLVD 1170

>TDEL0D05650 Chr4 (1015679..1018912) [3234 bp, 1077 aa] {ON} Anc_3.497
            YGR134W
          Length = 1077

 Score =  771 bits (1990), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 459/1120 (40%), Positives = 652/1120 (58%), Gaps = 76/1120 (6%)

Query: 3    KVAHVSKLKRIAEIL-SPNYKP--SIYQLEQLLRDENQVLDLLADIEVKGSFITEVTVIA 59
            K +++ K++ + E+L   N +P   +  L + LR+E     +L + + + S I E  +IA
Sbjct: 2    KRSNLDKVRPLHELLVEANLQPLKGVEGLAEALREEK----VLKNDQWRPSLICETLIIA 57

Query: 60   LFTTRPGISLLNCLTDNFGIDEDNKDFNPNSLLPRMPQLALKWMHDELILIKFLRFIIDN 119
            LFTTR GISLL               F+ ++   R+    L+W +DE ++++F  +I++N
Sbjct: 58   LFTTRAGISLLPL-------------FSESAKRKRVGPRVLEWHNDEELMLRFFSYILEN 104

Query: 120  RNMDINFKNKNDILSKLQLDFLIKNETSDFISLNLLTNE-VDVVREYLTAIWPKLKNIIK 178
            R+  I  +       KL L FLI+   S F++ +++ ++  +++ +Y+  I P +K  + 
Sbjct: 105  RSSRIEPRLFEKARWKLPLFFLIE---SKFLAASMVLDQNYNLLLDYVHTITPMIKRWVH 161

Query: 179  ISLNGENEYIDCEDSFFVRTILSYKRLYETLLHFEFYDYSSMKTNGSDIYVKALMKHLTG 238
             +          + +FF  T++ Y R+YE     E+Y + + K+N     ++  ++    
Sbjct: 162  RAFT--------QGTFFKDTVVCYNRVYELKDSSEWYSFGTKKSNEERRAIQQFLRE--- 210

Query: 239  LSNFSFQLFKLSGYFYNTIDNQSYNPSKFGFIPLSVDPDDGEVEENQETDNILQPSLLDF 298
                S Q+           + ++ N +      +S         EN  + +I Q   L+ 
Sbjct: 211  ---NSEQVLDTYHEMVRPSNERAINDTASYHHRISQ-------HENVYSFDINQDGSLEI 260

Query: 299  PDLMNETAKRHLALSKLIIDSKLEKQISNSPLLQIQYKTLLALIDPLTQPVPNDTHVISI 358
            P++M+  + RH  L  L     +   + +SPLLQ Q+K +  L+DPLTQP PND H+IS+
Sbjct: 261  PNIMSHASVRHDILQNL-----MRLPLCDSPLLQWQFKLMAGLVDPLTQPPPNDKHIISL 315

Query: 359  DLLCNMFLGLMKPYIDNQLNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERLGTV--- 415
            DLL  M LGLM+P I N L +D G DW+FH+CFNMQ+II ASL  LN  DF+ L ++   
Sbjct: 316  DLLYQMLLGLMEPAISNTLGSD-GCDWKFHLCFNMQKIIQASLKRLNLQDFDTLNSINNS 374

Query: 416  DESKDWRSQLHLWLPRGLNTQNLELVYMSCILAVYTIYKLYSDSPVHFNPFLSSLISLWK 475
            DE   WR  LH WLP GLNTQNLEL+YM  ILAVYTIYKLY D PV  NPFLS +ISLWK
Sbjct: 375  DEDVSWRDNLHSWLPHGLNTQNLELIYMIDILAVYTIYKLYEDLPVQLNPFLSPMISLWK 434

Query: 476  SLTCVVLYGLQIDRLEESNQSFDTPIIVRATIRGAAALRSIVATVLNEQMELKRHDFIHE 535
            +LTCV+L GL+IDR EE +++F+TP++VRATIRGAAALR++VAT+LN  ++  +HDF+HE
Sbjct: 435  NLTCVILLGLEIDRFEEEHETFETPVLVRATIRGAAALRAVVATILNGHVDTYKHDFMHE 494

Query: 536  SLNTFMSPHGRKLCDGALYADLKAYTASILALGAEFQEVTDLVSYLQAGDQFDEDVKYMF 595
             LNTFMSPHGRKLC GALYADL+++ A++LALG E ++VT+L++ LQAGD+FDEDV+YMF
Sbjct: 495  PLNTFMSPHGRKLCQGALYADLRSHAAALLALGTELEDVTNLLADLQAGDRFDEDVRYMF 554

Query: 596  XXXXXXXXXXXXXXXXXXXXXXXXXYAFNKRRCNCIFXXXXXXXXXXXXXXXXXXXXXXX 655
                                         +RRCNCI                        
Sbjct: 555  EYECDNYNEGDSESEKDGKLAVEQPKIL-QRRCNCI----FDDDEMAEDEDFDGENDEAF 609

Query: 656  IDGEIATKSKEHTEKTIESDSGLSNQLSKPHAVRSKSNFEFDYSGKDWRDIPREYNLYYS 715
                +  +    T  ++ S SG      KP AVRS   FEFDYSGKDWRDIPR  N YYS
Sbjct: 610  FSKHLILQQNAQTSLSM-SSSG------KPRAVRSGGAFEFDYSGKDWRDIPRGSNFYYS 662

Query: 716  PFYNFIDRPDLNTVFVLTLKATSXXXXXXXXXXXXCSVASTVKNEQDRMIFGNLLEQDKS 775
            P + FI+ P L+++  LT KA+S             SVAS VKNEQD +  GNL++  + 
Sbjct: 663  PDFEFIESPSLSSLLALTKKASSEKLVEKESLTLLRSVASCVKNEQDEITLGNLIDPHQD 722

Query: 776  STADEHEDTKKEATPDDIYEIWCEESAFERILHFNPDLAWKLMDEMLMCSGYRRVLIWFI 835
            S ADE      +  PDDIYE+WCE S FE+I++FN  LAWKLMDEML+C GYRRVLIWFI
Sbjct: 723  SQADEESRNADKIEPDDIYEMWCENSTFEKIVYFNHTLAWKLMDEMLLCIGYRRVLIWFI 782

Query: 836  THMELSHSLIIYIFDLMMGSRG-INKTDTSKNVKSTFITENISDSNSNSLKFSRMGHLKL 894
            THMEL+HSLI YIF+L+MG RG  ++ D   ++    + +        S+ FSR G L+L
Sbjct: 783  THMELNHSLIHYIFELVMGLRGNSDENDRDVDLAGPPLQDVDKVKGELSVGFSRQGALQL 842

Query: 895  SELETRMILQELFTNAAIYFSDKARKSNQSILTPDYSTXXXXXXXXXXGGYSIYSVGLMK 954
            S +ET+M+LQE FTNAAI+ S K+ +S    +  +                S+Y++GLMK
Sbjct: 843  STIETKMLLQEFFTNAAIFISKKSEESTD--IANEEQNNENRDLNGNSENVSLYAMGLMK 900

Query: 955  LICIMVSKLIENSKFNVNESDCVFELQTLLMGWISILPEAKELSFKINSSLSEFS---HV 1011
            LIC MV   I   KF+ +ES+CVFELQ LLM WI I+PEAK L F++ S ++ FS    V
Sbjct: 901  LICFMVRTFINKEKFDFSESECVFELQALLMNWIGIIPEAKTLFFELKSLIAGFSTATSV 960

Query: 1012 ENSELASIEGAST----KSHKQLVDKNSESYKYNEILLKLIPPTFGGKEENIIFNTFRDY 1067
            +  + A ++  +     K    +   N+  +++N  L+ L+PP    KEEN    T R +
Sbjct: 961  QEQKNAEVKNDTQEDVPKEQSPVRVSNTAGFEFNRKLMTLLPPLVKNKEENAAMQTLRSF 1020

Query: 1068 IKDYSFDSEVSTMCRKIIHQSDEILPLQDSEKPFSFHDYL 1107
            IK  SF + V  + RKI+++ D+ILPL  S+ P + H+Y+
Sbjct: 1021 IKTSSFLNTVPVIGRKIVYEDDKILPLPKSDVPLALHEYI 1060

>TPHA0A05680 Chr1 (1285934..1289158) [3225 bp, 1074 aa] {ON} Anc_3.497
            YGR134W
          Length = 1074

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/1109 (41%), Positives = 647/1109 (58%), Gaps = 81/1109 (7%)

Query: 19   PNYKPSIYQLEQLLRDENQVLDLLADIEVKGSFITEVTVIALFTTRPGISLLNCLTDNFG 78
            P Y+PS+Y L+ LLR+   VLD+LAD+  +    +EV ++ L  ++ G S+L     N  
Sbjct: 10   PKYRPSVYNLKNLLRNNELVLDMLADVNERNVLASEVVMMTLLCSKSGSSMLEYYMSNID 69

Query: 79   IDEDNKDFNPNSLLPRMPQLALKWMHDELILIKFLRFIIDNRNMDINFK-NKNDILSK-- 135
              +D K  + NS+  +   LAL+W +++++LIKFL  ++ NR   I F   K+D LSK  
Sbjct: 70   TIDDYKT-SENSIYKKNTALALRWENNDVLLIKFLTILLSNRKTLIKFTTGKDDTLSKNM 128

Query: 136  ---LQLDFLIK---NETSDFISLNLLTNEVDVVREYLTAIWPKLKNIIKISLNGENEYID 189
                 L FL     +ETS   +  + + + D +  Y + IWPK+KNI+  SLN + ++ D
Sbjct: 129  AFAQDLRFLFNKHYDETSYLPAAIVKSEQFDYLEAYCSIIWPKIKNILLESLNIDKQFQD 188

Query: 190  CEDSFFVRTILSYKRLYETLLHFEFYDYSSMKTNGSDIYVKALMKHLTGLSNFSFQLFKL 249
              +SFF + I  YKR  E L+  EF    ++ TN        ++      SN+   L+K 
Sbjct: 189  VTNSFFHKIIKLYKR--EYLVSAEFLTLINVLTNSVLFSYIVMLSEGYISSNYDGLLYK- 245

Query: 250  SGYFYNTIDNQSYNPSKFGFIPLSVDPDDGEVEENQETDNILQPSLLDFPDLMNETAKRH 309
            S   YN    ++   S FG    S       +  N E ++I         DLM  T +R 
Sbjct: 246  SPPTYNVKQRENMMNS-FGEFQSSA------MLTNDENNSI---------DLMKLTERRQ 289

Query: 310  LALSKLIIDSKLEKQISNSP--LLQIQYKTLLALIDPLTQPVPNDTHVISIDLLCNMFLG 367
              L K++I SKL KQI      L+ + +  + AL+DPLTQP+PND HVIS+DLL  +FL 
Sbjct: 290  NILYKVLIFSKL-KQIEPESFQLMSLLFNRICALVDPLTQPIPNDEHVISLDLLYKIFLA 348

Query: 368  LMKPYIDNQLNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERLGTVDESKDWRSQLHL 427
            +M P++   +  +   DWR+ I  N+Q+I+  +   LNC D E+L  VDE+K W+ QLHL
Sbjct: 349  MMLPHVQVLIERESSYDWRYEISNNLQKILFYAFLNLNCYDMEKLNKVDETKHWKEQLHL 408

Query: 428  WLPRGLNTQNLELVYMSCILAVYTIYKLYSDSPVHFNPFLSSLISLWKSLTCVVLYGLQI 487
            WLP GLN QNLEL+YM CI  VY I+KLY D P+HFNPFL +L+S WK LT V+LYGLQ+
Sbjct: 409  WLPHGLNPQNLELLYMICIFCVYAIFKLYEDKPLHFNPFLPTLLSTWKKLTYVMLYGLQV 468

Query: 488  DRLEESNQSFDTPIIVRATIRGAAALRSIVATVLNEQMELKRHDFIHESLNTFMSPHGRK 547
            DR EE N+SF+TPI+VRATIRGA+ALRS+VA++LN QM+ K+HDF HE LNTFMSPHGRK
Sbjct: 469  DRFEEENESFNTPIMVRATIRGASALRSVVASILNNQMDGKKHDFQHEPLNTFMSPHGRK 528

Query: 548  LCDGALYADLKAYTASILALGAEFQEVTDLVSYLQAGDQFDEDVKYMFXXX----XXXXX 603
            LC GALYADLK+YTAS+LA G EF+++T+L+SYLQ GD FDEDVKYMF            
Sbjct: 529  LCTGALYADLKSYTASMLACGMEFKDITELLSYLQPGDCFDEDVKYMFEYEYDDYNEPEE 588

Query: 604  XXXXXXXXXXXXXXXXXYAFNKRRCNCIFXXXXXXXXXXXXXXXXXXXXXXXIDGEIATK 663
                             + FN+RRC C+F                         G+    
Sbjct: 589  DESDEDGERNNSEENIKFNFNRRRCRCVFSDDDVLEH-----------------GDFNDA 631

Query: 664  SKEHTEKTIESDSGLSNQLSKPHAVRSKSNFEFDYSGKDWRDIPREYNLYYSPFYNFIDR 723
            + E++     S+   +  L      + K+  EFD+ GKDWR +PR  N++YS  Y FI+ 
Sbjct: 632  NSEYSNSEENSNDVDNFVLPNDGIDKPKNGVEFDFDGKDWRAVPRHLNMFYSFDYIFIEN 691

Query: 724  PDLNTVFVLTLKATSXXXXXXXXXXXXCSVASTVKNEQDRMIFGNLLEQDKSSTADEHED 783
            P    +  L  +A++             ++AS +K  QD  I G+     +S    +   
Sbjct: 692  PLEVLIRSLISEASASALSKKKSHLLLRNIASVIKINQDSRILGS----KRSPNGTDSSK 747

Query: 784  TKKEATPDDIYEIWCEESAFERILHFNPDLAWKLMDEMLMCSGYRRVLIWFITHMELSHS 843
            ++   +  D+ ++      FE IL FN +L   LMDE+LM  GYRRVL+WF+TH+ LSH+
Sbjct: 748  SQNGLSTGDLIKLITAGDTFENILKFNRELGCFLMDELLMILGYRRVLLWFLTHLTLSHT 807

Query: 844  LIIYIFDLMMGSRGINKTDTSKNVKSTFITENISDSNSNSLKFSRMGHLKLSELETRMIL 903
            +I YIF+L+M  RG   +DT +            + +  S  FSR G L+LS+LE  M+L
Sbjct: 808  IIYYIFELLMHHRG-QVSDTER------------EQSELSYTFSRQGELRLSDLEREMLL 854

Query: 904  QELFTNAAIYFSDKARKSNQSIL----TPDYSTXXXXXXXXXXGGYSIYSVGLMKLICIM 959
            QE FTNA ++FS K      S+L    T D +           G YS+Y+VGLM++ CIM
Sbjct: 855  QEFFTNATMFFSSK------SVLFASDTGD-NNEINTDVDGEEGLYSLYAVGLMRVTCIM 907

Query: 960  VSKLIENSKFNVNESDCVFELQTLLMGWISILPEAKELSFKINSSLSEFSHVENSELASI 1019
            +  L +N+ F+++ S+ +FELQTLLMGWI+I+PEAK L FK+  S+  F+ ++N EL SI
Sbjct: 908  IISLFDNADFDLSSSESIFELQTLLMGWINIIPEAKLLFFKLKESVKSFNGIDNPELKSI 967

Query: 1020 EGASTKSHKQLVDKNSESYKYNEILLKLIPPTFGGKEENIIFNTFRDYIKDYSFDSEVST 1079
            E +ST + K  +D+NSE Y++N+ LLK  P +F G + +I+  TF+D++++YSFDSE   
Sbjct: 968  EESSTTTKKTTIDENSEQYRFNKKLLKTFPKSFSGDDGDILLKTFKDFLRNYSFDSEPPY 1027

Query: 1080 MCRKIIHQSDEILPLQDSEKPFSFHDYLT 1108
            + RK+I++SDEIL L D EKP S H +L+
Sbjct: 1028 IGRKVIYESDEILQLTDIEKPISLHKFLS 1056

>Suva_7.422 Chr7 (727936..731319) [3384 bp, 1127 aa] {ON} YGR134W
            (REAL)
          Length = 1127

 Score =  750 bits (1937), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 450/1172 (38%), Positives = 651/1172 (55%), Gaps = 142/1172 (12%)

Query: 1    MAKVAHVSKLKRIAEILSP-NYKPSIYQLEQLLRDENQVLDLLADIEVKGSFITEVTVIA 59
            +  V   ++   + E+L   +Y PS+  LE+LL DE     +L D E++   + E   + 
Sbjct: 24   LGNVHRYAQFISLQELLKDRHYTPSVENLEKLLYDET----ILNDQEIRFPLLFEALSVT 79

Query: 60   LFTTRPGISLLNCLTDNFGIDE-------DNKDFNPNSLLPRMPQLALKWMHDELILIKF 112
            LFTT+ G S+L  +  +   +        +N D N  S++         W  D+++L+KF
Sbjct: 80   LFTTKSGKSILQTMKASTSKERKAWEKSFENHDSNYASIIR-------SWKEDDVLLLKF 132

Query: 113  LRFIIDNRNMDINFKNKNDILSKLQLDFLIKNETSDFISLNLLTNEVDVVREYLTAIWPK 172
            LRFI+ N+   +     N    KL L FLI ++ +  +   +L    +++++YL AI  +
Sbjct: 133  LRFILANKTTPLQIDRYNLPKYKLPLSFLIVSKVN--LPSIILNEGYNMLKDYLYAISGR 190

Query: 173  LKNIIKISLNGENEYIDCEDSFFVRTILSYKRLYETLLHFEFYDYSSMKT------NGSD 226
            ++ +I       N   D     F  T+  Y R+ E    + +Y +S+ K       +  +
Sbjct: 191  MEGLIWC-----NSTFDQSARIFKGTLQQYDRMIEFRNFYFWYSFSAEKNATPKLNHNIN 245

Query: 227  IYVKALMKHLTGLSNFSFQLFKLSGYFYNTIDNQSYNPSKFGFIPLSVDPDDGEVEENQE 286
            + + +   +L G+S+                DN    P K   I  +V+      +E   
Sbjct: 246  LLMDSYEDNLDGVSSVDDA---------GKSDNHQKQP-KDTIIHRTVND-----QEQIY 290

Query: 287  TDNILQPSLLDFPDLMNETAKRHLALSKLIIDSKLEKQISNSPLLQIQYKTLLALIDPLT 346
            +  + Q   L  P++M  +  RH  L K++  + +      +PLL+ Q+ TL  L+DPLT
Sbjct: 291  SFELNQDGTLQIPNVMEHSLLRHELLFKILNLTPVL-----TPLLEQQFSTLCGLVDPLT 345

Query: 347  QPVPNDTHVISIDLLCNMFLGLMKPYIDNQLNNDDGVDWRFHICFNMQQIIIASLFVLNC 406
            QP PND H+ISID L  +FLGLM P I     +++  DW+F+ICFNMQ+II A++  LNC
Sbjct: 346  QPTPNDKHIISIDFLYQLFLGLMYPSIKTSQEHNNHYDWKFYICFNMQKIIDATMLRLNC 405

Query: 407  NDFERLGTVDESKD---WRSQLHLWLPRGLNTQNLELVYMSCILAVYTIYKLYSDSPVHF 463
              FE+L +++ + D   WR+QLH+WLP GLNTQ+LEL+YM  ILAVYTIYKLY + P+  
Sbjct: 406  FGFEKLNSINNTDDTVHWRTQLHIWLPHGLNTQDLELLYMIDILAVYTIYKLYEEIPIQL 465

Query: 464  NPFLSSLISLWKSLTCVVLYGLQIDRLEESNQSFDTPIIVRATIRGAAALRSIVATVLNE 523
            NPFL SL+SLWK+L+CV+L  L+IDR+EE   +++TP++VRATIRGAAALRS++A VLN 
Sbjct: 466  NPFLFSLLSLWKNLSCVILLALEIDRIEEEKGTYETPLMVRATIRGAAALRSVIAAVLNG 525

Query: 524  QMELKRHDFIHESLNTFMSPHGRKLCDGALYADLKAYTASILALGAEFQEVTDLVSYLQA 583
             ++   HDF HESLNTFMSP+GRKLC GALYADL+++TAS+LALGA  ++VTDL + LQ+
Sbjct: 526  LVKSNDHDFKHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQS 585

Query: 584  GDQFDEDVKYMF---------XXXXXXXXXXXXXXXXXXXXXXXXXYAFNKRRCNCIFXX 634
            GD+FDED++YMF                                    F +RRCNCIF  
Sbjct: 586  GDRFDEDIRYMFDYECEDYNESFSDCGDEELGEGVNSGEKTKTSIHNGFYQRRCNCIFND 645

Query: 635  XXXXXXXXXXXXXXXXXXXXXIDGEIATKSKEHTEKTIESDSGLSNQLS----------- 683
                                  DG  A+ + +  +  I SD    +  +           
Sbjct: 646  DKLVAE----------------DGANASTNNDSIKNEIRSDGNAGSNTAITNANHATSSI 689

Query: 684  KPHAVRSKSNFEFDYSGKDWRDIPREYNLYYSPFYNFIDRPDLNTVFVLTLKATSXXXXX 743
             P++VRS+S FEFDYSG+DWRD+P+++N+YYSP Y+FI  P L+ +F LTL+  +     
Sbjct: 690  NPYSVRSRSTFEFDYSGEDWRDVPKDFNIYYSPSYSFIQEPKLDIIFNLTLRGATEKLSR 749

Query: 744  XXXXXXXCSVASTVKNEQDRMIFGNLLEQ-----------DKSSTADEHEDTK-KEATPD 791
                    SVAS VKNEQD+MI  +L              D   T+D+  D + +  TPD
Sbjct: 750  EESVLLVRSVASCVKNEQDQMILADLGSNFTSIGENFEGGDTGITSDKTNDEELRRTTPD 809

Query: 792  DIYEIWCEESAFERILHFNPDLAWKLMDEMLMCSGYRRVLIWFITHMELSHSLIIYIFDL 851
            DIYEIW EESAFER+L+ N D+AW+LMDEMLMC+GYRR+LIWF+TH+EL HSLI Y+F+L
Sbjct: 810  DIYEIWSEESAFERMLYVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFEL 869

Query: 852  MMGSRG------INKTDTSKNVKSTFITENISDSNSNSLKFSRMGHLKLSELETRMILQE 905
            +MG RG       +  D   ++    + +   + N++ L FSR G + LS++ET+M+LQE
Sbjct: 870  IMGLRGNPFSGEASDQDRKDDMIYEILKKKQKNENTSGLPFSRQGPIVLSDIETKMLLQE 929

Query: 906  LFTNAAIYFSDKARKSNQSILTPDYSTXXXXXXXXXXGGYSIYSVGLMKLICIMVSKLIE 965
             F NAAI+ S K  +                         S+YS+GL+KLIC MV  LI 
Sbjct: 930  FFMNAAIFLSSKNTEEEGE----------------DADKVSLYSLGLVKLICYMVQTLIA 973

Query: 966  NSKFNVNESDCVFELQTLLMGWISILPEAKELSFKINSSLSEFSHVENSELASIEGASTK 1025
            N KF   +S+C FELQTLLM WI ILPEAK+L F+I S L+    +E   +      +T 
Sbjct: 974  NDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFQIKSRLA----MEEDGITD----NTV 1025

Query: 1026 SHKQLVDKNSES---------YKYNEILLKLIPPTFGGKEENIIFNTFRDYIKDYSFDSE 1076
             HK   D + +S          K N  +L L P      ++N   +T R +I DYSFD++
Sbjct: 1026 QHKDKTDLDLDSGKKPNTKSISKLNMKILSLFPSNPTENDDNSAISTLRSFITDYSFDTQ 1085

Query: 1077 VSTMCRKIIHQSDEILPLQDSEKPFSFHDYLT 1108
            V    R+++   D+ILPL  ++KP   H+Y+T
Sbjct: 1086 VVAPGRRVVFHDDKILPLPKADKPIPLHEYIT 1117

>KAFR0C02000 Chr3 (396123..399323) [3201 bp, 1066 aa] {ON} Anc_3.497
            YGR134W
          Length = 1066

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/1083 (40%), Positives = 626/1083 (57%), Gaps = 110/1083 (10%)

Query: 50   SFITEVTVIALFTTRPGISLLNCLTDNFGIDEDNKDFNPNSLLPRMPQLALKWMHDEL-- 107
            S + E  VI+LFTT+ G S+L+ L +     E  + +N + L      L  K++  EL  
Sbjct: 51   SVLLEGLVISLFTTKSGHSILSVLNNPDANSELFQRYN-SWLESSSGDLNYKYLKHELWQ 109

Query: 108  -----ILIKFLRFIIDNRNMDINFKNKNDILSKLQLDFLIKNETSDFISLNLLTNEVDVV 162
                  L +F +F++ N  +  +  N +    KL+L  LI +E S+ ISL L ++  +++
Sbjct: 110  SNRNYYLSQFTKFLLQNEQVPFHLNNYHLTKYKLKLQRLINSE-SNIISLILNSDNYNLL 168

Query: 163  REYLTAIWPKLKNIIKISLNGENEYIDCEDSFFVRTILSYKRLYETLLHFEFYDYSSMKT 222
             +++    P + ++I   + G           F   I  Y R+YE L  F  +   ++ +
Sbjct: 169  LDFIMFFQPYMNDLISYIVEGNK---------FFEIIAKYNRIYE-LNGFHTWYTLTIAS 218

Query: 223  NGSDIYVKALMKHLTGLSNFSFQLFKLSGYFYNTIDNQSYNPSKFGFIPLSVDPDDGEVE 282
            N S I V+ L   L+     + Q       F +   ++++  S+   +           +
Sbjct: 219  NTS-IAVRYLNDVLSIDPMITDQ-------FTSNYRDKAFQESEETLLM---------SQ 261

Query: 283  ENQETDNILQPSLL----DFPDLMNETAKRHLALSKLIIDSKLEKQISNSPLLQIQYKTL 338
            +    D+I+    L    D P+L+  +  RH    ++I D     QI +SP L+ Q+  +
Sbjct: 262  QQTAKDDIIFSFDLNETGDLPNLIKHSEMRH----QIIYDILNLNQI-DSPFLKKQFLLI 316

Query: 339  LALIDPLTQPVPNDTHVISIDLLCNMFLGLMKPYIDNQLNNDDGVDWRFHICFNMQQIII 398
              L+DPLTQP PN+ H+ISIDL+  +F+GLM  + +N+L   D     F ICFNMQ+II 
Sbjct: 317  CGLVDPLTQPQPNNEHIISIDLIYQLFMGLMYKFNNNELAGKDKELQHFTICFNMQKIIS 376

Query: 399  ASLFVLNCNDFERLGTV--DESKDWRSQLHLWLPRGLNTQNLELVYMSCILAVYTIYKLY 456
             SL +LNCND++ L T+  D   D+++ L+ WLP G+NTQ+LEL+YM  I+A+YTIYKLY
Sbjct: 377  RSLVLLNCNDYDTLSTILNDFPNDYKTALNKWLPHGINTQDLELIYMINIIAIYTIYKLY 436

Query: 457  SDSPVHFNPFLSSLISLWKSLTCVVLYGLQIDRLEESNQSFDTPIIVRATIRGAAALRSI 516
            S+ P+  NPFL +L+SLWK+L+ +VL GL+IDR+EESN+++DTPIIVRATIRGAAALR++
Sbjct: 437  SNLPIQLNPFLQTLVSLWKTLSHLVLIGLEIDRIEESNETYDTPIIVRATIRGAAALRAV 496

Query: 517  VATVLNEQMELKRHDFIHESLNTFMSPHGRKLCDGALYADLKAYTASILALG-AEFQEVT 575
            +AT+LN+ +  K HDF HES NTFMSPHGRKLC GAL ADL+++ A+ILALG  E  +VT
Sbjct: 497  IATILNDHVSTKEHDFKHESFNTFMSPHGRKLCSGALLADLRSHAAAILALGDGELHDVT 556

Query: 576  DLVSYLQAGDQFDEDVKYMFXXXXXXXXXXXXXXXXXXXXXXXXXYAFNKRRCNCIFXXX 635
            +L++ LQAGD+FDEDVKY+F                          +  KRRCNCIF   
Sbjct: 557  ELLADLQAGDRFDEDVKYIFEYEYQDYNELGEEDEQTNELEELEKRSVKKRRCNCIFEDD 616

Query: 636  XXXXXXXXXXXXXXXXXXXXIDGEIATKSKEHTEKTIESDSGLSNQLSKPHAVRSKSNFE 695
                                   E+  +S+   +  +ESD   +N    P++VR  S FE
Sbjct: 617  KMLEDYEYY--------------EVGNESRRE-DMNLESDKSRTN----PYSVRVNSIFE 657

Query: 696  FDYSGKDWRDIPREYNLYYSPFYNFIDRPDLNTVFVLTLKATSXXXXXXXXXXXXCSVAS 755
            FDYSGKDWRD+PR +NLYYSP Y FI  P L TV   TLKAT+             SVAS
Sbjct: 658  FDYSGKDWRDVPRGFNLYYSPSYEFIKNPKLGTVLHFTLKATTEKLSDEDSLLLLQSVAS 717

Query: 756  TVKNEQDRMIFGNLLEQDKSSTADEHEDTKKEATPDDIYEIWCEESAFERILHFNPDLAW 815
             VK EQ++MI  N       ST    ED  +E TPDD+YEIWCEESAFER+++ N ++AW
Sbjct: 718  CVKLEQEKMILENYSNTKNCST---EEDLDREVTPDDVYEIWCEESAFERMIYLNKEVAW 774

Query: 816  KLMDEMLMCSGYRRVLIWFITHMELSHSLIIYIFDLMMGSRGINKTDTSKN-----VKST 870
            +LMDEMLMC+GYRRVL+WFITHME++HSL+ YIF+L+MG RG  + D S+N     +KS 
Sbjct: 775  RLMDEMLMCNGYRRVLMWFITHMEINHSLVHYIFELVMGLRG--QRDDSRNPGDDRLKSL 832

Query: 871  FITENISD-SNSNSLKFSRMGHLKLSELETRMILQELFTNAAIYFS--DKARKSNQSILT 927
             + + ++D   S  + FSR G + LSE+ET+M+LQE FTNAAI+FS  D A  S+     
Sbjct: 833  LLQDMMTDKKGSEKVPFSRQGSIILSEIETKMLLQEFFTNAAIFFSTNDTANMSSND--- 889

Query: 928  PDYSTXXXXXXXXXXGGYSIYSVGLMKLICIMVSKLIENSKFNVNESDCVFELQTLLMGW 987
                              S+Y++GL+KLIC MV  L+ N KF+ ++S+C FELQTLLM W
Sbjct: 890  --------------SENVSLYAIGLVKLICFMVKTLMNNDKFDFSKSECTFELQTLLMNW 935

Query: 988  ISILPEAKELSFKINSSLSEFSHVENSELASIEGASTKSHKQLVDKN-SESYKYNEILLK 1046
            I I+PEA+EL F + +++ E          S+EG   KS     D N  E   YN  LL 
Sbjct: 936  IGIIPEAQELFFTLKANVGE---------PSMEG---KSDSDGTDSNEGELSWYNSKLLA 983

Query: 1047 LIPPTFGGKEENIIFNTFRDYIKDYSFDSEVSTMCRKIIHQSDEILPLQDSEKPFSFHDY 1106
            L+P       EN    T R ++K YSF ++V  + RK+I++ D+ILP+    +P    + 
Sbjct: 984  LLPSPTNSGLENPAIETLRSFLKKYSFTNKVPVVGRKVIYKDDKILPIPKLYQPILLREL 1043

Query: 1107 LTE 1109
            + E
Sbjct: 1044 IDE 1046

>YGR134W Chr7 (757770..761138) [3369 bp, 1122 aa] {ON}  CAF130Part of
            the evolutionarily-conserved CCR4-NOT transcriptional
            regulatory complex involved in controlling mRNA
            initiation, elongation, and degradation
          Length = 1122

 Score =  716 bits (1849), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 438/1130 (38%), Positives = 638/1130 (56%), Gaps = 100/1130 (8%)

Query: 20   NYKPSIYQLEQLLRDENQVLDLLADIEVKGSFITEVTVIALFTTRPGISLLNCLTDNFGI 79
            NY PS+  LE++L +E     +  D ++  + + E  +I LFTT  G S L  +  +   
Sbjct: 42   NYVPSVENLEKILYNET----MFNDQKICSNLLLEALIITLFTTISGKSALRLIQTSSLK 97

Query: 80   DEDN--KDFNPNSLLPRMPQLALKWMHDELILIKFLRFIIDNRNMDINFKNKNDILSKLQ 137
            +  +  + F  NS       + L W  ++++L+KFLRF++ N+   +     N    KL 
Sbjct: 98   ERKSWAQSFENNS--SSYASIVLSWKDNDILLLKFLRFLLANKTAPLQINRYNLPEYKLP 155

Query: 138  LDFLIKNETSDFISLNLLTNEVDVVREYLTAIWPKLKNIIKISLNGENEYIDCEDSFFVR 197
            L FLI ++ +  I   LL    +++++YL +I  +++++I  S   +      + +  VR
Sbjct: 156  LSFLIVSKIT--IPSILLNETYNLLKDYLYSITGRIESLISCSSTFD------KPALVVR 207

Query: 198  TILS-YKRLYETLLHFEFYDYSSMKTNGSDIYVKALMKHLTGLSNFSFQLFKLSGYFYNT 256
             IL  Y R+ E    + +Y +++               +LT   N S  +    G   + 
Sbjct: 208  KILKDYNRMIECRNFYFWYSFNAENR-----------VNLTFSDNISLLMENDEGNAGSG 256

Query: 257  IDNQSYNPSKFGFIPLSVDPDD---GEVEENQE---TDNILQPSLLDFPDLMNETAKRHL 310
            +D+  ++  K         P +   G    +QE   +  + Q   L+ P++M  +  RH 
Sbjct: 257  LDDSRFDHQK--------QPREAIMGRTINDQEQIYSFELNQDGTLEIPNVMEHSLLRHE 308

Query: 311  ALSKLIIDSKLEKQISNSPLLQIQYKTLLALIDPLTQPVPNDTHVISIDLLCNMFLGLMK 370
             L K+     L      +PLL++Q+ TL  L+DPL QP PND H+ISID L  +FLGLM 
Sbjct: 309  LLFKI-----LNLTTVLTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFQLFLGLMS 363

Query: 371  PYIDNQLNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERLGTV---DESKDWRSQLHL 427
              I     ++D  DW+F++CFNMQ+II A++  LNC DF+ L +V   D +  W++QLH 
Sbjct: 364  QSIKTSQEHNDHYDWKFYMCFNMQKIIDATMLRLNCFDFDILNSVNNTDNAVHWKTQLHR 423

Query: 428  WLPRGLNTQNLELVYMSCILAVYTIYKLYSDSPVHFNPFLSSLISLWKSLTCVVLYGLQI 487
            WLP GLNTQ+LEL+YM  ILAVYTIYKLY   P+  NPFL SLISLWK+L+CV+L  L+I
Sbjct: 424  WLPHGLNTQDLELLYMIDILAVYTIYKLYEKIPIQLNPFLFSLISLWKNLSCVILLALEI 483

Query: 488  DRLEESNQSFDTPIIVRATIRGAAALRSIVATVLNEQMELKRHDFIHESLNTFMSPHGRK 547
            DR+EE N +++TP++VRATIRGAAALRS++ATVLN  ++   HDF HESLNTFMSP+GRK
Sbjct: 484  DRIEEENGTYETPLMVRATIRGAAALRSVIATVLNGLVKNNDHDFKHESLNTFMSPYGRK 543

Query: 548  LCDGALYADLKAYTASILALGAEFQEVTDLVSYLQAGDQFDEDVKYMFX----------X 597
            LC GALYADL+++TAS+LALGA  ++VTDL + LQ+GD+FDED++YMF            
Sbjct: 544  LCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIRYMFDYECEDYDESFS 603

Query: 598  XXXXXXXXXXXXXXXXXXXXXXXYAFNKRRCNCIFXXXXXXXXXXXXXXXXXXXXXXXID 657
                                     F +RRCNCIF                         
Sbjct: 604  ESDHGGLDESVVNPTEKIASGSNNVFFRRRCNCIFNDDKLVAEDGANEAFGSTNSENVEG 663

Query: 658  GEIATKSKEHTEKTIESDSGLSNQLSKPHAVRSKSNFEFDYSGKDWRDIPREYNLYYSPF 717
                 ++  H   T  SD  +++    P +VRS+S FEFDYSG+DWRD+PR++N+YYSP 
Sbjct: 664  AMHNNRNAVHNATTATSDHVVTS--PNPLSVRSRSTFEFDYSGEDWRDVPRDFNMYYSPS 721

Query: 718  YNFIDRPDLNTVFVLTLKATSXXXXXXXXXXXXCSVASTVKNEQDRMIFGNL-------- 769
            Y+FI  P L+ +F LTL+  +             SVAS V+NEQD+MI  +L        
Sbjct: 722  YSFIHEPKLDVIFSLTLRGATEKLNKEESILLVRSVASCVRNEQDQMILADLESNFSASI 781

Query: 770  -----LEQDKSSTADEHEDTKKEATPDDIYEIWCEESAFERILHFNPDLAWKLMDEMLMC 824
                  E +   +  ++ED ++  TPDDIYEIW EESAFER+L+ N D+AW+LMDEMLMC
Sbjct: 782  NGDVEGEGNTKMSKIDNEDLRR-TTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMC 840

Query: 825  SGYRRVLIWFITHMELSHSLIIYIFDLMMGSRG------INKTDTSKNVKSTFITENISD 878
            +GYRR+LIWF+TH+EL HSLI Y+F+L+MG RG       +  D   ++    + +   +
Sbjct: 841  TGYRRILIWFLTHLELKHSLIYYVFELIMGLRGKPFSGEASDQDKKDDMIYEILKKKQKN 900

Query: 879  SNSNSLKFSRMGHLKLSELETRMILQELFTNAAIYFSDKARKSNQSILTPDYSTXXXXXX 938
             +++ L FSR G + LS++ET+M+LQE F NAAI+ S K  +                  
Sbjct: 901  EDASGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSKNNEEENE-------------- 946

Query: 939  XXXXGGYSIYSVGLMKLICIMVSKLIENSKFNVNESDCVFELQTLLMGWISILPEAKELS 998
                   S+YS+GL++LIC MV  LI N KF   +S+C FELQTLLM WI ILPEAK+L 
Sbjct: 947  --DGEKISLYSLGLVRLICYMVQTLIANDKFFFTKSECTFELQTLLMTWIGILPEAKDLF 1004

Query: 999  FKINSSLSEFSHVENSELASIEGASTKSHKQLVDKNSESYKYNEILLKLIPPTFGGKEEN 1058
            FKI + L+     ++++    EG      ++ ++    S + N  LL L P     K+++
Sbjct: 1005 FKIKTRLA-MEEEDSADTMQHEGRKNSDIEKKLNAKPAS-ELNLKLLNLFPSKPANKDDS 1062

Query: 1059 IIFNTFRDYIKDYSFDSEVSTMCRKIIHQSDEILPLQDSEKPFSFHDYLT 1108
               NT R +I DYSFD++V+   R+++    +ILPL  ++KP   H+Y+T
Sbjct: 1063 SPINTLRSFIADYSFDTQVNPPGRRVVFYDGKILPLPKADKPIPLHEYIT 1112

>Smik_6.230 Chr6 (375653..379027) [3375 bp, 1124 aa] {ON} YGR134W
            (REAL)
          Length = 1124

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/1129 (39%), Positives = 639/1129 (56%), Gaps = 96/1129 (8%)

Query: 20   NYKPSIYQLEQLLRDENQVLDLLADIEVKGSFITEVTVIALFTTRPGISLLNCLTDNFGI 79
            NY PS+  LE++L DE     +L D +V+ S + E   I LFTT  G S+L  +   F  
Sbjct: 42   NYVPSVENLEKVLCDET----MLNDQKVRFSLLFEALAITLFTTNSGKSILQSI-QTFTS 96

Query: 80   DEDN---KDFNPNSLLPRMPQLALKWMHDELILIKFLRFIIDNRNMDINFKNKNDILSKL 136
             +     + F  N+       +   W  ++++L+KF+RF++ N+ M +     N    KL
Sbjct: 97   KKRKLWAQSFENNN--SNYASIVFSWKDNDILLLKFVRFLLANKTMPLKIDRYNLPEHKL 154

Query: 137  QLDFLIKNETSDFISLNLLTNEVDVVREYLTAIWPKLKNIIKISLNGENEYIDCEDSFFV 196
             L FLI ++ +  I   LL    +++++YL +I  +++ ++  S       +  +     
Sbjct: 155  PLSFLIVSKIN--IPSILLNEGYNLLKDYLYSITGRIEELLMCSPKFNQPALVVK----- 207

Query: 197  RTILSYKRLYETLLHFEFYDYSSMKTNGSDIYVKALMKHLTGLSNFSFQLFKLSGYFYNT 256
            RT+  Y R+ E    + +Y +++   N + +     +  L G  N +      +G   + 
Sbjct: 208  RTLKDYDRMIECENCYCWYYFNA--ENSAHLKFDDNIACLMGSENNT-----ENGLGDSR 260

Query: 257  IDNQSYNPSKFGFIPLSVDPDDGEVEENQETDNILQPSLLDFPDLMNETAKRHLALSKLI 316
            ++N +Y+      + +S   +D E   + E +       L+ P++M  +  RH  L K+ 
Sbjct: 261  VNNNNYHKQPKDVV-MSRTINDQEQIYSFELN---HDGTLEIPNVMKHSLLRHELLFKI- 315

Query: 317  IDSKLEKQISNSPLLQIQYKTLLALIDPLTQPVPNDTHVISIDLLCNMFLGLMKPYIDNQ 376
                L     ++PLL++Q+ TL  L+DPL QP PND H+ISID L  +FLGLM P I + 
Sbjct: 316  ----LNLTPVSTPLLELQFSTLCGLVDPLMQPTPNDKHIISIDFLFKLFLGLMYPAIKSS 371

Query: 377  LNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERLGTV---DESKDWRSQLHLWLPRGL 433
              ++D  DW+F+ CFNMQ+II A++  LNC DF  L +V   D S  WR+QLH WLP GL
Sbjct: 372  QGHNDHYDWKFYTCFNMQKIIDATMSRLNCFDFNILNSVNNTDSSVHWRTQLHRWLPHGL 431

Query: 434  NTQNLELVYMSCILAVYTIYKLYSDSPVHFNPFLSSLISLWKSLTCVVLYGLQIDRLEES 493
            NTQ+LEL+YM  ILAVYTIYKLY   P+  NPFL SLISLWK+L+CV+L  L+IDR+EE 
Sbjct: 432  NTQDLELLYMIDILAVYTIYKLYEKLPIQLNPFLFSLISLWKNLSCVILLALEIDRIEEE 491

Query: 494  NQSFDTPIIVRATIRGAAALRSIVATVLNEQMELKRHDFIHESLNTFMSPHGRKLCDGAL 553
            N +++TP++VRATIRGAAALRS++AT+LN  ++   HDF HESLNTFMSP+GRKL  GAL
Sbjct: 492  NGTYETPLMVRATIRGAAALRSVIATILNGLVKTNEHDFKHESLNTFMSPYGRKLSHGAL 551

Query: 554  YADLKAYTASILALGAEFQEVTDLVSYLQAGDQFDEDVKYM-----------FXXXXXXX 602
            YADL++++AS+LA G   ++VTDL + LQ+GD+FDED++YM           F       
Sbjct: 552  YADLRSHSASLLAFGTSIEDVTDLFADLQSGDRFDEDIRYMFDYECADYDESFSESDDEG 611

Query: 603  XXXXXXXXXXXXXXXXXXYAFNKRRCNCIFXXXXXXXXXXXXXXXXXXXXXXXIDGEIAT 662
                                F +RRCNCIF                        +GE   
Sbjct: 612  LEEGIVNAREKIKSSNDNNVFCQRRCNCIFNDDKLVAEDGLNEVFESTCNR---NGE--R 666

Query: 663  KSKEHTEKTIESDSGLSNQLS---KPHAVRSKSNFEFDYSGKDWRDIPREYNLYYSPFYN 719
            + + + +    +    SN +S    P +VR++S FEFDYSG+DWRD+PR++N+YYSP Y 
Sbjct: 667  RVRNNIDVVSNTAITTSNHVSTSINPFSVRARSTFEFDYSGEDWRDVPRDFNMYYSPSYP 726

Query: 720  FIDRPDLNTVFVLTLKATSXXXXXXXXXXXXCSVASTVKNEQDRMIFGNLL--------- 770
            FI  P L+ +F LTL+  +             SVAS VKNEQD+M+  +L          
Sbjct: 727  FIHDPKLDVIFNLTLRGATEKLNREESILLVRSVASCVKNEQDQMVLADLKTNLTGISKH 786

Query: 771  EQDKSSTADEHEDTK--KEATPDDIYEIWCEESAFERILHFNPDLAWKLMDEMLMCSGYR 828
             + ++ST+    D +  +  TPDDIYEIW EESAFER+L+ N D+AW+LMDEMLMC+GYR
Sbjct: 787  AEGENSTSISKTDNEELRRTTPDDIYEIWSEESAFERMLNVNHDVAWRLMDEMLMCTGYR 846

Query: 829  RVLIWFITHMELSHSLIIYIFDLMMGSRG--INKTDTSKNVKSTFITENISDSNSN---- 882
            R+LIWF TH+EL HSLI Y+F+L+MG RG   +   + ++ K   I E +     N    
Sbjct: 847  RILIWFFTHLELKHSLIYYVFELIMGLRGKAFSGKASDQDKKDDMIYEILKKKQKNDDAS 906

Query: 883  SLKFSRMGHLKLSELETRMILQELFTNAAIYFSDKARKSNQSILTPDYSTXXXXXXXXXX 942
            SL FSR G + LS++ET+M+LQE F NAAI+ S    +                      
Sbjct: 907  SLPFSRQGPIILSDIETKMLLQEFFMNAAIFLSSNNSEEENE----------------DG 950

Query: 943  GGYSIYSVGLMKLICIMVSKLIENSKFNVNESDCVFELQTLLMGWISILPEAKELSFKIN 1002
               S+YS+GL++LIC MV  LI N KF   +S+C FELQTLLM WI ILPEAK+L F+I 
Sbjct: 951  EKISLYSLGLVRLICYMVQTLITNDKFFFTKSECTFELQTLLMTWIGILPEAKDLFFEIK 1010

Query: 1003 SSLSEFSHVENSELASIEGASTKS---HKQLVDKNSESYKYNEILLKLIPPTFGGKEENI 1059
            + L   +  E+++  +++    +S    K+L  K   + K N  LL L P       EN 
Sbjct: 1011 TRL---AMEEDNDTGTMQHEGRRSLDIEKKLNTK--PASKLNLKLLSLFPSNSADNGENS 1065

Query: 1060 IFNTFRDYIKDYSFDSEVSTMCRKIIHQSDEILPLQDSEKPFSFHDYLT 1108
              NT R++I DYSFD++V+   RK++    +ILPL  ++KP   H+Y+T
Sbjct: 1066 AINTLRNFITDYSFDTQVNPPGRKVVFYDGKILPLTKADKPIPLHEYIT 1114

>Skud_7.445 Chr7 (736960..740331) [3372 bp, 1123 aa] {ON} YGR134W
            (REAL)
          Length = 1123

 Score =  707 bits (1825), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 448/1155 (38%), Positives = 639/1155 (55%), Gaps = 149/1155 (12%)

Query: 20   NYKPSIYQLEQLLRDENQVLDLLADIEVKGSFITEVTVIALFTTRPGISLLNCLTDNF-- 77
            NY PS+  LE+LL +E+    +L D +++ S + E   I LFTT+ G S+L  +  +   
Sbjct: 42   NYVPSLENLEKLLYNES----ILDDQKIRLSILFEALSIILFTTKSGKSILQAVQASTLK 97

Query: 78   -------GIDEDNKDFNPNSLLPRMPQLALKWMHDELILIKFLRFIIDNRNMDINFKNKN 130
                    + +D+ ++           +   W  ++++ +KFLRF++ N+   +     N
Sbjct: 98   EKKLWAQSLRDDDSNY---------ASVVQGWKDNDVLFLKFLRFLLANKTTSLQIDKYN 148

Query: 131  DILSKLQLDFLIKNETSDFISLNLLTNEVDVVREYLTAIWPKLKNIIKISLNGENEYIDC 190
                KL L FLI ++  +F S+ +L    +++++YL ++  ++  +I+         I  
Sbjct: 149  LPEYKLPLSFLIVSKI-NFPSI-ILNEGHNMLKDYLYSMSGRIDCLIR------GNSITS 200

Query: 191  EDSFFVRTILS-YKRLYETLLHFEFYDYSSMKTNGS--------DIYVKALMKHLTGLSN 241
              +  V+ IL  Y R+ E   H  ++ YS    N          D+ + +   H  G   
Sbjct: 201  RSALVVKKILKDYDRIVE--FHNLYFWYSFNVENDVNFEFSDNFDLLMNSPEDHADG--- 255

Query: 242  FSFQLFKLSGYFYNTIDN--QSYNPSKFG---FIPLSVDPDDGEVEENQETDNILQPSLL 296
                           ID+  +S NP K      I  ++  +D E   + E D   Q   L
Sbjct: 256  -------------GVIDDRCKSDNPQKHAKNTIIKRTI--NDQEQIYSFELD---QDGTL 297

Query: 297  DFPDLMNETAKRHLALSKLI-IDSKLEKQISNSPLLQIQYKTLLALIDPLTQPVPNDTHV 355
              P++M  +  RH  L K++ + S L      +PLL++Q+  L  L+DPL QP PND  V
Sbjct: 298  QIPNIMEHSLMRHELLFKILNLPSVL------TPLLELQFCNLCGLVDPLMQPSPNDEQV 351

Query: 356  ISIDLLCNMFLGLMKPYIDNQLNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERLGTV 415
            ISID L  +FLGLM P I +   ++D  DW+F+ CFNMQ+II A++  LNC+DFERL +V
Sbjct: 352  ISIDFLFQLFLGLMYPSIKSSQEHNDHYDWKFYTCFNMQKIIDATMLRLNCSDFERLNSV 411

Query: 416  DESKD---WRSQLHLWLPRGLNTQNLELVYMSCILAVYTIYKLYSDSPVHFNPFLSSLIS 472
            + +     WR+QLH WLP GLNTQ+LEL+YM  ILA+YTIYKLY   P+  NPFL SL+S
Sbjct: 412  NNTDSVIHWRTQLHKWLPHGLNTQDLELLYMIDILAIYTIYKLYEKIPIQLNPFLFSLLS 471

Query: 473  LWKSLTCVVLYGLQIDRLEESNQSFDTPIIVRATIRGAAALRSIVATVLNEQMELKRHDF 532
            LWK+L+CV+L  L+IDR+EE N +++TP++VRATIRGAAALRS++A+VLN  ++   HDF
Sbjct: 472  LWKNLSCVILLALEIDRIEEENGTYETPLMVRATIRGAAALRSVIASVLNGLVKSNDHDF 531

Query: 533  IHESLNTFMSPHGRKLCDGALYADLKAYTASILALGAEFQEVTDLVSYLQAGDQFDEDVK 592
             HESLNTFMSP+GRKLC GALYADL+++TAS+LALGA  ++VTDL + LQ+GD+FDED++
Sbjct: 532  KHESLNTFMSPYGRKLCHGALYADLRSHTASLLALGASIEDVTDLFADLQSGDRFDEDIR 591

Query: 593  YMFXX---------XXXXXXXXXXXXXXXXXXXXXXXYAFNKRRCNCIFXXXXXXXXXXX 643
            YMF                                    F +RRCNCIF           
Sbjct: 592  YMFDYECEDYNEPFSESDDEQLNEDANSRGKIKSSSSNGFYQRRCNCIFNDDKLVAEDGT 651

Query: 644  XXXXXXXXXXXXIDGEIATKSKEHTE---------KTIESDSGLSNQLSKPHAVRSKSNF 694
                           EI+  S    E          T  ++S        P +VRS+S F
Sbjct: 652  NEAF-----------EISGNSNMENEMPNNVNVIPSTATTNSNRFASSINPLSVRSRSTF 700

Query: 695  EFDYSGKDWRDIPREYNLYYSPFYNFIDRPDLNTVFVLTLKATSXXXXXXXXXXXXCSVA 754
            EFDYSG+DWRD+P+++N+YYSP Y+FI  P L+ +F LTL+  +            CSVA
Sbjct: 701  EFDYSGEDWRDVPKDFNMYYSPSYSFIQEPKLDVIFNLTLRGATEKLNRDDSIVLVCSVA 760

Query: 755  STVKNEQDRMIF----GNLLEQDKSSTADEHEDTKK-------EATPDDIYEIWCEESAF 803
            S VKNEQD+MI      N  E D++  A    +  K         TPDDIYEIW EESAF
Sbjct: 761  SCVKNEQDQMILSDLGSNFAEIDENPEAKSSNNITKTNNEELRRTTPDDIYEIWSEESAF 820

Query: 804  ERILHFNPDLAWKLMDEMLMCSGYRRVLIWFITHMELSHSLIIYIFDLMMGSRG--INKT 861
            ER+L+ N D+AW+LMDEMLMC+GYRR+LIWF+TH+EL HSLI Y+F+L+MG RG   +  
Sbjct: 821  ERMLNVNHDVAWRLMDEMLMCTGYRRILIWFLTHLELKHSLIYYVFELVMGLRGKPFSGE 880

Query: 862  DTSKNVKSTFITENISDSNSN----SLKFSRMGHLKLSELETRMILQELFTNAAIYFSDK 917
             + ++ K   I E +     N     L FSR G + LS++ET+M+LQE F NAAI+ S K
Sbjct: 881  ASDQDRKDDMIYEILKKKRKNEDVSGLPFSRQGPIVLSDIETKMLLQEFFMNAAIFLSSK 940

Query: 918  ARKSNQSILTPDYSTXXXXXXXXXXGGYSIYSVGLMKLICIMVSKLIENSKFNVNESDCV 977
              +                         S+YS+GL+KLIC MV  LI N KF   +S+C 
Sbjct: 941  NDEEENEDGE----------------KISLYSLGLVKLICYMVQTLIANDKFLFTKSECT 984

Query: 978  FELQTLLMGWISILPEAKELSFKINSSLSEFSHVENSELASIEGASTKSHKQL-VDKNSE 1036
            FELQTLLM WI +LPEAK+L F+I + L+        E +  +G     +K L V++   
Sbjct: 985  FELQTLLMTWIGVLPEAKDLFFQIKTRLAM------EEDSDKDGQQNDDNKDLEVERRPH 1038

Query: 1037 SYKYNEI---LLKLIPPTFGGKEENIIFNTFRDYIKDYSFDSEVSTMCRKIIHQSDEILP 1093
            +   +E+   LL L P    G  +N   +T R +I DY FD++++   RK++    +ILP
Sbjct: 1039 TKSNSELNVKLLNLFPSNPAGNNDNSAISTLRSFITDYPFDTQITPPGRKVVFYDGKILP 1098

Query: 1094 LQDSEKPFSFHDYLT 1108
            L  ++KP   H+Y+T
Sbjct: 1099 LSKADKPIPLHEYIT 1113

>NCAS0E00770 Chr5 complement(141832..145284) [3453 bp, 1150 aa] {ON}
            Anc_3.497
          Length = 1150

 Score =  701 bits (1809), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/856 (44%), Positives = 528/856 (61%), Gaps = 60/856 (7%)

Query: 300  DLMNETAKRHLALSKLIIDSKLEKQISNSPLLQIQYKTLLALIDPLTQPVPNDTHVISID 359
            ++++ TAKRH  L++LI ++ L+     +PLL +Q+  +  L+DPL+QP PN+  VIS+ 
Sbjct: 292  NVVSHTAKRHRVLNQLINNNDLK----TTPLLTLQFTFMAGLVDPLSQPPPNNKQVISLH 347

Query: 360  LLCNMFLGLMKPYIDNQLNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERL------- 412
            LL +MF+GLM P +    N +DG +W+FHICFNM ++I  S+ +L C++F +L       
Sbjct: 348  LLYSMFIGLMYPNLKECFNANDGFNWKFHICFNMVKLINNSMVILKCDNFNKLNDIINSN 407

Query: 413  -----GTVDESKD-WRSQLHLWLPRGLNTQNLELVYMSCILAVYTIYKLYSDSPVHFNPF 466
                 GT ++  D W+ +L+ W+P G+NTQ+LEL+YM  I+AVYTIY+LYSD P+  NPF
Sbjct: 408  NDNDEGTENDDDDAWKLKLNEWIPHGINTQDLELIYMINIMAVYTIYQLYSDLPIQMNPF 467

Query: 467  LSSLISLWKSLTCVVLYGLQIDRLEESNQSFDTPIIVRATIRGAAALRSIVATVLNEQME 526
            LS LI+LWK+L+ ++L GL IDR EE+ ++F TP++VRATIRGAA+LR++VAT+LN  ++
Sbjct: 468  LSCLITLWKNLSAIILLGLDIDRSEEARKTFSTPLLVRATIRGAASLRAVVATILNNHVD 527

Query: 527  LKRHDFIHESLNTFMSPHGRKLCDGALYADLKAYTASILALGAEFQEVTDLVSYLQAGDQ 586
            +  HDF HE LNTFMSPHGRKLC GALYAD++++ A+ILALGAE ++VTDL++ LQAGD+
Sbjct: 528  VNEHDFKHEPLNTFMSPHGRKLCQGALYADIRSHAAAILALGAELEDVTDLLTDLQAGDR 587

Query: 587  FDEDVKYMFXXXXXXXXXXXXXXXXXXXXXXXXXYAFNKRRCNCIFXXXXXXXXXXXXXX 646
            FDED++YMF                         +    RRCNCIF              
Sbjct: 588  FDEDIRYMFDYEYDDYNDFKDDVEEQEEMEIMGSFP---RRCNCIFEDDNIINDDTDNIN 644

Query: 647  XXXXXXXXX----IDGEIATKSKEHTEKTIESDSGLSNQLSKPHAVRSKSNFEFDYSGKD 702
                         +D  I   +K+     +     +  + S P++ RSKS+FEFDY GKD
Sbjct: 645  ENDEDDDDEQEEYVDA-IEGVTKDTPHNNLNPHDAIRTRNSHPNSKRSKSSFEFDYGGKD 703

Query: 703  WRDIPREYNLYYSPFYNFIDRPDLNTVFVLTLKATSXXXXXXXXXXXXCSVASTVKNEQD 762
            WRDIPR +NLYYSP Y+FI  P + T+  LT KAT+             +VAS +K EQD
Sbjct: 704  WRDIPRGFNLYYSPSYHFIKSPMMETISTLTSKATNEKLTTEDSTLLITAVASCIKLEQD 763

Query: 763  RMIFGNLLEQD--KSSTADEHEDTK--KEATPDDIYEIWCEESAFERILHFNPDLAWKLM 818
            +MI   LL+ +  K   A E+ED    K ATPDDIY++W EES FER+L+ N D+AW+LM
Sbjct: 764  KMISKELLKHNTVKHPHAAENEDDADFKIATPDDIYDMWSEESKFERMLYLNQDVAWRLM 823

Query: 819  DEMLMCSGYRRVLIWFITHMELSHSLIIYIFDLMMGSRGI------NKTDTSKNVKSTFI 872
            DEMLMC+GYRRVLIWFITHMEL+HSLI YIF+L+MG RG       ++TD+  ++    +
Sbjct: 824  DEMLMCNGYRRVLIWFITHMELNHSLIQYIFELVMGLRGSPFSGEGDETDSKNDLLHEIM 883

Query: 873  TENISD----SNSNSLKFSRMGHLKLSELETRMILQELFTNAAIYFSDKARKSNQSILTP 928
               + +    ++   L FSR G L LSE+E +M+LQE FTNAAIYFS K+  +N+     
Sbjct: 884  YGQVKNKEIVTSLTYLPFSRQGPLILSEIENKMLLQEFFTNAAIYFSSKS--NNEGTTNN 941

Query: 929  DYSTXXXXXXXXXXGGYSIYSVGLMKLICIMVSKLIENSKFNVNESDCVFELQTLLMGWI 988
            D               +S+YS GL+KLIC MV  L+EN+KF+  +S+C FELQTLLM WI
Sbjct: 942  DNGEGIDEEAV----NFSVYSTGLVKLICFMVQSLMENNKFDFAKSECTFELQTLLMNWI 997

Query: 989  SILPEAKELSFKINSSLSEFS-------------HVENSELA--SIEGASTKSHKQLVDK 1033
             I+PEA++L F + S +S  S             H +N   +     G    S     D 
Sbjct: 998  GIIPEAEDLFFTLKSGVSSSSTKTGRESDDHDNTHADNLSFSDDGDTGHPGISRFDTDDS 1057

Query: 1034 NSESYKYNEILLKLIPPTFGGKEENIIFNTFRDYIKDYSFDSEVSTMCRKIIHQSDEILP 1093
                  +N+ L+ L+P     K+EN   +T R +I+ YSFD E     RK+++  + +LP
Sbjct: 1058 PPNESIFNKRLVSLLPKRINDKDENAAVSTLRHFIERYSFDEEAPVYGRKVVYSDEIVLP 1117

Query: 1094 LQDSEKPFSFHDYLTE 1109
            L  +++P SFH+YLTE
Sbjct: 1118 LPAADQPISFHEYLTE 1133

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 54/191 (28%), Positives = 98/191 (51%), Gaps = 13/191 (6%)

Query: 1   MAKVAHVSKLKRIAEILSPNYKPSIYQLEQLLRDENQVLDLLADIEVKGSFITEVTVIAL 60
           MA++   + L+ +      NY+PS+ QL  LL D+  +L+ L  I+ + S + E  +I  
Sbjct: 25  MAQLVTYTPLREL--FAERNYQPSLSQLLNLLSDD-ALLNNLTPIQ-EHSLLVECVIIGF 80

Query: 61  FTTRPGISLLNCL------TDNFGIDEDNKDFNPNSLLPRMPQ-LALKWMHDELILIKFL 113
            +TR G  L + L       D F  ++  K      +     Q L  KW  ++L  +KF 
Sbjct: 81  LSTRSGKLLQSALFNDKHQQDTFLENQYKKWLTSTDISKTAHQYLRKKWSSNKLYFLKFT 140

Query: 114 RFIIDNRNMDINFKNKNDILSKLQLDFLIKNETSDFISLNLLTNEVDVVREYLTAIWPKL 173
           +F++ N + +IN     + + KL L+FL  + T + +   +L N+ +++++Y+ A  P L
Sbjct: 141 KFLLVNADGNINVDKYTEPIYKLPLNFLFDDNT-NLMPTFILDNKYNLLQDYIYACGPLL 199

Query: 174 KNIIKISL-NG 183
           K ++K +L NG
Sbjct: 200 KCVMKDTLENG 210

>SAKL0F02596g Chr6 complement(221983..225381) [3399 bp, 1132 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily-conserved CCR4-
            NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1132

 Score =  640 bits (1651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/1116 (36%), Positives = 600/1116 (53%), Gaps = 94/1116 (8%)

Query: 46   EVKGSFITEVTVIALFTTRPGISLLNCLTD-NFG-IDEDNKDFNPNSLLPRM---PQLAL 100
            E   + + E+ +++LF T PG S+L    D + G +D  +     +S +       +L  
Sbjct: 43   EFPDAVVQEMLILSLFVTLPGHSILELYYDLSCGRVDLSSYKQWQHSQVRSTDGYKKLVK 102

Query: 101  KWMHDELILIKFLRFIIDNRNMDINFKNKNDILSKLQLDFLIKNETSDFISLNLLTNEVD 160
            +W    L+L++F   ++ N+N+ + +   N    KL L FL+ ++ ++F+ L+   N + 
Sbjct: 103  RWSTSTLVLLRFTDLLLQNKNVPLEYTKHNTAEYKLSLIFLL-DKQNEFLILDPDYNLLL 161

Query: 161  VVREYLTAIWPKLKNIIKISLNGENEYIDCEDSFFVRTILSYKRLYETLLHFEFYDYSSM 220
                +     P +++I+  ++ G               +  Y +L E      +Y + + 
Sbjct: 162  DYLLHAK---PMIESILLGNIPG----------LLKALVYQYNKLPEFNGCHTWYTFRTH 208

Query: 221  KTNGSDIYVKALMKHLTGLSNFSFQLFKLSGYFYN---TIDNQSYNPSKFGFIPLSVDPD 277
                 +I+ K  +      +     + +L G+F     + D+    P        S   D
Sbjct: 209  YHGTQEIFHKFFIALTDKFTASKEIMPELEGWFVEGPVSRDSGCIKPITGDDYTSSAAID 268

Query: 278  D----------GEVEENQETDNILQPSLLDFPDLMNETAKRHLALSKLIIDSKLEKQISN 327
            D             +E   +  + +   L+ P++   T +RH AL K+     L      
Sbjct: 269  DFNEDYWTQQKTNTQEQVYSFELNEDGTLEIPNVFAHTKRRHDALYKV-----LGLNDDP 323

Query: 328  SPLLQIQYKTLLALIDPLTQPVPNDTHVISIDLLCNMFLGLMKPYIDNQLNNDDGVD-WR 386
            +PLL+  + T   L DP+TQP PND H++S+DLL +MFLGLM P I   L      D W 
Sbjct: 324  TPLLKSCFLTFCCLADPVTQPPPNDKHIVSLDLLSDMFLGLMYPEITADLVQPLNKDTWT 383

Query: 387  FHICFNMQQIIIASLFVLNCNDFERLGTV---DESKDWRSQLHLWLPRGLNTQNLELVYM 443
             HICFN+Q+II A+L  LNC+DF RL  +   D+S DWR  L+ WLP+GLNTQ+LEL+YM
Sbjct: 384  LHICFNLQKIINATLSRLNCDDFTRLNEINNSDDSVDWRKNLYKWLPQGLNTQDLELIYM 443

Query: 444  SCILAVYTIYKLYSDSPVHFNPFLSSLISLWKSLTCVVLYGLQIDRLEESNQSFDTPIIV 503
              ILA YTIYKLYS+ P+  NPFL  +ISLWK+LTCVVL GL+IDRLEE  ++F+TP++V
Sbjct: 444  VDILATYTIYKLYSNRPIQMNPFLLPMISLWKNLTCVVLLGLEIDRLEEEQETFNTPVMV 503

Query: 504  RATIRGAAALRSIVATVLNEQMELKRHDFIHESLNTFMSPHGRKLCDGALYADLKAYTAS 563
            RATIRGA+ALRS++AT++N     K HDF HE +N FMSPHGRKLC+GALYADL+++ A+
Sbjct: 504  RATIRGASALRSVLATIINGHARYKSHDFKHEPINLFMSPHGRKLCNGALYADLRSHAAT 563

Query: 564  ILALGAEFQEVTDLVSYLQAGDQFDEDVKYMFXXXXXXXXXXXXXXXXXXXXXXXXXYAF 623
            +LALG E + +TDL+S LQ GD+FDEDVKYMF                            
Sbjct: 564  MLALGIELETLTDLLSDLQPGDRFDEDVKYMFDYEFDDYNEVDTELMADDELEDIESRER 623

Query: 624  NK------RRCNCIFXXXXXXXXXXXXXXXXXXXXXXXIDGEIATKSKEHTEKTIE---- 673
             K      +RC+C+F                               +K+H + + E    
Sbjct: 624  IKEVRGYYKRCHCVFDDDSLVPENEDGGGEEG----------DQEDTKKHLQDSHEDQLP 673

Query: 674  -SDSGLSNQLSKPHAVRSKSNFEFDYSGKDWRDIPREYNLYYSPFYNFIDRPDLNTVFVL 732
               + + +  SKP AVRS+   EFD++G+DWRDIPR  N YY+  Y F+ +   + V  L
Sbjct: 674  PQQNVVMSTTSKPLAVRSRDTVEFDFNGRDWRDIPRGLNFYYTDAYIFVTKLHADVVHYL 733

Query: 733  TLKATSXXXXXXXXXXXXCSVASTVKNEQDRMIFGNLL---EQDKSSTADEHEDTKKEAT 789
              +AT              S+A+ VK EQ+  I    L   + DKSS A   + T+ E T
Sbjct: 734  MKEATRKKLERNHASFILRSIATCVKLEQEEAIVRRALGNQDGDKSSNATTIK-TENELT 792

Query: 790  PDDIYEIWCEESAFERILHFNPDLAWKLMDEMLMCSGYRRVLIWFITHMELSHSLIIYIF 849
             D IYE WCE+S FE++++ N DL W++MDEMLMCSGYRRVLIWFITH+E++HS+I YIF
Sbjct: 793  SDFIYEKWCEDSLFEKMMYHNSDLVWRMMDEMLMCSGYRRVLIWFITHLEINHSVIHYIF 852

Query: 850  DLMMGSRG-INKTDTSKNVKSTFITENISDSNSNS---LKFSRMGHLKLSELETRMILQE 905
            +L+MG RG I   D  +  K+    + ++  +S S   L FSR G + LS +E  M+LQE
Sbjct: 853  ELVMGLRGNITYEDDEEKSKNLDALDGLAQGSSTSELTLPFSRQGPIILSSIEVNMLLQE 912

Query: 906  LFTNAAIYFSDKARKSNQSILTPDYSTXXXXXXXXXXGGYSI--YSVGLMKLICIMVSKL 963
             FTNAAI+FS K R+S       D               +S+  + +GLMKL+C MV  L
Sbjct: 913  FFTNAAIFFSSKLRESF------DSENEELDENFEDEDEFSVPPHVIGLMKLVCFMVDTL 966

Query: 964  IENSKFNVNESDCVFELQTLLMGWISILPEAKELSFKINSSLSEFSH--------VENSE 1015
            ++  KF+  +S+ +FELQTLLM WI I+PEA++L FK+ S +   S         V+ SE
Sbjct: 967  MQKKKFDFTDSEYIFELQTLLMNWIGIVPEARDLFFKLKSQIVATSQDTQEQGTPVKESE 1026

Query: 1016 LASIEGASTKSHKQLVDKNSESYKYNEILLKLIPPTFGGKEENIIFNTFRDYIKDYSFDS 1075
               I+   T      ++ N    ++N+ L+ LIPP  G   E       R +I  YS  +
Sbjct: 1027 KDDIDAPDT------LEMNDTMSEHNKKLMMLIPP--GTTNERNALTALRGFIGKYSLTN 1078

Query: 1076 EVSTMCRKIIHQSDEILPLQDSEKPFSFHDYLTEYG 1111
            + +   RKII+Q DEI+ +  ++K   + ++L E+G
Sbjct: 1079 KTAVFGRKIIYQDDEIMGMYMTDKEMMYREFLAEFG 1114

>KLTH0G02442g Chr7 complement(189819..193160) [3342 bp, 1113 aa] {ON}
            similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134W CAF130 Part of the evolutionarily- conserved
            CCR4- NOT transcriptional regulatory complex involved in
            controlling mRNA initiation elongation and degradation
          Length = 1113

 Score =  621 bits (1602), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/1119 (36%), Positives = 596/1119 (53%), Gaps = 135/1119 (12%)

Query: 54   EVTVIALFTTRPGISLL------NCLTDNFGIDEDNKDFNPNSLLPRMPQLALKWM---- 103
            E  V+ LFTTRPG+S L      +C   N    +  +   P     R+   A K M    
Sbjct: 51   EKLVLGLFTTRPGLSTLRLYYELSCGRVNLLRYKKWQQSKPQ----RVSDAAYKRMVKRW 106

Query: 104  -----HDELILIKFLRFIIDNRNMDINFKNKNDILSKLQLDFLIKNETSDFISLNLLTNE 158
                 H  L++  FLR    N N  +++ +      KL + FL+  ET   +    + +E
Sbjct: 107  TSSTEHVGLLMDHFLR----NDNWALDYASFYSPAHKLSVAFLLDPETEVLV----IDDE 158

Query: 159  VDVVREYLTAIWPKLKNIIKISLNGENEYIDCEDSFFVRTILSYKRLYETLLHFEFYDYS 218
             +++ ++      + + +++  LN     ID   S   +    + RL++    + +Y +S
Sbjct: 159  YNLLLDFAL----QCRALVEQLLNQ----IDLP-SLLAKCAYGHGRLFQLCGRYVWYTFS 209

Query: 219  SMKTN-GSDI---YVKALMKHLTGLSNFSFQLFKLSGYFYNTIDNQSYNPSKFGFIPLSV 274
            + + +   DI   Y+  L   LT   +   Q+  L    +  I +   +   +G    + 
Sbjct: 210  AEQFDEAQDICYKYLSVLTDKLTAQQDLIPQIQPL----FEIISSSKASHWVYGDGLFTE 265

Query: 275  DPDDGEVEENQETDNILQPSL----------------LDFPDLMNETAKRHLALSKLIID 318
            +P   E + N ++D+  Q  L                L+  ++ N T +RH AL +++  
Sbjct: 266  NP---ESDSNSDSDHWPQKRLSAQERVYSFDLKDDGTLEASNVFNRTRRRHQALYQVL-- 320

Query: 319  SKLEKQISNSPLLQIQYKTLLALIDPLTQPVPNDTHVISIDLLCNMFLGLMKPYIDNQLN 378
              L+KQ + +PLL  Q+ TL AL+DP+TQP PND+H++SIDLL +MFLGL+   I N+L+
Sbjct: 321  -NLQKQ-NTAPLLSSQFFTLCALVDPVTQPTPNDSHIVSIDLLSDMFLGLLYSEI-NELH 377

Query: 379  NDDGVDWRFHICFNMQQIIIASLFVLNCNDFERLGTV---DESKDWRSQLHLWLPRGLNT 435
                +DWRFH+CFN+Q+I+ A+L  LNC+DF+RL +V   D+S DWR  LH WLP+GLNT
Sbjct: 378  ----IDWRFHVCFNLQKIVQATLPRLNCHDFQRLNSVNNSDDSIDWRRNLHKWLPQGLNT 433

Query: 436  QNLELVYMSCILAVYTIYKLYSDSPVHFNPFLSSLISLWKSLTCVVLYGLQIDRLEESNQ 495
            Q+LEL+YM  ILA+Y I+KLY D P   NPFL+S+ISLWK+LT VVL GL+IDR EE  +
Sbjct: 434  QDLELIYMIDILAIYIIHKLYRDLPAQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQE 493

Query: 496  SFDTPIIVRATIRGAAALRSIVATVLNEQMELKRHDFIHESLNTFMSPHGRKLCDGALYA 555
            +F TP++VRA IRG++ALRS+VAT+LN  +E KRHDF HE +N FMSPHGRKLC GALY 
Sbjct: 494  TFSTPVLVRAAIRGSSALRSVVATILNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYT 553

Query: 556  DLKAYTASILALGAEFQEVTDLVSYLQAGDQFDEDVKYMF-------XXXXXXXXXXXXX 608
            D++++ A++LALG E ++VT+L+S LQ GD+FDEDVKYMF                    
Sbjct: 554  DVRSHAAAMLALGIELEDVTNLLSDLQPGDRFDEDVKYMFDYEYDNYNEVDTEELDEDEL 613

Query: 609  XXXXXXXXXXXXYAFNKRRCNCIFXXXXXXXXXXXXXXXXXXXXXXXIDGEI-ATKSKEH 667
                         A+ K RC+C F                        DG   A+  +  
Sbjct: 614  EDVESRERIKEMRAYYK-RCHCQFDDDELLPEDEE-------------DGRPDASPYRVT 659

Query: 668  TEKTIESDSGLSNQLSKPHAVRS-KSNFEFDYSGKDWRDIPREYNLYYSPFYNFIDRPDL 726
             +   +++  LSN  SKP A+RS K + EFD++G+DWR IPR  N Y++  Y F      
Sbjct: 660  RDAPPDNNVKLSNT-SKPMALRSQKDSVEFDFNGRDWRGIPRGLNFYFNENYEFEKHLSS 718

Query: 727  NTVFVLTLKATSXXXXXXXXXXXXCSVASTVKNEQDRMIFGNLLEQDKSSTADEHEDTKK 786
                 L   A                +A+ V  EQ+  +  + L   ++  ++ H     
Sbjct: 719  GQAHSLMCNAAEKKLPLEEGTQLLRVIATCVAKEQELTVLRSALLLGETPESENHSTLVA 778

Query: 787  EA--TPDDIYEIWCEESAFERILHFNPDLAWKLMDEMLMCSGYRRVLIWFITHMELSHSL 844
            +   T D +YE WCE S FE+IL  N  L W++MDEMLMCSGYRRVLIWFITH+E+S+S+
Sbjct: 779  DGDLTTDFVYEKWCENSMFEKILFHNETLVWRMMDEMLMCSGYRRVLIWFITHLEVSNSM 838

Query: 845  IIYIFDLMMGSRGINKTDTSKNVKSTFITENISDSNSNSLKFSRMGHLKLSELETRMILQ 904
            I YI+ L++G+RG                +  SD +   + FSR G + LS++E +M+LQ
Sbjct: 839  IEYIYTLVLGNRG---------------EKAASDGDYAKVPFSRQGAIVLSDIEIKMLLQ 883

Query: 905  ELFTNAAIYFSDKARKSNQSILTPDYSTXXXXXXXXXXGGYSIYSVGLMKLICIMVSKLI 964
            E FTNAAI+FS + R+S                      G S + VGLMKL+C MV  L+
Sbjct: 884  EFFTNAAIFFSKQLRESLGDG-----EDDEDQGDDEKGSGISPHVVGLMKLVCYMVKSLM 938

Query: 965  ENSKFNVNESDCVFELQTLLMGWISILPEAKELSFKINSSLSEFSH---VENSELASIEG 1021
            +   F+  + D +FELQTLLM WI ILPEA++L F + S + E S    +E+  +AS   
Sbjct: 939  QKEMFDFKDPDYIFELQTLLMSWICILPEARDLFFALRSLVDEQSQNIKLESESIASACE 998

Query: 1022 ASTKSHKQLVDKNSESYK---------YNEILLKLIPPTFGGKEENIIFNTFRDYIKDYS 1072
              ++S  QL        +         YN+ L+ L+PP  G   EN      R +I  +S
Sbjct: 999  PDSQSEPQLPQGTHAELEPEATHAVSIYNKKLMSLLPPAAG--TENSAITALRSFISKHS 1056

Query: 1073 FDSEVSTMCRKIIHQSDEILPLQDSEKPFSFHDYLTEYG 1111
              ++ +   R++I Q D I+P+  S++      +L E+G
Sbjct: 1057 LTTKTALFGRRVISQDDTIMPMYMSDREMDNRQFLAEFG 1095

>NDAI0G00900 Chr7 complement(187653..191492) [3840 bp, 1279 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1279

 Score =  624 bits (1609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 364/867 (41%), Positives = 508/867 (58%), Gaps = 91/867 (10%)

Query: 300  DLMNETAKRHLALSKLIIDSKLEKQISNSPLLQIQYKTLLALIDPLTQPVPNDTHVISID 359
            +LM  T KRH  L+KL+  +  +    +SPLL++Q+K +L L+DPL+QP PND H+IS+D
Sbjct: 413  NLMLNTKKRHQILNKLLNSNSFD----SSPLLELQFKLMLGLVDPLSQPPPNDKHIISLD 468

Query: 360  LLCNMFLGLMKPYIDNQLNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERL----GTV 415
            LL  +F+ ++ P  +    N+ G +W+ H+CF M +II   +  LNCND ++L    G  
Sbjct: 469  LLYQLFIAILYPNFE-IFQNNLGFNWKTHVCFQMVKIINNCMEKLNCNDLQKLYDLTGFQ 527

Query: 416  DESK------------------------DWRSQLHLWLPRGLNTQNLELVYMSCILAVYT 451
             E+                         +WRS L  WLP GLNTQ+LEL+YM  ILA YT
Sbjct: 528  GENNKEELLQQQQQQQQQQQQTDRFVDGNWRSTLEQWLPHGLNTQDLELLYMVMILASYT 587

Query: 452  IYKLYSDSPVHFNPFLSSLISLWKSLTCVVLYGLQIDRLEESNQSFDTPIIVRATIRGAA 511
            + KL  + P+  NPFL +LI+LWK LT +++ GL IDR EE+++++ TP++V+ATIRGA+
Sbjct: 588  LQKLNHEIPIQLNPFLPTLINLWKKLTLILVLGLDIDRSEEAHETYKTPLLVKATIRGAS 647

Query: 512  ALRSIVATVLNEQMELKRHDFIHESLNTFMSPHGRKLCDGALYADLKAYTASILALGAEF 571
            ALRS+VAT+LN  ME   HDF HE+LNTFMSPHGRKLC+GALY D+K + AS+ ALG + 
Sbjct: 648  ALRSVVATILNNYMEYNDHDFKHEALNTFMSPHGRKLCNGALYCDIKLFAASLYALGMDL 707

Query: 572  QEVTDLVSYLQAGDQFDEDVKYMFX------XXXXXXXXXXXXXXXXXXXXXXXXYAFN- 624
             E+ +L+SYL+ GD+FDED+ YMF                               Y  N 
Sbjct: 708  IEIRNLLSYLEPGDRFDEDINYMFEYEYDDYNAALKENHEDLGKTLKSNDDNSDIYVLNE 767

Query: 625  ------KRRCNCIFXXXXXXXXXXXXXXXXXXXXXXXIDGEIATKSKEHTEKTIESDSGL 678
                  +RRCNCIF                        +G+     +E  E T ++ +  
Sbjct: 768  VKLDRYQRRCNCIFEDDKILQDDDDG------------NGDEQQGEQEEQEGTPKNVASF 815

Query: 679  SNQLSK---PHAVRSKSNFEFDYSGKDWRDIPREYNLYYSPFYNFIDRPDLNTVFVLTLK 735
             + L K    +AVRSK+ FEFDYSGKDWRDIPR +N+YYS  Y+FID   L+T+  LT K
Sbjct: 816  QDPLGKRNLDYAVRSKTTFEFDYSGKDWRDIPRGFNIYYSTSYSFIDDSSLDTMINLTSK 875

Query: 736  ATSXXXXXXXXXXXXCSVASTVKNEQDRMIFGNLLEQDKS----------STADEHEDTK 785
            A++              +AS++K EQ+ MI  +LL+              ++ +E E + 
Sbjct: 876  ASTQKLNHDDSIQLLQLLASSIKEEQNDMIMKDLLKGKDQLHSNIINPLVNSKEEKERST 935

Query: 786  KEATPDDIYEIWCEESAFERILHFNPDLAWKLMDEMLMCSGYRRVLIWFITHMELSHSLI 845
              ATPDDI++ W ++  F  +LHFN +L+W+LMDEMLMC+GYRRVLIW+ITHM+L+HSLI
Sbjct: 936  VVATPDDIFDYWFDKDVFVEMLHFNEELSWRLMDEMLMCNGYRRVLIWYITHMKLNHSLI 995

Query: 846  IYIFDLMMGSRG--INKTDTSKN--VKSTFITENISDSNSNSLKFSRMGHLKLSELETRM 901
             YIF+L+MG RG      +  KN  +    + + I D  +++  FSR G L LS++ET+M
Sbjct: 996  QYIFELLMGLRGSPFANNNECKNELLHELMLGKKIVD--NHTYPFSRQGPLILSDIETKM 1053

Query: 902  ILQELFTNAAIYF-SDKARKSNQSIL---TPDYSTXXXXXXXXXXGGYSIYSVGLMKLIC 957
            +LQE F+NAAIYF +D A       L   T D S            G S+YS+GLMKLIC
Sbjct: 1054 LLQEFFSNAAIYFDNDLATNEGDGQLEHTTEDISINSDEIENNENHGVSMYSMGLMKLIC 1113

Query: 958  IMVSKLIENSKFNVNESDCVFELQTLLMGWISILPEAKELSFKINSSLSEFSHV----EN 1013
            IMVS LIEN KF+  +SDC FELQTLLM WI IL EAKEL FK+ S + E S      ++
Sbjct: 1114 IMVSSLIENKKFDFTKSDCNFELQTLLMNWIGILKEAKELFFKLKSDIEETSESTDGGDD 1173

Query: 1014 SELASIEG--ASTKSHKQLVDKNSESYKYNEILLKLIPPTFGGKEE---NIIFNTFRDYI 1068
             +  SI+   +S  + K    +  +   +N+ LL+L+ P   G  +   + +   FR  +
Sbjct: 1174 DDFESIDSRKSSESNGKWEGSRIGKMNDFNKRLLRLLAPIHSGDTDLNSDTVTTPFRGLL 1233

Query: 1069 KDYSFDSEVSTMC-RKIIHQSDEILPL 1094
            K+YSF S+   +  RK+++  DEILPL
Sbjct: 1234 KNYSFTSKPKKVAGRKVVYTDDEILPL 1260

 Score = 59.7 bits (143), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 64/220 (29%), Positives = 103/220 (46%), Gaps = 37/220 (16%)

Query: 21  YKPSIYQLEQLLRDENQVLDLLADIEVKG-SFITEVTVIALFTTRPGISLLNCLTDNFGI 79
           YKP+I  L+  L DE+  L++    +VK  S + E  VIA FTT+ G S+LN L D    
Sbjct: 85  YKPTIENLQDFLEDEHFFLEMRKIKKVKKFSIMLETLVIAYFTTKSGQSILNYLFDT--- 141

Query: 80  DEDNKDFNPNSLLPRMPQLALKWMHDELILIKFLRFIIDNRNMDINFKNKNDILSKLQLD 139
                   P ++  ++  L   W  +E +   F+ F+I N+N +IN    N+  +KL + 
Sbjct: 142 -----KRKPPTVQNKI--LRKTWEVNEFLYFCFIDFLIRNKNNEINIDKFNEPENKLSIK 194

Query: 140 FLI------KNETSDFI---SLNLLTNEVDVVREYLTAIWPKLKNIIKISLNGENEYIDC 190
           FL+        ET   I   + N+LT+ +D    +L         +IK++       I  
Sbjct: 195 FLLTFHPLSNIETPSIILDSNYNMLTDYLDATSNWLIL-------LIKMT-------ILN 240

Query: 191 EDSFFVRTILSYKRLYETLLHFEFYDYSSMKTNGSDIYVK 230
              FF  TI+ Y R+ +   HF++Y   +   N   +Y+K
Sbjct: 241 VGPFFYNTIIRYNRIPQFNGHFQWY---TSLPNDKPLYIK 277

>Kwal_47.18886 s47 (1013635..1016952) [3318 bp, 1105 aa] {ON} YGR134W
            (CAF130) - CCR4 Associated Factor 130 kDa [contig 189]
            FULL
          Length = 1105

 Score =  610 bits (1572), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/1115 (35%), Positives = 591/1115 (53%), Gaps = 126/1115 (11%)

Query: 52   ITEVTVIALFTTRPGISLL------NCLTDNFGIDEDNKDFNPNSLLPRM-PQLALKWMH 104
            I E  VI LFTT+PG+S+L      +C   N    +  +     SL   +  +L  KW  
Sbjct: 46   IQEKLVIGLFTTKPGLSILKLYYELSCGRINLLRYKKWQQSKFQSLPDAVYKKLVKKWTG 105

Query: 105  DELILIKFLRFIIDNRNMDINFKNKNDILSKLQLDFLIKNETSDFISLNLLTNEVDVVRE 164
                +   + +++ N +  +++ +      KL + FL+  +T     L ++ +E +++ +
Sbjct: 106  SSDYISALMEYLLRNDSTSLDYVSFYSAEYKLSMAFLLDQDTE----LLIIDDEYNLLLD 161

Query: 165  YLTAIWPKLKNIIKISLNGENEYIDCEDSFFVRTILSYKRLYETLLHFEFYDYSSMK-TN 223
            +L      ++ ++  +        D   S   ++ LS+ RL++    + +Y +S  +   
Sbjct: 162  FLLQTRASVEELLSQA--------DLP-SLIAKSALSHHRLFQLSGRYVWYTFSDERFAE 212

Query: 224  GSDI---YVKALMKHLTGLSNFSFQLFKLSGYFYNTIDNQSYNPSKFGFIPL--SVDPDD 278
              DI   Y+  L   LT   +   Q+  L           S N S+   +    S+  + 
Sbjct: 213  AQDICYKYLSVLTDKLTAQQDLIPQIQPLF---------DSVNSSRLAHLSQGDSLYSEG 263

Query: 279  GEVEENQETDNILQPSL----------------LDFPDLMNETAKRHLALSKLIIDSKLE 322
             E + N ++D+  Q  L                L+ P++   T +RH AL +++   +L+
Sbjct: 264  VESDSNSDSDHWPQKKLSAHERIYSFDLKDDGTLESPNVFGRTRRRHQALYQVL---RLQ 320

Query: 323  KQISNSPLLQIQYKTLLALIDPLTQPVPNDTHVISIDLLCNMFLGLMKPYIDNQLNNDDG 382
            +Q ++SP L+ Q+ TL AL+DP+TQP PND+H+ISIDLL +MF+GL+   I  QL     
Sbjct: 321  QQ-NSSPCLKAQFFTLCALVDPVTQPTPNDSHIISIDLLSDMFIGLLHSEI-KQL----P 374

Query: 383  VDWRFHICFNMQQIIIASLFVLNCNDFERLGTV---DESKDWRSQLHLWLPRGLNTQNLE 439
             +WRFHICFN+Q+I+ ++L  LNC+DF++L +V   D+S DWR  LH WLP+GLNTQ+LE
Sbjct: 375  FNWRFHICFNLQKILQSTLPRLNCHDFQQLNSVNNSDDSIDWRRNLHKWLPQGLNTQDLE 434

Query: 440  LVYMSCILAVYTIYKLYSDSPVHFNPFLSSLISLWKSLTCVVLYGLQIDRLEESNQSFDT 499
            LVYM  ILA+Y I+KLY D PV  NPFL+S+ISLWK+LT VVL GL+IDR EE  ++F T
Sbjct: 435  LVYMIDILAIYIIHKLYRDRPVQMNPFLASMISLWKNLTFVVLLGLEIDRFEEEQETFST 494

Query: 500  PIIVRATIRGAAALRSIVATVLNEQMELKRHDFIHESLNTFMSPHGRKLCDGALYADLKA 559
            P++VRA IRG++ALRS+VATVLN  +E KRHDF HE +N FMSPHGRKLC GALY D+++
Sbjct: 495  PVLVRAAIRGSSALRSVVATVLNGHVEYKRHDFQHEPINIFMSPHGRKLCHGALYTDVRS 554

Query: 560  YTASILALGAEFQEVTDLVSYLQAGDQFDEDVKYMF-------XXXXXXXXXXXXXXXXX 612
            + A++LALG E ++VT+L+S LQ GD+FDEDVKYMF                        
Sbjct: 555  HAAAMLALGIELEDVTNLLSDLQPGDRFDEDVKYMFDYEYDNYNEVGTEDMDEEELEDVE 614

Query: 613  XXXXXXXXYAFNKRRCNCIFXXXXXXXXXXXXXXXXXXXXXXXIDGEIATKSKEHTEKTI 672
                     A+ K RC+C F                         G   + ++   E   
Sbjct: 615  SRERIKEMRAYYK-RCHCQFDDDELLPEEEEES------------GIPISHTRISKELPP 661

Query: 673  ESDSGLSNQLSKPHAVRSKSN-FEFDYSGKDWRDIPREYNLYYSPFYNFIDRPDLNTVFV 731
            +++  LSN  +KP A+R+K +  EFD++G+DWRDIPR  N Y++  Y+F           
Sbjct: 662  DTNVKLSNT-AKPVALRNKKDTIEFDFNGRDWRDIPRGLNFYFNENYDFEKSVKRGAAHT 720

Query: 732  LTLKATSXXXXXXXXXXXXCSVASTVKNEQDRMIFGNLLEQDKSSTADEHEDTKKEA--T 789
            L   A                V++ V  EQ+  +  +    D S           +   T
Sbjct: 721  LMNSAAERQLSKEEAVHLLRLVSTCVAKEQEHTVLRSAFAADDSQALSCQSTLVADGDLT 780

Query: 790  PDDIYEIWCEESAFERILHFNPDLAWKLMDEMLMCSGYRRVLIWFITHMELSHSLIIYIF 849
             D IYE WC++S F+++L  N  L W++MDEMLMCSGYRRVLIWFITH+E++ S+I YI+
Sbjct: 781  TDYIYENWCQDSLFDKMLFHNETLVWRIMDEMLMCSGYRRVLIWFITHLEVTSSMIEYIY 840

Query: 850  DLMMGSRGINKTDTSKNVKSTFITENISDSNSNSLKFSRMGHLKLSELETRMILQELFTN 909
             L+MG+RG    +   N ++ F            L FSR G + LSE+E +M+LQE FTN
Sbjct: 841  SLVMGNRG----EKLANEETPF----------GKLPFSRQGDIVLSEIEIKMLLQEFFTN 886

Query: 910  AAIYFSDKARKSNQSILTPDYSTXXXXXXXXXXGGYSIYSVGLMKLICIMVSKLIENSKF 969
            AAI+FS + R+S       +              G S Y VGLM+L+C MV  LI+   F
Sbjct: 887  AAIFFSKQLRESLGDEEEEETENL----------GISPYIVGLMRLVCFMVKSLIQEEMF 936

Query: 970  NVNESDCVFELQTLLMGWISILPEAKELSFKINSSLSEFSH----VENSELASIEGASTK 1025
            +  + D +FEL+TLLM WI ILPEA++L F + S + + S      +   +A+    +  
Sbjct: 937  DFKDPDYIFELETLLMSWICILPEARDLFFALRSRVDQQSRKPAKRDPDAMATASVVNLS 996

Query: 1026 SHKQLVDKNSESYK---------YNEILLKLIPPTFGGKEENIIFNTFRDYIKDYSFDSE 1076
               +  D+N  S           YN+ L+ L+PP  G   EN      R +I  +S    
Sbjct: 997  PDFRTTDENDGSSDSEETNSVSIYNKKLISLLPPVVG--TENTAVTALRSFISKHSLTMG 1054

Query: 1077 VSTMCRKIIHQSDEILPLQDSEKPFSFHDYLTEYG 1111
             +   R++I+  D I+ +  S+K     ++L E+G
Sbjct: 1055 TAVFGRRVINHDDRIMSMYMSDKDIDNRNFLAEFG 1089

>TBLA0C04510 Chr3 (1092230..1096153) [3924 bp, 1307 aa] {ON} Anc_3.497
            YGR134W
          Length = 1307

 Score =  612 bits (1578), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/1299 (34%), Positives = 656/1299 (50%), Gaps = 237/1299 (18%)

Query: 9    KLKRIAEILSPNYKPSIYQLEQLLRDENQVLDLLADIEVKGSFITEVTVIALFTTRPGIS 68
            KL  + + L  +YKP+I  LE L+           D E   S + E  ++ALFTT  G+S
Sbjct: 6    KLSDLRDSLPIDYKPNIQLLETLIDYAK------PDSEYLDSLLFESLILALFTTNCGLS 59

Query: 69   LLNCL-------------------TDNFGID-EDNKDFN------------------PNS 90
            +LN +                   T    +D + NKD N                  PN 
Sbjct: 60   VLNIISTLKSFTNDKQKKNNLVPTTATAAVDSKHNKDENLDTTVIRNATATRNIIAKPNI 119

Query: 91   LLPRM--PQLALKWMHDELILIKFLRFIIDNRNMDINFKNKNDILSKLQLDFLIKNET-- 146
            L  +   P+L  KW +D++ L+KF +FI+ N N  +N+    D + KL L+FL+ N+   
Sbjct: 120  LKKQAHHPKLLEKWRNDKITLLKFTKFILKNSNFPLNYNAFFDPVMKLPLEFLLLNDRFC 179

Query: 147  ------------SDFISLNLLTNEVDVVREYLTAIWPKLKNIIKISLNGENEYIDCEDSF 194
                        S + +  L+    +++ +YL    P L +++  +L         +   
Sbjct: 180  SNDNNATSQKLFSIYNNTLLMDKNYNLLLDYLHVSTPLLISLLHTNL---------DPLL 230

Query: 195  FVRTILSYKRLYE-----TLLHFEFYDYSSMK-----TNGSDIY-----VKALMKHLTGL 239
            F   I SY + +E       L ++F D          TN  DI      +  + K+ T  
Sbjct: 231  FNNIISSYNKSFELTNDNKCLWYDFIDSKDTTNFGTITNCIDIINNFLEIFDMHKNFTLN 290

Query: 240  SNFSFQLFKLSGYFYNTIDNQSYNPSKFGFIPLSVDPDD-GE------VEENQETDNILQ 292
            +  S  LF +S    +T  +  +N ++   + L +D +  GE      + EN     IL 
Sbjct: 291  AEISNSLFNISSS--STTKSNMHNENEGADLNLLMDENSMGEHTLSFNLFENNINHGILH 348

Query: 293  PSLLDFPDLMNETAKRHLALSKLIIDSKLEKQISNSPLLQIQYKTLLALIDPLTQPVPND 352
            P      DLM   +KRH  L+K I++     +  NSPLL +Q+K L AL+DPLTQP PN 
Sbjct: 349  P------DLMAHISKRHDILAK-ILNVGDNDKYYNSPLLHLQFKLLCALVDPLTQPTPNH 401

Query: 353  THVISIDLLCNMFLGLMKPYIDNQLNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERL 412
             ++ISIDLL  +FLG +KP +D   + +DG +W+F +CFNM++II + +  LNC DF  L
Sbjct: 402  KNIISIDLLFQLFLGFLKPELDRYSSAEDGTNWKFLVCFNMEKIINSVMKKLNCVDFNTL 461

Query: 413  GTV---DESKDWRSQLHLWLPRGLNTQNLELVYMSCILAVYTIYKLYSDSPVHFNPFLSS 469
             ++   DES  WR+QLH WLPRG NTQ+LEL+YM  ILA YTIYKL  D P+  NPFLSS
Sbjct: 462  NSINNSDESVHWRTQLHKWLPRGFNTQDLELLYMVNILATYTIYKLNEDLPIQLNPFLSS 521

Query: 470  LISLWKSLTCVVLYGLQIDRLEESNQSFDTPIIVRATIRGAAALRSIVATVLNEQMELKR 529
            ++S WK+L+C +L GL+IDRLEE N++FDTP+IVRAT+R + ALRSI+AT+LNE +    
Sbjct: 522  MVSHWKNLSCTILLGLEIDRLEEENETFDTPLIVRATVRSSTALRSIIATILNEHVNAFA 581

Query: 530  HDFIHESLNTFMSPHGRKLCDG--------------ALYADLKAYTASILALGA------ 569
            HDF HESLNTFMSP+GRKLC+G              AL  DL+  T  I  L        
Sbjct: 582  HDFKHESLNTFMSPYGRKLCNGALYTDFRSHASTILALTGDLEHVTQLISDLQPGDRFDE 641

Query: 570  ------EFQEVTDLVSYLQAGD--------QFDEDVKYMFXXXXXXXXXXXXXXXXXXXX 615
                  EF++   L + L   D        +  E +K +                     
Sbjct: 642  DVKYMFEFEDYNTLPNVLGGEDDETSTDTLKNREMLKEIHNGNFIPDNEENDEREIRNYL 701

Query: 616  XXXXXYAFNKRRCNCIFXXXXXXXXXXXXXXXXXXXXXXXIDGEIA-------------- 661
                      RRCNCIF                       I+  IA              
Sbjct: 702  EQKLREMNCHRRCNCIFSDDEIKDTSISDKNYMGNSSSNGIESRIALLLNNNSSRKGGNG 761

Query: 662  TKSKEHTE---KTIES-----------DSGLSNQLSKPHAVRS------------KSN-- 693
            T S++  +   K IE+           +S      +KPHAVR+            K+N  
Sbjct: 762  TNSEDDEDVIRKNIENLTKDQLSSTEMESLRVTGFNKPHAVRTSNLNNNPSSVNNKNNQN 821

Query: 694  -FEFDYSGKDWRDIPREYNLYYSPFYNFIDRPDLNTVFVLTLKATSXXXXXXXXXXXXCS 752
             F+FDY+GKDWRD PR  NLYY+  Y FI++P+L+ VF LTLKAT+              
Sbjct: 822  IFDFDYNGKDWRDTPRGMNLYYNLNYEFIEKPNLDLVFQLTLKATNMKLDKDDSNLLLRL 881

Query: 753  VASTVKNEQDRMIFGN---------LLEQDKSSTADE---HEDTK----------KEATP 790
            VAS+VKNEQDR+IF +         ++EQ++    +E   H   +           E TP
Sbjct: 882  VASSVKNEQDRIIFSDNQVSKEVKEIMEQNEDGVENEKLPHNKNRIENGNEKEIITEITP 941

Query: 791  DDIYEIWCEESAFERILHFNPDLAWKLMDEMLMCSGYRRVLIWFITHMELSHSLIIYIFD 850
            DDIYEIWCEESAFER++  N ++ ++LMDEMLMC GYRRVLIWFITH+ELSHS+I YIF+
Sbjct: 942  DDIYEIWCEESAFERMMQLNYEVTFRLMDEMLMCYGYRRVLIWFITHLELSHSVIHYIFE 1001

Query: 851  LMMGSRGINKTDTSKNVKSTFITENISDSNSN-------------------SLKFSRMGH 891
            L+MG RG ++ + +   K T    N+++  +                     L FSR G+
Sbjct: 1002 LVMGFRGTSEENGATEDKHTNTKGNVNELENKNENELVNMLLNDYSKIFDLQLPFSRQGN 1061

Query: 892  LKLSELETRMILQELFTNAAIYFSDKAR-KSNQSILTPDYSTXXXXXXXXXXGGYSIYSV 950
            ++LSE+E +M++QE  TNAAI+F+++   K N +      S              S+YS+
Sbjct: 1062 IELSEIERKMLIQEFLTNAAIHFNERNNLKHNPNSNDNSNSNEDNINKDEDEDEISLYSI 1121

Query: 951  GLMKLICIMVSKLIENSKFNVNESDCVFELQTLLMGWISILPEAKELSFKINSSLS---- 1006
            GLM+LIC M+   ++N+K  +   D +FELQTLLM WI+I+PEAK+L F+I   +S    
Sbjct: 1122 GLMRLICFMIQAFLDNNKLKIEVDDSIFELQTLLMNWITIIPEAKKLFFQIKDIISNNQI 1181

Query: 1007 -------EFSHVENSELASIEGASTKSHKQLVDKNSE---SYKYNEILLKLIPP-TFGGK 1055
                         + +  +IE  ++K +   +D++S+   +  +N+ L++L P  +   K
Sbjct: 1182 DNNNFNNNLILDLDQDNNTIENQTSKDNNDKMDESSKVDSNSSFNKKLIELFPKMSHTNK 1241

Query: 1056 EENIIFNTFRDYIKDYSFDSEVSTMCRKIIHQSDEILPL 1094
            EEN   +T ++Y+K + F  EV  + RK+I++  +IL +
Sbjct: 1242 EENTAIDTLKNYLKKFRFHQEVPIIGRKVIYEDGKILKI 1280

>KNAG0B00770 Chr2 complement(142612..145728) [3117 bp, 1038 aa] {ON}
            Anc_3.497 YGR134W
          Length = 1038

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 386/1115 (34%), Positives = 588/1115 (52%), Gaps = 140/1115 (12%)

Query: 52   ITEVTVIALFTTRPGISLLNCLTD-NFGIDEDNKDFNPNSLLPRMPQLALKWMHDEL--I 108
            + E  V+ LFTT  G  +   L   + G+   +K   P+ ++    Q+   W  + L   
Sbjct: 11   LLEECVVTLFTTYRGQHVCQMLEQLDLGVFSLSK--TPSRIVQ---QVRTAWTEEALSKY 65

Query: 109  LIKFLRFIIDNRNMDINFKNKNDILSKLQLDFLIKNETSDFISLNLLTNEVDVVREYLTA 168
            +  F + +  +          N+   KLQ+  L  +E S   +  +L  + DV+ +++  
Sbjct: 66   IHLFFQHVWRDAGDRFAIMQYNEPAFKLQVSDLFPSEFSK--ARLVLNTDYDVLLDFVNT 123

Query: 169  IWPKLKNIIKISLNGENEYIDCEDSFFVRTILSYKRLYETLLHFEFYDYSSMKTNGSDIY 228
            + P+LK +I+ ++ G         S     +  Y R+YE   +F +++ S  K    D+ 
Sbjct: 124  VRPQLKGLIRQAVQG---------SLVDPIVRKYGRVYEFHDYFHWFNLSKKKFANRDVL 174

Query: 229  VKALMKHLTGLSNF---SF---------QLFKLSGYFYNTIDNQSYNPSKFGFIPLSVDP 276
            +  L K    L ++   SF          L    G  +   +N  Y         L  + 
Sbjct: 175  I--LNKGTPDLFHYYINSFCSKAPYDVHPLHPFLGELFEGNNNVKYQQ-------LGTNE 225

Query: 277  DDGEVEENQETDNILQPSLLDFPDLMNETAKRHLALSKLIIDSKLEKQISNSPLLQIQYK 336
               E + ++ET N      +   DLM ++ +RH  L++++   +++     SP L  Q+K
Sbjct: 226  HVYEFDLDEETHNGSGNRTVAV-DLMQQSNQRHEILTRMLNLKEID-----SPHLYEQFK 279

Query: 337  TLLALIDPLTQPVPNDTHVISIDLLCNMFLGLMKPYIDNQLNNDDGVDWRFHICFNMQQI 396
             +++L+DPLTQP P+DT+V+S+DLL  +FL  +    D + N+       F +CFNMQ+I
Sbjct: 280  CMISLVDPLTQPPPSDTYVVSLDLLYKLFLAFLPKNQDTEQND------TFLLCFNMQKI 333

Query: 397  IIASLFVLNCNDFERLGTVDESK--------DWRSQLHLWLPRGLNTQNLELVYMSCILA 448
            I  +L+ L C D+ +L ++ + +        ++R  L  W+P GLNTQ+LEL+YM  I+A
Sbjct: 334  ITRTLWRLKCWDYAKLTSISKKQTEGDNSQYNYRDHLKEWVPNGLNTQDLELLYMVDIMA 393

Query: 449  VYTIYKLYSDSPVHFNPFLSSLISLWKSLTCVVLYGLQIDRLEESNQSFDTPIIVRATIR 508
            VYTIY  YS  P+  NPFLS LISLWK+L+ V+L  L++DR EE+N +FDTP++VRATIR
Sbjct: 394  VYTIYNAYSHLPIQLNPFLSMLISLWKNLSAVLLLSLEVDRCEEANDTFDTPLLVRATIR 453

Query: 509  GAAALRSIVATVLNEQMELKRHDFIHESLNTFMSPHGRKLCDGALYADLKAYTASILALG 568
            GA+ALR++VA VLN  +    HDF HE LNTFMSPHGRKLC G+LYADL+++ A++L+LG
Sbjct: 454  GASALRAVVACVLNGHVRENEHDFKHEPLNTFMSPHGRKLCQGSLYADLRSHAAAMLSLG 513

Query: 569  AEFQEVTDLVSYLQAGDQFDEDVKYMFXXX---------------XXXXXXXXXXXXXXX 613
             + ++VT+L+S LQ GD+FDED++YMF                                 
Sbjct: 514  VDLEDVTELLSDLQPGDRFDEDIRYMFEYEYEDYNLVDFEDEDEDAAAAATTATASAAAI 573

Query: 614  XXXXXXXYAFNKRRCNCIFXXXXXXXXXXXXXXXXXXXXXXXIDGEIATKSKEHTEKTIE 673
                    A  KRRCNCIF                        D +I         ++ E
Sbjct: 574  TAANEGTGASQKRRCNCIFT-----------------------DDKII--------QSDE 602

Query: 674  SDSGLSNQLSKPHAVRSKSNFEFDYSGKDWRDIPREYNLYYSPFYNFIDRPDLNTVFVLT 733
            S   L    ++P++VR+KS+FEFDYSG DWRD+PR  NLY+ P Y F+ RP L     ++
Sbjct: 603  SKVSLGGGKNRPYSVRTKSSFEFDYSGNDWRDVPRGLNLYFWPSYEFLARPGLAEFRNVS 662

Query: 734  LKATSXXXXXXXXXXXXCSVASTVKNEQDRMIFGNLLEQDKSSTADEHEDTKKEATPDDI 793
             KA                VAS +K EQ+ +I G +  Q +     +        TPD+I
Sbjct: 663  SKAAGGKLNPMESQQLLKLVASAIKIEQECIIMGTVYPQTEGIAVGD----DGLLTPDNI 718

Query: 794  YEIWCEESAFERILHFNPDLAWKLMDEMLMCSGYRRVLIWFITHMELSHSLIIYIFDLMM 853
            Y+ W ++  F+RIL  N +LAWKLMDE+LMC GYRRVL+WF+THMEL+HS+I YIF+L+M
Sbjct: 719  YDAWFQDKVFDRILFMNQELAWKLMDELLMCHGYRRVLLWFVTHMELNHSVIHYIFELVM 778

Query: 854  GSRG----INKTDTSKNVKSTFITENISDSNSNSLKFSRMGHLKLSELETRMILQELFTN 909
            G RG     + T   +  ++      I   N  +L FSR G+L LSE+E +M+LQE FTN
Sbjct: 779  GLRGQELSADVTLEEQRKQALHNLMEIDTPNGGTLMFSRQGNLALSEIEVKMLLQEFFTN 838

Query: 910  AAIYFSDKARKSNQSILTPDYSTXXXXXXXXXXGGYSIYSVGLMKLICIMVSKLIENSKF 969
            AAI+ S    +  +S  +                  S+YS+GL+KLIC MV  LI N KF
Sbjct: 839  AAIFLSASESEEPESETS----------------DVSLYSIGLVKLICFMVKTLIVNHKF 882

Query: 970  NVNESDCVFELQTLLMGWISILPEAKELSFKINSSLSE-FSHVENSELASIEGASTKSHK 1028
              ++S+C FELQTLLM W+ I+P+A+EL F +  ++S+  +    +   S  GA      
Sbjct: 883  EFSKSECTFELQTLLMNWLGIVPDAQELFFLLKKNISDTKTATTTTTTTSALGAPGDIFP 942

Query: 1029 QLVDKNSES-------YKYNEILLKLIPPTFG--GKEENIIFNTFRDYIKDYSFDSEVST 1079
             L D + ++        ++N+ L+ L+P      GK  +   +  R++++ +S  SE+  
Sbjct: 943  TLTDADDDNNAVAENLSEFNKKLVMLLPRATQSEGKGSSQAIDALRNFMRKHSLSSEIPV 1002

Query: 1080 MCRKIIHQSDEILPLQDSEKPFSFHDYLTEYGKAV 1114
            + R+I+ +  +ILP    E+  +  +YL  Y  AV
Sbjct: 1003 LGRRIVRRGSQILPQATPERTVTLREYLGSYDGAV 1037

>Ecym_1232 Chr1 complement(477523..481137) [3615 bp, 1204 aa] {ON}
            similar to Ashbya gossypii AFR316W
          Length = 1204

 Score =  590 bits (1522), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/1180 (33%), Positives = 591/1180 (50%), Gaps = 155/1180 (13%)

Query: 50   SFITEVTVIALFTTRPGISLLNCLTD----NFGIDEDNKDFNPNSLLPRMPQLALKWMHD 105
            + ITE  V+ LF TR G S+L+ L D       + E  +     S           W   
Sbjct: 46   ALITEKVVVTLFMTRSGNSMLHMLYDLCCGRIKLTEYKQSLKVRSNHSYWKSCYKDWGSR 105

Query: 106  ELILIKFLRFIIDNRNMDINFKNKNDILSKLQLDFLIKNETSDFISLNLLTNEVDVVREY 165
              IL +FL F + N N  +++        KL L FL+      +    L+ +E +++ +Y
Sbjct: 106  RDILSEFLDFCLRNENCALDYIEYASATRKLPLQFLLPEPLRPY----LIDDEYNLLLDY 161

Query: 166  LTAIWPKLKNIIKISLNGENEYIDCEDSFFVRTILSYKRLYETLLHFEFYDYSS-----M 220
            +    P  + ++   +            F    +  Y R YE   ++ +Y   +     +
Sbjct: 162  MIQSRPMWEMLLTQGI----------PKFLPELVDEYNRSYEFNGYYVWYGNVTCSQVQV 211

Query: 221  KTNGSDIYVKALMKHLTGLSNFSFQLFKLSGYFYNTIDNQSYNPSKFGFIPLSVDPDDGE 280
            +++  ++Y K        L+     L KL+   ++     SY   +      + D D  +
Sbjct: 212  QSSTKELYTKFFYTLFDKLTVTKELLPKLNVALWSHSWPASYT-KQTLLDLSNDDDDHYD 270

Query: 281  VEENQETDNILQPSL----------------LDFPDLMNETAKRHLALSKLIIDSKLEKQ 324
             + + E D+  Q  L                L+FP++     KRH  L +++     E  
Sbjct: 271  QDVDSENDHWPQQKLSSREQVFTFDLNRDGTLEFPNVFLHAKKRHEILYRVLGLPDAE-- 328

Query: 325  ISNSPLLQIQYKTLLALIDPLTQPVPNDTHVISIDLLCNMFLGLMKPYIDNQLNNDDGVD 384
                PLL+ Q+ TL AL+DP+TQP P + H+ISIDL+  MFLG     I+N L +  G D
Sbjct: 329  ---GPLLKAQFMTLAALVDPITQPPPTEDHIISIDLIFQMFLGSTSNLIENMLISR-GRD 384

Query: 385  WRFHICFNMQQIIIASLFVLNCNDFERLGTV---DESKDWRSQLHLWLPRGLNTQNLELV 441
            WRFH+C+NMQ+I++A++  LNC+D + L TV   DES  W   L  W PRGLNTQ+LEL+
Sbjct: 385  WRFHVCYNMQKIVLATMKRLNCHDGDVLNTVNNSDESVHWNVNLDKWTPRGLNTQDLELL 444

Query: 442  YMSCILAVYTIYKLYSDSPVHFNPFLSSLISLWKSLTCVVLYGLQIDRLEESNQSFDTPI 501
            YM  +L++Y +Y+LYS  PV  NPFL   + LWK+LT V+L GL+IDR EE  ++F+TPI
Sbjct: 445  YMVDMLSIYAMYRLYSYLPVQMNPFLPLALHLWKNLTNVLLRGLEIDRFEEDRETFNTPI 504

Query: 502  IVRATIRGAAALRSIVATVLNEQMELKRHDFIHESLNTFMSPHGRKLCDGALYADLKAYT 561
            IVRA IRG AALRS+VAT++N+    K HDF HE +N FMSPHGRKLC GALYAD++++ 
Sbjct: 505  IVRAAIRGTAALRSVVATMINDHFSSKEHDFKHEPINLFMSPHGRKLCHGALYADVRSHA 564

Query: 562  ASILALGAEFQEVTDLVSYLQAGDQFDEDVKYMF------------XXXXXXXXXXXXXX 609
            A++L+LG +  +VTDL+S LQ GD+FD+DVKYMF                          
Sbjct: 565  AAMLSLGIDLNDVTDLLSDLQPGDRFDDDVKYMFDYEYDDYNAIDPEQLYDENEEDLERL 624

Query: 610  XXXXXXXXXXXYAFNKRRCNCIFXXXXXXXXXXXXXXXXXXXXXXXIDGEIATKSKEHTE 669
                            +RC+C+F                        +GE A+ + +  +
Sbjct: 625  EEIQQRERIKDMRGYYKRCHCVFDDDELLSDEE--------------EGETASSNIDRPK 670

Query: 670  KTIES----DSGLSNQLSKPH----AVRSKSNFEFDYSGKDWRDIPREYNLYYSPFYNFI 721
             +  S     S LS   + P+    A+RS+   +FD++GKDWRDIPR  N YY+  Y F+
Sbjct: 671  YSHNSLNLPSSMLSTTFNGPNSQKFAIRSRDGVDFDFNGKDWRDIPRGLNFYYTEHYVFV 730

Query: 722  DRPDLNTVFVLTLKATSXXXXXXXXXXXXCSVASTVKNEQDRMIFGNLL--EQDKSSTAD 779
            ++   + V+ L  +AT+             S+A+ +K EQ++ +  +++    DK S+++
Sbjct: 731  NKLHADVVYYLMKEATTKKMEPNHASFILRSIATCIKLEQEKSMVYDVMNGRTDKGSSSN 790

Query: 780  EHEDTKKEATPDDIYEIWCEESAFERILHFNPDLAWKLMDEMLMCSGYRRVLIWFITHME 839
             + D   E T D IYE WCEES F +++++N DL W++MDEMLMCSGYRRVLIWFITH+E
Sbjct: 791  SNSDRVNELTSDFIYEKWCEESLFTKMMYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLE 850

Query: 840  LSHSLIIYIFDLMMGSRGINKTD-------TSKNVKSTFITENISDSNSNSLKFSRMGHL 892
            +SHSLI YIF+L+MG RG    D        ++N+         S S +  + FSR G +
Sbjct: 851  ISHSLIHYIFELVMGMRGNVDYDEEAEDDIKNRNLDILDSLSLGSSSVTIKIPFSRQGPI 910

Query: 893  KLSELETRMILQELFTNAAIYFSDKARKSNQSILTPDYSTXXXXXXXXXXG--------- 943
             LS +E  M+L E F NA IYFSD  +  N     P   +          G         
Sbjct: 911  ILSIIEINMLLLEFFINATIYFSDNMKNLNSDEELPLSQSENEGSDDLEYGLCEDGDKDT 970

Query: 944  -GYSIYSVGLMKLICIMVSKLIENSKFNVNESDCVFELQTLLMGWISILPEAKELSFKIN 1002
             G S + +GLMKL+C MV  L+E  KF+  +S+ +FELQTLLM WI I+PEA+ L FK+ 
Sbjct: 971  LGVSPHVIGLMKLVCFMVDMLMEKKKFDFTDSEYIFELQTLLMNWIGIIPEARNLFFKLK 1030

Query: 1003 SSLSEFSHVENSELASIEGAST---KSHKQLV---------------------------- 1031
            SS+ E S   +S  +  +G      KS + LV                            
Sbjct: 1031 SSILEASSQNDSSKSDKQGTENIRKKSSQSLVTEGEGIEQKIVNIDREDHLENCLSDADF 1090

Query: 1032 --------------------DKNSESYKYNEILLKLIPPTFGGKEENIIFNTFRDYIKDY 1071
                                D N+   KYN++L++L+P       EN      R +I  +
Sbjct: 1091 PPTPIDINNLKLENVGSPEIDNNNNLSKYNKMLIELLP--LHVDNENTAVTALRSFITKH 1148

Query: 1072 SFDSEVSTMCRKIIHQSDEILPLQDSEKPFSFHDYLTEYG 1111
            S  ++ +   R++I+Q   I+ L  ++K     ++L E+G
Sbjct: 1149 SLTNKTAVFGRRVIYQDHAIMGLYMADKEMRQREFLAEFG 1188

>AFR316W Chr6 (1008188..1011763) [3576 bp, 1191 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YGR134W (CAF130)
          Length = 1191

 Score =  586 bits (1510), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/1209 (33%), Positives = 609/1209 (50%), Gaps = 177/1209 (14%)

Query: 21   YKPSIYQLEQL-LRDENQVLDLLADIEVKGSFITEVTVIALFTTRPGISLLNCLTD---- 75
            YKPSI  L +L +++ +   +L+         I E  V+ LF TR G S+L+ L D    
Sbjct: 25   YKPSIQSLLELNVQEGDPHFELM---------IVEKVVVTLFMTRGGNSILHLLYDLSCG 75

Query: 76   NFGIDEDNKDFNPNSLLPRMPQLALKWMHDELILIKFLRFIIDNRNMDINFKNKNDILSK 135
               + E  +     S + +      +W      L +FL F + N +  +++     ++ K
Sbjct: 76   RIKLSEYRQSLKVRSNVHQWKTCYKEWGSRRDTLSRFLDFCLRNEDCALDYTEYGRVMRK 135

Query: 136  LQLDFLIKNETSDFISLNLLTNEVDVVREYLTAIWPKLKNIIKISLNGENEYIDCEDSFF 195
            L L FL+      ++    L    +++ +Y          II   L  E   I       
Sbjct: 136  LPLQFLLPAGLHAYV----LDEGYNLLLDY----------IINSRLMWEELLIQGIPRLL 181

Query: 196  VRTILSYKRLYETLLHFEFYDYSSMK----TNGSDIYVKALMKHLTGLSNFSFQLFKLSG 251
               I  Y R++E   ++ +Y  +        +  +++ K L      L+     L +L+ 
Sbjct: 182  PELIEDYNRVFEFNGYYTWYGGAPSGAGAANSTRELHTKVLYALFDKLTVAKELLPRLNA 241

Query: 252  YFYNTIDNQSYNP--SKFGFIPLSVDPDD-----------------GEVEENQETDNILQ 292
                T+ + S+ P   K G    S + +D                    +E   T  + +
Sbjct: 242  ----TVWSHSWPPMYHKHGINEFSNEEEDLYDFDSELEGDSWPQHKSSAKEQVYTFELNR 297

Query: 293  PSLLDFPDLMNETAKRHLALSKLIIDSKLEKQISNSPLLQIQYKTLLALIDPLTQPVPND 352
               L+FP++   T +RH  L +++     E      PLL+ Q+ TL AL+DP+TQP P +
Sbjct: 298  DGSLEFPNVFLHTRRRHETLYRILGLPNRE-----CPLLRAQFMTLCALVDPITQPPPTE 352

Query: 353  THVISIDLLCNMFLGLMKPYIDNQLNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERL 412
             H+ISIDL+  MFLG +   +++ L    G DWRFH+C N+Q+II+A++  LNC+D E L
Sbjct: 353  KHIISIDLIYQMFLGSISSLLESSLR---GQDWRFHVCHNLQKIILATMKRLNCHDSEVL 409

Query: 413  GTV---DESKDWRSQLHLWLPRGLNTQNLELVYMSCILAVYTIYKLYSDSPVHFNPFLSS 469
             ++   DE+  W   +  W PRGLNTQ+LEL+YM  +L +YTIY+LYSD PV  NPFL  
Sbjct: 410  NSINNSDETVHWNVNIGKWTPRGLNTQDLELLYMVDMLGIYTIYQLYSDLPVQMNPFLPL 469

Query: 470  LISLWKSLTCVVLYGLQIDRLEESNQSFDTPIIVRATIRGAAALRSIVATVLNEQMELKR 529
               LWK+LT V+L GL+IDR EE  ++F TPIIVRATIRG+AALRS+VAT++N    +K 
Sbjct: 470  SFHLWKNLTNVLLLGLEIDRFEEDRETFSTPIIVRATIRGSAALRSVVATMINSHFSIKE 529

Query: 530  HDFIHESLNTFMSPHGRKLCDGALYADLKAYTASILALGAEFQEVTDLVSYLQAGDQFDE 589
            HDF HE +N FMSPHGRKLC GALYAD++++ A++LALG E  +VTDL+S LQ GD+FD+
Sbjct: 530  HDFKHEPINLFMSPHGRKLCQGALYADVRSHAAAMLALGIELNDVTDLLSDLQPGDRFDD 589

Query: 590  DVKYMF------------XXXXXXXXXXXXXXXXXXXXXXXXXYAFNKRRCNCIFXXXXX 637
            DVKYMF                                          +RC+C+F     
Sbjct: 590  DVKYMFDYEYDDYNAIDPEQLYDENEEDLERLEEIQQRERIKDMRGYYKRCHCVF----- 644

Query: 638  XXXXXXXXXXXXXXXXXXIDGEIATKSKEHTE----KTIESD-----SGLSNQLSKPHAV 688
                              +  E  T + EHT+    +T++S      +G+S    +  AV
Sbjct: 645  -------------DDDELLSDEEGTDTGEHTDNHITETVQSAPLNLVTGVSTSGPQKVAV 691

Query: 689  RSKSNFEFDYSGKDWRDIPREYNLYYSPFYNFIDRPDLNTVFVLTLKATSXXXXXXXXXX 748
            RS+   EFD++GKDWRDIPR  N YY   Y F+++   + +  L  +ATS          
Sbjct: 692  RSRDYVEFDFNGKDWRDIPRGMNFYYVEDYVFVNKLHADVLHYLMKEATSKKLESNQSSF 751

Query: 749  XXCSVASTVKNEQDRMIFGNLL--EQDKSSTADEHEDTKKEATPDDIYEIWCEESAFERI 806
               SVA+ +K EQ++ +  + +   +DKS  +    +     T D IYE WCE++ FE++
Sbjct: 752  ILRSVATCIKLEQEKTMVHDAIFKSKDKSPLSASGSEGSNGLTSDFIYEKWCEDALFEKM 811

Query: 807  LHFNPDLAWKLMDEMLMCSGYRRVLIWFITHMELSHSLIIYIFDLMMGSRGINKTDTSKN 866
            +++N DL W++MDEMLMCSGYRRVLIWFITH+ELSHS+I YIF+L+MG RG       K+
Sbjct: 812  MYYNNDLVWRMMDEMLMCSGYRRVLIWFITHLELSHSVIHYIFELVMGMRG---NVAYKD 868

Query: 867  VKSTFITE---NISDSNS-------NSLKFSRMGHLKLSELETRMILQELFTNAAIYFS- 915
            ++  +I     ++ DS S        S+ FSR G + LS +E  M+LQE F NAAIYFS 
Sbjct: 869  LEEEYIINRNLDLLDSFSLGSSCIPASIPFSRQGPIVLSTIEVNMLLQEFFINAAIYFSN 928

Query: 916  ---DKARKSNQSILTPDYSTXXXXXXXXXXG-----GYSIYSVGLMKLICIMVSKLIENS 967
               D A   +  +  P+  T                  S + +GLMKL+C MV  LIE  
Sbjct: 929  YLRDTASYEHLDVEQPEEQTEIEEGEAEDEIADERLTASSHVLGLMKLLCFMVDMLIEKK 988

Query: 968  KFNVNESDCVFELQTLLMGWISILPEAKELSFKINSSL--------SEFSHVENSELAS- 1018
            K +  +S+ +FELQTLLM WI ++PEA+ L FK+ S+L        S  SH+E  ELAS 
Sbjct: 989  KLDFTDSEYLFELQTLLMNWIGLVPEARTLFFKLKSTLLNSSALNGSALSHLE-GELASN 1047

Query: 1019 ----------------------------------IEGASTKSHKQLVDKNSES-YKY-NE 1042
                                                G  T +     +  SES   Y N+
Sbjct: 1048 DNDDSEPVDTAEDAGPMDKSNGLDGLPLCDIGALTNGQPTSAANSAPNGMSESNISYCNQ 1107

Query: 1043 ILLKLIPPTFGGKEENIIFNTFRDYIKDYSFDSEVSTMCRKIIHQSDEILPLQDSEKPFS 1102
            +L+KL+PP     +EN      R +I  +   ++ +   R++I+Q + I+ L  ++K   
Sbjct: 1108 MLIKLLPPH--SADENAAVTALRSFIAKHPLTTKTAIFGRRVIYQDNAIMGLYMADKELQ 1165

Query: 1103 FHDYLTEYG 1111
              ++L E+G
Sbjct: 1166 QREFLAEFG 1174

>CAGL0I10428g Chr9 complement(1031462..1034953) [3492 bp, 1163 aa]
            {ON} similar to uniprot|P53280 Saccharomyces cerevisiae
            YGR134w
          Length = 1163

 Score =  543 bits (1400), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 359/1098 (32%), Positives = 574/1098 (52%), Gaps = 57/1098 (5%)

Query: 28   LEQLLRDENQVLDLLADIEVKGSFITEVTVIALFTTRPGISLLNCLTDNFGIDEDNKDFN 87
            LE++ RDE+      +    + +F  E+  IALFTT+PG  +L+    N G+D   +  +
Sbjct: 92   LEKIYRDEDLSTTSYSRPRFEDNFFYELLTIALFTTKPGNKILHFFK-NTGLDSAIEHND 150

Query: 88   PNSLL---PRMPQLALKWMHDELILIKFLRFIIDNRNMDINFKNKNDILSKLQLDFLIKN 144
             +  L   P    L + W  ++  L   L+FI+ NRN+DI+  N      K  L FL+  
Sbjct: 151  SDDTLFHSPAYEHLKMLWKWEDEYLHNLLQFILKNRNVDIDLGNYCKTSYKRPLTFLLTC 210

Query: 145  ETSDFISLNLLTNEVDVVREYLTAIWPKLKNIIKISLNGENEYIDCEDSFFVRTILSYKR 204
              ++     LL+ E +++ EYL A    +K+ I I++      I    +FF  T+  Y R
Sbjct: 211  PNNNIKHRFLLSEEFNILEEYLYAAQSNIKSKIAIAIQST---IGKHMNFFTMTLHLYDR 267

Query: 205  LYE---TLLHFEFYDYSSMKTNGSDIYVKALMKHLTGLSNFSFQLFKLSGYFYNTIDNQS 261
            + E   + L +E  D  +      +  +  L++    ++    +   L     N + + S
Sbjct: 268  VTEYNQSYLRYEITDDENALCQFDESLLDVLLEFERYVTTDDIEAILLQSGRINKVKDIS 327

Query: 262  YNPSKFGF-----IPLSVDPDDGEVEENQE---TDNILQPSLLDFPDLMNETAKRHLALS 313
                +  +        S+ P++ + +  +E   + +I +  L + P++M ++  RH  L 
Sbjct: 328  SAIERGDYKWEQGTLRSLTPNNHKADNEEEVILSFDINENGLQEVPNIMKDSMLRHSILF 387

Query: 314  KLIIDSKLEKQISNSPLLQIQYKTLLALIDPLTQPVPNDTHVISIDLLCNMFLGLMKPYI 373
            + +    L ++ + +P L++Q+KTL  L+DPLTQP PNDTH+ISIDLL  ++ GL+ P +
Sbjct: 388  EFL---GLSQRNTLAPYLEMQFKTLAGLVDPLTQPTPNDTHIISIDLLHGLYTGLVHPAL 444

Query: 374  DNQLNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERL---GTVDESKDWRSQLHLWLP 430
                      DW++   FN+ +I+  SL  L+C+ ++ L   G  +E  DWR  L  W+P
Sbjct: 445  IKS-GKARNYDWKYLCGFNLIKIVWKSLKKLHCSSYDTLNNIGNFEEGNDWRQTLEYWIP 503

Query: 431  RGLNTQNLELVYMSCILAVYTIYKLYSDSPVHFNPFLSSLISLWKSLTCVVLYGLQIDRL 490
            + LNTQ+LEL+YM  IL+VY IYKLY D P+  NPFL  L S+WK +T ++  GLQ+DR+
Sbjct: 504  KNLNTQDLELLYMIDILSVYAIYKLYEDQPIQNNPFLFELFSVWKYITKIIFLGLQVDRI 563

Query: 491  EESNQSFDTPIIVRATIRGAAALRSIVATVLNEQMELKRHDFIHESLNTFMSPHGRKLCD 550
            EE N S +TP+++RAT+RGA+A R+ + T+LN Q+E   HDF HE +NTFMSPHGRKLC 
Sbjct: 564  EEQNDSEETPLMIRATVRGASAFRAALTTILNRQIENNEHDFKHEPINTFMSPHGRKLCS 623

Query: 551  GALYADLKAYTASILALGAEFQEVTDLVSYLQAGDQFDEDVKYMFXXXXXXXXXXXXXXX 610
            G+LYAD++  T   +  G E  ++T+L++ LQ GD+FDEDV+YMF               
Sbjct: 624  GSLYADMRVSTKIFVENGVELDDITNLLTDLQPGDRFDEDVEYMFDYEYEDYNLVSDSED 683

Query: 611  XXXXXXXXXXYAFNK---RRCNCIFXXXXXXXXXXXXXXXXXXXXXXXIDGEIATKSKEH 667
                              RRCNC+F                        +  I+TK +  
Sbjct: 684  MDEKADNESDGVRPAPIFRRCNCVFEDDKIMDESTIDHQSLITDMELE-NNAISTKDEND 742

Query: 668  TEKTIESDSGLSNQLSKPHAVRSKSNFEFDYSGKDWRDIPREYNLYYSPFYNFIDRPDLN 727
              K I           +P  VR +S F+F+Y GKDWRDIPR  NLYY+  + F+     +
Sbjct: 743  KIKIISQ--------PEPFTVRMRSFFDFNYGGKDWRDIPRGENLYYNGEFVFVQECSSS 794

Query: 728  TVFVLTLKATSXXXXXXXXXXXXCSVASTVKNEQDRMIFGNLLEQDKSSTADEHEDTKKE 787
                   KA +              VAS ++ EQDRM+  + + Q   +  D +   K +
Sbjct: 795  EFASYFSKAVNSVLDISESNRLIQLVASCIREEQDRMVIYHGMSQLPLANGDVN---KSK 851

Query: 788  ATPDDIYEIWCEESAFERILHFNPDLAWKLMDEMLMCSGYRRVLIWFITHMELSHSLIIY 847
             T D+IY+     + F ++L+ + +LA  LMDE+LM  GYRRVLIWF+TH+ ++  LI Y
Sbjct: 852  LTVDEIYDQISSSNNFAKMLYQDTELACGLMDELLMIVGYRRVLIWFLTHINITFPLIHY 911

Query: 848  IFDLMMGSRGINKTDTSKNVKSTFITENISDSNSNSLKFSRMGHLKLSELETRMILQELF 907
            IF+L+MG R +  +D   N       +N   S++    FSR+G + LS +E +M+LQE F
Sbjct: 912  IFELVMGYR-VGFSDGDAN------GDNNKKSSTGKCGFSRLGTVALSSIEKQMLLQEFF 964

Query: 908  TNAAIYFSDKARKSNQSILTPDYSTXXXXXXXXXXGGYSIYSVGLMKLICIMVSKLIENS 967
             NA +  S K+ +SN + +  +Y               S Y+VG++ LIC MV  L+   
Sbjct: 965  LNATVSLSAKSFESNGTEID-NYDDNADEDNEYI----SSYAVGIVTLICNMVKTLVRAG 1019

Query: 968  KFNVNESDCVFELQTLLMGWISILPEAKELSFKINSSLSEFSHVENSELASIEGASTKSH 1027
            + +V++S+   ELQTLL+ WIS++PEAKEL F +     EF  +++S L  I  +  ++ 
Sbjct: 1020 QMDVSKSEYTVELQTLLVNWISLIPEAKELFFFLKQEAHEFD-IQDS-LEPINESELQTS 1077

Query: 1028 KQLVD-KNSESYKYNEILLKLIPPTFGGKEENIIFNTFRDYIKDYSFDSEVSTMCRKIIH 1086
              + +   ++S   ++ +   +  +          +TF + +++ S   +   + RK+I+
Sbjct: 1078 GNINEPAATDSIPLDDTINTSLTSSTKNSNATDALSTFLETVEETSV--QPPQIGRKVIY 1135

Query: 1087 QSDEILPLQDSEKPFSFH 1104
            +  +ILPL + E+P  FH
Sbjct: 1136 KGTKILPLPEQERPIPFH 1153

>KLLA0E03961g Chr5 complement(358995..362393) [3399 bp, 1132 aa]
           {ON} weakly similar to uniprot|P53280 Saccharomyces
           cerevisiae YGR134W CAF130 Part of the evolutionarily-
           conserved CCR4-NOT transcriptional regulatory complex
           involved in controlling mRNA initiation elongation and
           degradation
          Length = 1132

 Score =  266 bits (680), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 194/600 (32%), Positives = 307/600 (51%), Gaps = 93/600 (15%)

Query: 31  LLRDENQVLDL-LADIEVKGSFITEVTVIALFTTRPGISLLNCLTDNFGIDEDNKDFNPN 89
           +L++++ V  L LAD +V  S + E  VIALFTT PG +++  L ++    +   D +  
Sbjct: 1   MLQEKSSVQRLFLADSDVDESVLLEKLVIALFTTVPGQAVVTQLIND---AKRTNDVDGV 57

Query: 90  SLLPRM-----PQLALKWMHDELILIKFLRFIIDNRNMDINFKNKNDILSKLQLDFLIKN 144
             L RM       L   W  D+ IL  FL +++ N    I+ +  +D   K+ + FL+ N
Sbjct: 58  ECLIRMNDPYWVALFGTWATDKHILSLFLGWVLRNETDHIDLERYSDQSFKMAMRFLLTN 117

Query: 145 ETSDFISLNLLTNEVDVVREYLTAIWPKLKNIIKISLNGENEYIDCEDSFFVRTILSYKR 204
           +   F +   L +  +++ +YL    P +++++K  L+G         S F++ ++ Y R
Sbjct: 118 QDPKFTAP--LWDTSNILLDYLHNAKPLIESVLK-KLDG---------SQFLQCLMKYNR 165

Query: 205 LYE---------------------TLLHFEFYDYSSMKTNGSDIYVKALMKHLTGLSNFS 243
           LYE                     T+L       S++   G+D+ V+AL +  TG     
Sbjct: 166 LYEFNGSYQWFTPPQSTSHAESPTTILERNSTFLSTLGNFGNDM-VRALSQLKTG----D 220

Query: 244 FQLFKLSGYFYNTIDNQSYNPSKFGFIPLSVDPDDGEVEENQETDNILQPSLLDFPDLMN 303
            +L  L  Y  N+  N   NP      PLS   D   +  N ++D               
Sbjct: 221 IRLNSLESYGKNSGHN---NP------PLSKQDDHNPLNLNGKSDRF------------- 258

Query: 304 ETAKRHLALSKLIIDSKLEKQISNSPLLQIQYKTLLALIDPLTQPVPNDTHVISIDLLCN 363
                      L     L K+    PLL  Q+ +L    DP+TQP PND+H+IS+DLL +
Sbjct: 259 ----------NLFFKLGLHKE--PHPLLAEQFNSLCLFADPMTQPPPNDSHIISLDLLHD 306

Query: 364 MFLGLMKPYIDNQLNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERLGTVDESKDWRS 423
           ++LG +  YI   + N   V W+ H+  N++ I +A L +L   D+  L   D  KD ++
Sbjct: 307 LYLGSLTAYIVKLIPNYQKV-WKIHLSANLETITLAILQMLQIWDYRSL---DNLKDIQA 362

Query: 424 Q--------LHLWLPRGLNTQNLELVYMSCILAVYTIYKLYSDSPVHFNPFLSSLISLWK 475
           +        +  W+P  L+   +E++YM   L+ Y+++K++SD P   NPFL  ++  W+
Sbjct: 363 RSPDAYPKYMTSWIPYDLSPPEMEILYMIAGLSFYSMHKMHSDKPPRLNPFLPMMLRAWR 422

Query: 476 SLTCVVLYGLQIDRLEESNQSFDTPIIVRATIRGAAALRSIVATVLNEQMELKRHDFIHE 535
            L+  ++ GLQIDR EE    + TP+IV A IRGA+ALRSI+AT+LN  ++ K HDF H+
Sbjct: 423 GLSSALVLGLQIDRFEEMQMLYGTPVIVSAVIRGASALRSIIATILNGHVDEKLHDFKHQ 482

Query: 536 SLNTFMSPHGRKLCDGALYADLKAYTASILALGAEFQEVTDLVSYLQAGDQFDEDVKYMF 595
               FMSPHGRKLC+GALY     Y A++L  G ++ E+ +L++ +Q GD+ DEDV+YMF
Sbjct: 483 PFGGFMSPHGRKLCNGALYTYEMYYFAALLPSGMDYDEIVELLTDIQKGDRIDEDVRYMF 542

 Score =  112 bits (279), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 84/318 (26%), Positives = 151/318 (47%), Gaps = 28/318 (8%)

Query: 696 FDYSGKDWRDIPREYNLYYSPFYNFIDRPDLNTVFVLTLKATSXXXXXXXXXXXXCSVAS 755
           +D +G DWRDIPR  NLYY   Y F+ + D  ++F L  +                S+A+
Sbjct: 663 YDKNGDDWRDIPRGLNLYYMDDYQFLSKLDKVSLFELLRRLPDRNVTFSQACTVLRSIAT 722

Query: 756 TVKNEQDRMIFGNLLEQDKSSTADEHEDTKKEATPDDIYEIWCEESAFERILHF---NPD 812
            VK EQ+++    LL+   +++A+        +T + I  I+ ++    +   F   N  
Sbjct: 723 CVKLEQEQI----LLKLITATSAEVDLKVLPFSTDEVITAIFNDDGGIIKPFPFSGCNDS 778

Query: 813 LAWKLMDEMLMCSGYRRVLIWFITHMELSHSLIIYIFDLMMGSRGINKT----DTSKNVK 868
           L WK+ DE++M  G+RR+LI+ +TH   + S I Y+++L+ G RG        +++KN +
Sbjct: 779 LGWKIFDELMMSHGHRRLLIYHLTHRSYTFSSIHYVYELLFGLRGNPARSYDLESTKNKQ 838

Query: 869 STFITENISD--SNSNSLKFSRMGHLKLSELETRMILQELFTNAA---------IYFSDK 917
              ++   +       +++FSR G ++LS +E +M+LQE F   +           F   
Sbjct: 839 LGILSWTPTGEFERVAAIEFSRQGVIELSAIEKKMLLQEFFVGVSSGLLGEYNDAGFEAF 898

Query: 918 ARKSNQSILTPDYSTXXXXXXXXXXGGYSIYSVGLMKLICIMVSKLIENSKFN-VNESDC 976
           + K+   +   DY                    G +K++C ++ +++ + +F  V   D 
Sbjct: 899 SIKNPSKVYVDDYGEEFFSATSRKAE-----MSGKVKMVCFILEEVLNDKEFEFVPHEDY 953

Query: 977 VFELQTLLMGWISILPEA 994
           V+EL+  LM W +   EA
Sbjct: 954 VYELKRFLMQWSTFSAEA 971

>ZYRO0C16390g Chr3 complement(1274651..1275961) [1311 bp, 436 aa]
           {ON} similar to uniprot|Q12214 Saccharomyces cerevisiae
           YPR068C
          Length = 436

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 21/78 (26%), Positives = 41/78 (52%), Gaps = 3/78 (3%)

Query: 372 YIDNQLNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERLGTVDESKDWRSQLHLWLPR 431
           YID  L++ DGV+  F    N+Q I   S+ +  C  F   G+++++K  ++  ++ L  
Sbjct: 228 YIDFDLHHGDGVERAFQFSSNVQTI---SMHLFECGFFPTSGSLEDNKKGKNIANIPLAH 284

Query: 432 GLNTQNLELVYMSCILAV 449
           GLN + L  +    ++ +
Sbjct: 285 GLNDEYLNEIVTQVVIPL 302

>Kpol_543.53 s543 complement(117707..119326) [1620 bp, 539 aa] {ON}
           complement(117707..119326) [1620 nt, 540 aa]
          Length = 539

 Score = 33.1 bits (74), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 46/167 (27%), Positives = 78/167 (46%), Gaps = 15/167 (8%)

Query: 87  NPNSLLPRMPQLALKWMHDELILIKFLRFIIDNRNMDINFKNKNDILSKLQLDFLIKNET 146
           NP  L P +  L L+W  ++ +L +FL+ IID+    +N K+  + + K     L+KN+ 
Sbjct: 97  NPEKLCPLIYSLHLEWHINDSLLSRFLKVIIDHA---VNLKSVENFIKKYIGITLMKNK- 152

Query: 147 SDFISLNLLTNEVDVVR-----EYLTAIWPKLKNIIKISLNGENEYIDCEDSFF--VRTI 199
           S+  SLNL   +   V       Y   +   LK      +   N +++C  +FF  ++  
Sbjct: 153 SNLESLNLFPPDSYPVEGGASPAYFNGLRGLLKTYSFDHVKNLNVHVNCR-TFFKPLKNP 211

Query: 200 LSYKRLYETLLHFEFYD---YSSMKTNGSDIYVKALMKHLTGLSNFS 243
           L  + L   L H  F      ++++TN  DI+    +K L  LS +S
Sbjct: 212 LKIESLCLNLRHDTFDTDPLATAIRTNYYDIFDVDTLKELEILSWYS 258

>ZYRO0G19954g Chr7 (1653353..1655455) [2103 bp, 700 aa] {ON} highly
            similar to uniprot|P07342 Saccharomyces cerevisiae
            YMR108W ILV2 Acetolactate synthase catalyses the first
            common step in isoleucine and valine biosynthesis and is
            the target of several classes of inhibitors localizes to
            the mitochondria expression of the gene is under general
            amino acid control
          Length = 700

 Score = 32.3 bits (72), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 27/108 (25%), Positives = 44/108 (40%), Gaps = 11/108 (10%)

Query: 990  ILPEAKELSFKINSSLSEFSHVENSELASIEGASTKSHKQLVDKNSESYKYNEILL---- 1045
            IL        ++  ++S+F+    +  A++EG     H ++  KN       ++ +    
Sbjct: 382  ILAVGARFDDRVTCNISKFA--PEARRAALEGRGGIVHFEMTPKNISKVVETQVAVHGDA 439

Query: 1046 -----KLIPPTFGGKEENIIFNTFRDYIKDYSFDSEVSTMCRKIIHQS 1088
                 KLIP  FG KE    FN    + K+Y  D    T   KI  Q+
Sbjct: 440  ATNIQKLIPLVFGVKERQEWFNQISQWKKEYPLDYMHETPGSKIKPQT 487

>TDEL0C05040 Chr3 complement(901798..903162) [1365 bp, 454 aa] {ON}
           Anc_3.362 YPR068C
          Length = 454

 Score = 32.0 bits (71), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 372 YIDNQLNNDDGVDWRFHICFNMQQIIIASLFVLNCNDFERLGTVDESKDWRSQLHLWLPR 431
           YID  L++ DGV+  F    N+Q I   SL +     F   G + ES   R+ +++ L  
Sbjct: 239 YIDFDLHHGDGVEKAFQFSSNVQTI---SLHLFEVGFFPGTGNLSESDKRRNVVNIPLLH 295

Query: 432 GLNTQNLE 439
           GL+  +LE
Sbjct: 296 GLDDTSLE 303

>Kwal_23.5946 s23 complement(1381399..1382139) [741 bp, 246 aa]
           {OFF} YIL072W (HOP1) - DNA binding protein [contig 12]
           FULL
          Length = 246

 Score = 31.6 bits (70), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 28/106 (26%), Positives = 49/106 (46%), Gaps = 27/106 (25%)

Query: 114 RFIIDNRNMDINFKNKNDI-LSKLQLDFLIKNETSDF----------------------I 150
           RF+ D  N D N KN+N+  L+ +++  L++ +T++                       +
Sbjct: 55  RFVPDKVNKDYN-KNRNEAPLNSIKIKTLVRGKTAEADLFLDWLEKGVFQSIKLKYLKAL 113

Query: 151 SLNLLTNE---VDVVREYLTAIWPKLKNIIKISLNGENEYIDCEDS 193
           SL +  NE    D++ +YL +        + IS+NGENE +   DS
Sbjct: 114 SLGIFANEEAPTDLLEDYLFSFAYDGSGEVSISVNGENEGVSLLDS 159

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 118,231,467
Number of extensions: 5462971
Number of successful extensions: 18842
Number of sequences better than 10.0: 56
Number of HSP's gapped: 19227
Number of HSP's successfully gapped: 82
Length of query: 1114
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 994
Effective length of database: 39,721,479
Effective search space: 39483150126
Effective search space used: 39483150126
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 71 (32.0 bits)