Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_480.103.499ON25924612850.0
YGR135W (PRE9)3.499ON25824712131e-170
Smik_6.2313.499ON25824712111e-170
Suva_7.4233.499ON25824712071e-169
Skud_7.4463.499ON25824711971e-168
ZYRO0D09746g3.499ON25324511931e-167
NDAI0G008903.499ON25424711901e-167
NCAS0E007603.499ON25924711891e-166
TPHA0A057003.499ON25624611861e-166
KAFR0C020203.499ON25824711801e-165
SAKL0F02530g3.499ON25224611701e-164
TDEL0D056703.499ON25524611671e-163
CAGL0I10406g3.499ON25724711571e-162
KNAG0B007603.499ON25924711401e-159
Ecym_12303.499ON25124611341e-158
Kwal_47.188983.499ON25124611241e-157
KLTH0G02376g3.499ON25124611231e-156
KLLA0E03917g3.499ON24924611141e-155
AFR318W3.499ON25124611051e-154
TBLA0D029203.499ON25824810391e-144
Ecym_81518.871ON2502474111e-48
ADL354W8.871ON2502214102e-48
KNAG0J001808.871ON2502214092e-48
SAKL0H02068g5.64ON2612384093e-48
KLTH0E16324g8.871ON2502194074e-48
Kwal_56.247805.64ON2622264075e-48
TPHA0H011905.64ON2602384051e-47
NDAI0C034005.64ON2632384032e-47
TBLA0C066205.64ON2622384032e-47
AER296W5.64ON2602384013e-47
KLLA0B11836g7.120ON2542044006e-47
Kpol_1062.25.64ON2602383981e-46
NCAS0D013405.64ON2612383972e-46
CAGL0I02442g5.64ON2602383962e-46
Ecym_51005.64ON2612383963e-46
KAFR0B044405.64ON2602383954e-46
NCAS0F010307.120ON2532043944e-46
CAGL0H07007g8.871ON2502193926e-46
KAFR0L020808.871ON2502193927e-46
KLTH0H00528g5.64ON2612263928e-46
TDEL0G008805.64ON2602383911e-45
KLLA0A05093g5.64ON2622263911e-45
KAFR0G030307.120ON2542043892e-45
ZYRO0C11770g5.64ON2602383893e-45
TBLA0J019807.120ON2542043883e-45
KLLA0D10373g8.871ON2502133873e-45
SAKL0F04224g7.120ON2522043874e-45
NDAI0E001608.871ON2502133856e-45
SAKL0D00440g8.871ON2502193857e-45
TPHA0C049308.871ON2502203858e-45
KNAG0K004505.64ON2672383869e-45
KLTH0F13574g7.120ON2542043859e-45
Suva_13.568.871ON2502133822e-44
NDAI0H015207.120ON2522043822e-44
Kpol_455.58.871ON2492223822e-44
Skud_13.518.871ON2502133813e-44
YML092C (PRE8)8.871ON2502133804e-44
ZYRO0G04136g7.120ON2542233805e-44
CAGL0F01199g7.120ON2542073796e-44
AAR012C7.120ON2512043796e-44
Smik_13.438.871ON2502133797e-44
Skud_15.1197.120ON2542203797e-44
TPHA0I020707.120ON2562043797e-44
Kwal_YGOB_Anc_7.1207.120ON2542043771e-43
YOL038W (PRE6)7.120ON2542043771e-43
YGR253C (PUP2)5.64ON2602383781e-43
Suva_15.1317.120ON2542043771e-43
Suva_7.5495.64ON2602383772e-43
TDEL0B004008.871ON2502203752e-43
Smik_16.545.64ON2602383753e-43
Kpol_1023.1087.120ON2542333753e-43
Skud_7.5865.64ON2602383753e-43
Ecym_12727.120ON2512043734e-43
NCAS0B001508.871ON2502153727e-43
Smik_15.1297.120ON2542043727e-43
TDEL0H033007.120ON2562183729e-43
TBLA0C063408.871ON2562273711e-42
ZYRO0A00616g8.871ON2502133674e-42
KNAG0L010207.120ON2661763537e-40
ZYRO0C00792g7.20ON2901953172e-34
Kpol_538.407.20ON2741953145e-34
KLTH0D00902g7.20ON2771943102e-33
Smik_15.5467.20ON2881723112e-33
TBLA0E006907.20ON2781953102e-33
ADR401C7.20ON2792323102e-33
Skud_15.5307.20ON2881953103e-33
CAGL0H06105g7.20ON2901943085e-33
YOR362C (PRE10)7.20ON2881953076e-33
Suva_8.4197.20ON2921723069e-33
KAFR0C050007.20ON2811953051e-32
KLLA0A03487g7.20ON2751723005e-32
Ecym_50197.20ON2852323007e-32
NCAS0I002507.20ON2921722982e-31
Ecym_72334.110ON2462482952e-31
SAKL0D14476g7.20ON2811942945e-31
KNAG0E002307.20ON2791882929e-31
KLLA0A05027g4.110ON2462052901e-30
TDEL0H043107.20ON2742382911e-30
AGL089W4.110ON2461822891e-30
NDAI0A087707.20ON2921952902e-30
TBLA0C040804.110ON2532012864e-30
TPHA0N002407.20ON2771722875e-30
KNAG0E011805.1ON2331922811e-29
YMR314W (PRE5)5.1ON2342292802e-29
Kpol_1061.454.110ON2561772812e-29
Kwal_27.97208.871ON1731442743e-29
Smik_13.5315.1ON2342252783e-29
Skud_13.4885.1ON2342202741e-28
CAGL0M14003g5.1ON2332412704e-28
KLTH0B09504g5.1ON2332192705e-28
KLTH0E07788g4.110ON2461822715e-28
Suva_13.5075.1ON2342202706e-28
TPHA0F006704.110ON2571772716e-28
ZYRO0G10164g4.110ON2532022717e-28
Kwal_47.174934.110ON2461822691e-27
Kwal_26.94835.1ON2332212681e-27
YGL011C (SCL1)4.110ON2521772691e-27
SAKL0H21956g4.110ON2481842681e-27
ZYRO0C01144g5.1ON2332222662e-27
NCAS0A016404.110ON2531772673e-27
Suva_7.2704.110ON2521872663e-27
TPHA0A056705.1ON2332212643e-27
Smik_7.2794.110ON2521772646e-27
NCAS0D023105.1ON2332192636e-27
Kpol_1060.15.1ON2332192636e-27
KLLA0A10153g5.1ON2332422627e-27
Skud_7.2764.110ON2521872621e-26
CAGL0A00407g4.110ON2542402621e-26
TDEL0F023604.110ON2531792602e-26
Ecym_56505.1ON2331922592e-26
KNAG0D035404.110ON2522002577e-26
NDAI0I026405.1ON2332192541e-25
AGL336W5.1ON3062212572e-25
TBLA0C071905.1ON2332192513e-25
KAFR0I027205.1ON2352242443e-24
SAKL0H00946g5.1ON2332242434e-24
KAFR0F034304.110ON2522002411e-23
TDEL0G002405.1ON2382462225e-21
Kwal_26.68197.20ON1961501707e-14
NDAI0D035604.110ON1721031493e-11
SAKL0G04290g5.507ON2612271392e-09
Smik_15.3375.507ON2611601375e-09
KAFR0C053005.507ON2611821358e-09
Skud_15.3215.507ON2612051341e-08
KNAG0B038005.507ON2612051322e-08
Suva_8.2085.507ON2611601322e-08
NDAI0C011705.507ON2632051313e-08
YOR157C (PUP1)5.507ON2611601294e-08
ZYRO0D12034g5.507ON2611601287e-08
Kpol_534.575.216ON2152091242e-07
Kpol_2002.1095.216ON2152091242e-07
TDEL0A037105.507ON2611821252e-07
KLLA0A02233g5.507ON2621981252e-07
Kwal_47.187485.507ON2632141224e-07
AGL324W7.480ON2432041206e-07
Kpol_218.15.507ON2611601206e-07
CAGL0L04312g5.507ON2611601207e-07
TBLA0D017505.507ON2591641191e-06
Ecym_54585.507ON2582051191e-06
TPHA0E020505.507ON2611711181e-06
NCAS0A148807.480ON2412371162e-06
KAFR0B006507.480ON2412251162e-06
KNAG0F035907.480ON2482211153e-06
NDAI0J006007.480ON2412251153e-06
KLTH0G03168g5.507ON2631711154e-06
TDEL0E041305.216ON2192061144e-06
KLLA0E05633g7.480ON2401591144e-06
NCAS0H024805.507ON2642281136e-06
Smik_10.2785.216ON2162091117e-06
KLLA0F12936g5.216ON2151721117e-06
Skud_10.2225.216ON2152111117e-06
Ecym_71717.480ON2422061111e-05
YJL001W (PRE3)5.216ON2152091101e-05
TPHA0N007405.216ON2162101091e-05
CAGL0F04477g7.480ON2421731101e-05
SAKL0F15092g7.480ON2611791101e-05
TBLA0C062005.216ON2162081082e-05
Kwal_33.151935.216ON1932051072e-05
Ecym_82765.216ON2152061072e-05
TPHA0E029905.216ON2162101073e-05
TPHA0M017503.417ON2861731083e-05
TDEL0C034407.480ON2412251073e-05
TBLA0F026807.480ON2412061074e-05
KLTH0E01826g7.480ON2422251064e-05
Suva_12.805.216ON2152091064e-05
Kpol_1028.927.480ON2421831055e-05
Kwal_55.198827.480ON2422161055e-05
Suva_2.777.480ON2411731056e-05
ZYRO0B10142g5.216ON2152091047e-05
ZYRO0G17842g7.480ON2442061048e-05
KLTH0D03058g3.417ON2871811049e-05
SAKL0G12584g5.216ON2152091011e-04
TDEL0C055403.417ON2871771021e-04
TBLA0F017603.417ON2872021022e-04
TPHA0E004207.480ON2412251012e-04
Smik_2.737.480ON2412061002e-04
YBL041W (PRE7)7.480ON2412061003e-04
AAL172C5.216ON215206993e-04
Skud_2.617.480ON241173993e-04
NDAI0A048603.417ON2871731003e-04
AEL326C3.417ON285198994e-04
KLTH0B03102g5.216ON215209984e-04
CAGL0G01804g3.417ON286173977e-04
Kwal_26.72733.417ON287173977e-04
AAR119W5.507ON259174968e-04
Kpol_1018.1443.417ON288173960.001
Skud_16.3883.417ON287204960.001
Suva_16.4293.417ON287204960.001
NCAS0A114403.417ON287173950.001
KAFR0C063505.216ON216207940.001
KNAG0A075203.417ON287177950.001
ZYRO0C17688g3.417ON287198950.001
NDAI0C024205.216ON216212930.002
KNAG0H024505.216ON216207930.002
YPR103W (PRE2)3.417ON287217930.002
CAGL0D03058g5.216ON215206920.002
Ecym_26143.417ON285169930.002
Smik_16.3433.417ON287173930.003
KLLA0F08228g3.417ON285173920.003
KAFR0D042103.417ON287173920.003
SAKL0B09262g3.417ON287173860.017
NCAS0A014805.216ON216210850.018
Smik_7.1736.159ON34942760.39
KLLA0B11660g7.162ON195161720.84
Kwal_55.210287.162ON195160682.6
AAR019W7.162ON195159682.6
TPHA0A007303.106ON717104693.1
KLTH0G00550g3.574ON265192673.4
KLTH0F13750g7.162ON195159673.5
KLTH0C07348g3.269ON316127665.1
TDEL0B071102.618ON888106676.0
Skud_5.1167.162ON198168656.3
Ecym_12647.162ON195161656.5
TBLA0C017408.651ON52482658.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_480.10
         (259 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON} ...   499   0.0  
YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3...   471   e-170
Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W (...   471   e-170
Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W (...   469   e-169
Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W (...   465   e-168
ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {O...   464   e-167
NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON...   462   e-167
NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499     462   e-166
TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3....   461   e-166
KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.49...   459   e-165
SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {O...   455   e-164
TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3....   454   e-163
CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa] ...   450   e-162
KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON...   443   e-159
Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON} ...   441   e-158
Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR13...   437   e-157
KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {O...   437   e-156
KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {O...   433   e-155
AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic h...   430   e-154
TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON...   404   e-144
Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa] ...   162   1e-48
ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON} S...   162   2e-48
KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871...   162   2e-48
SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly ...   162   3e-48
KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 2...   161   4e-48
Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa] ...   161   5e-48
TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON...   160   1e-47
NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON...   159   2e-47
TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {...   159   2e-47
AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic h...   159   3e-47
KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highl...   158   6e-47
Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906...   157   1e-46
NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64      157   2e-46
CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {O...   157   2e-46
Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON} ...   157   3e-46
KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64...   156   4e-46
NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120     156   4e-46
CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {O...   155   6e-46
KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.8...   155   7e-46
KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly si...   155   8e-46
TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64...   155   1e-45
KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly ...   155   1e-45
KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON...   154   2e-45
ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {O...   154   3e-45
TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.1...   154   3e-45
KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {O...   153   3e-45
SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 a...   153   4e-45
NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON} ...   152   6e-45
SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,...   152   7e-45
TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8....   152   8e-45
KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}...   153   9e-45
KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893) ...   152   9e-45
Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON} ...   151   2e-44
NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120     151   2e-44
Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432) ...   151   2e-44
Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON} ...   151   3e-44
YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}  PR...   150   4e-44
ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {O...   150   5e-44
CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {O...   150   6e-44
AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, ...   150   6e-44
Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON} ...   150   7e-44
Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W...   150   7e-44
TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.12...   150   7e-44
Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131...   149   1e-43
YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha ...   149   1e-43
YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}  P...   150   1e-43
Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W...   149   1e-43
Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}...   149   2e-43
TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871 ...   149   2e-43
Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C (R...   149   3e-43
Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON} (2523...   149   3e-43
Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}...   149   3e-43
Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa] ...   148   4e-43
NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON} ...   147   7e-43
Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W...   147   7e-43
TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON...   147   9e-43
TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {...   147   1e-42
ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}...   145   4e-42
KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {O...   140   7e-40
ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly si...   126   2e-34
Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON} ...   125   5e-34
KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {...   124   2e-33
Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {O...   124   2e-33
TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON...   124   2e-33
ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 ...   124   2e-33
Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {O...   124   3e-33
CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly ...   123   5e-33
YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}...   122   6e-33
Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}...   122   9e-33
KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20...   122   1e-32
KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 a...   120   5e-32
Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}...   120   7e-32
NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON} ...   119   2e-31
Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to...   118   2e-31
SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369) ...   117   5e-31
KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20 Y...   117   9e-31
KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly ...   116   1e-30
TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON...   116   1e-30
AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic hom...   115   1e-30
NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {...   116   2e-30
TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON...   114   4e-30
TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20 ...   115   5e-30
KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON...   112   1e-29
YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha ...   112   2e-29
Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {...   112   2e-29
Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON} ...   110   3e-29
Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W...   111   3e-29
Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W...   110   1e-28
CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} high...   108   4e-28
KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {O...   108   5e-28
KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly ...   108   5e-28
Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W...   108   6e-28
TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.11...   108   6e-28
ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly ...   108   7e-28
Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C...   108   1e-27
Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {...   107   1e-27
YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}  S...   108   1e-27
SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highl...   107   1e-27
ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}...   107   2e-27
NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON...   107   3e-27
Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}...   107   3e-27
TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON}             106   3e-27
Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}...   106   6e-27
NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON...   105   6e-27
Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON} c...   105   6e-27
KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {O...   105   7e-27
Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}...   105   1e-26
CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly si...   105   1e-26
TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON...   104   2e-26
Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON...   104   2e-26
KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON...   103   7e-26
NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1       102   1e-25
AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homol...   103   2e-25
TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5....   101   3e-25
KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1 ...    99   3e-24
SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly ...    98   4e-24
KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON...    97   1e-23
TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON} ...    90   5e-21
Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C (P...    70   7e-14
NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON...    62   3e-11
SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly ...    58   2e-09
Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {O...    57   5e-09
KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5....    57   8e-09
Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {O...    56   1e-08
KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON...    55   2e-08
Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}...    55   2e-08
NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON...    55   3e-08
YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}  ...    54   4e-08
ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highl...    54   7e-08
Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON} (145742....    52   2e-07
Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON} (2589...    52   2e-07
TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.50...    53   2e-07
KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {O...    53   2e-07
Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {O...    52   4e-07
AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic hom...    51   6e-07
Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON} comp...    51   6e-07
CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {...    51   7e-07
TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON...    50   1e-06
Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to...    50   1e-06
TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON...    50   1e-06
NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {...    49   2e-06
KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.48...    49   2e-06
KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON...    49   3e-06
NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.4...    49   3e-06
KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly ...    49   4e-06
TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 ...    49   4e-06
KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {O...    49   4e-06
NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507      48   6e-06
Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 a...    47   7e-06
KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590) ...    47   7e-06
Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 a...    47   7e-06
Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON} ...    47   1e-05
YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {...    47   1e-05
TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.2...    47   1e-05
CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {O...    47   1e-05
SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highl...    47   1e-05
TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5....    46   2e-05
Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL00...    46   2e-05
Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp...    46   2e-05
TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON...    46   3e-05
TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.4...    46   3e-05
TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON...    46   3e-05
TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON...    46   4e-05
KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly ...    45   4e-05
Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa...    45   4e-05
Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON} (21109...    45   5e-05
Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W...    45   5e-05
Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W (R...    45   6e-05
ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648...    45   7e-05
ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa] ...    45   8e-05
KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {O...    45   9e-05
SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137) ...    44   1e-04
TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.41...    44   1e-04
TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON...    44   2e-04
TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480 ...    44   2e-04
Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W (R...    43   2e-04
YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6 ...    43   3e-04
AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 ...    43   3e-04
Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W (R...    43   3e-04
NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {...    43   3e-04
AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON} Synt...    43   4e-04
KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648...    42   4e-04
CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {O...    42   7e-04
Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON...    42   7e-04
AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic hom...    42   8e-04
Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa] ...    42   0.001
Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W...    42   0.001
Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W...    42   0.001
NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3....    41   0.001
KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [...    41   0.001
KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3....    41   0.001
ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highl...    41   0.001
NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON...    40   0.002
KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 ...    40   0.002
YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5...    40   0.002
CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {O...    40   0.002
Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar ...    40   0.002
Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W...    40   0.003
KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {O...    40   0.003
KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.41...    40   0.003
SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly ...    38   0.017
NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON...    37   0.018
Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W ...    34   0.39 
KLLA0B11660g Chr2 complement(1024265..1024852) [588 bp, 195 aa] ...    32   0.84 
Kwal_55.21028 s55 (654604..655191) [588 bp, 195 aa] {ON} YER012W...    31   2.6  
AAR019W Chr1 (375421..376008) [588 bp, 195 aa] {ON} Syntenic hom...    31   2.6  
TPHA0A00730 Chr1 (131951..134104) [2154 bp, 717 aa] {ON} Anc_3.1...    31   3.1  
KLTH0G00550g Chr7 (38715..39512) [798 bp, 265 aa] {ON} highly si...    30   3.4  
KLTH0F13750g Chr6 (1126220..1126807) [588 bp, 195 aa] {ON} highl...    30   3.5  
KLTH0C07348g Chr3 (636295..637245) [951 bp, 316 aa] {ON} weakly ...    30   5.1  
TDEL0B07110 Chr2 complement(1254814..1257480) [2667 bp, 888 aa] ...    30   6.0  
Skud_5.116 Chr5 (174986..175582) [597 bp, 198 aa] {ON} YER012W (...    30   6.3  
Ecym_1264 Chr1 complement(543133..543720) [588 bp, 195 aa] {ON} ...    30   6.5  
TBLA0C01740 Chr3 (409315..410889) [1575 bp, 524 aa] {ON} Anc_8.6...    30   8.0  

>Kpol_480.10 s480 complement(20212..20991) [780 bp, 259 aa] {ON}
           complement(20212..20991) [780 nt, 260 aa]
          Length = 259

 Score =  499 bits (1285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 246/246 (100%), Positives = 246/246 (100%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ
Sbjct: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQLLLK 240
           KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQLLLK
Sbjct: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQLLLK 240

Query: 241 TGITKK 246
           TGITKK
Sbjct: 241 TGITKK 246

>YGR135W Chr7 (761392..762168) [777 bp, 258 aa] {ON}  PRE9Alpha 3
           subunit of the 20S proteasome, the only nonessential 20S
           subunit; may be replaced by the alpha 4 subunit (Pre6p)
           under stress conditions to create a more active
           proteasomal isoform
          Length = 258

 Score =  471 bits (1213), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 229/247 (92%), Positives = 242/247 (97%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           TSTEK+Y+LNDKI VAVAGLTADAEILINTAR+HAQ YLKTYNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGEND-KIYQKIFKPEEIKQLLL 239
           KDD+KVD+AIELALKTLSKTTDSSALTYDR+EFATI+KG ND ++YQKIFKP+EIK +L+
Sbjct: 181 KDDMKVDDAIELALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDILV 240

Query: 240 KTGITKK 246
           KTGITKK
Sbjct: 241 KTGITKK 247

>Smik_6.231 Chr6 (379282..380058) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  471 bits (1211), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 229/247 (92%), Positives = 243/247 (98%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           TSTEK+Y+LNDKI+VAVAGLTADAEILINTAR+HAQ YLKTYNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKISVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGEND-KIYQKIFKPEEIKQLLL 239
           KDD+KVD+AI+LALKTLSKTTDSSALTYDR+EFATI+KG ND ++YQKIFKP+EIK LL+
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGVNDGEVYQKIFKPQEIKDLLV 240

Query: 240 KTGITKK 246
           KTGITKK
Sbjct: 241 KTGITKK 247

>Suva_7.423 Chr7 (731573..732349) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  469 bits (1207), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 228/247 (92%), Positives = 242/247 (97%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           TSTEK+Y+LNDKI VAVAGLTADAEILINTARVHAQ YLK+YNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKSYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAG+DDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGEND-KIYQKIFKPEEIKQLLL 239
           KDD+KVD+AI+LALKTLSKTTDSSALTYDR+EFATI+KG ND ++YQKIFKP+EIK LL+
Sbjct: 181 KDDMKVDDAIDLALKTLSKTTDSSALTYDRLEFATIRKGANDGEVYQKIFKPQEIKDLLV 240

Query: 240 KTGITKK 246
           KTGITKK
Sbjct: 241 KTGITKK 247

>Skud_7.446 Chr7 (740583..741359) [777 bp, 258 aa] {ON} YGR135W
           (REAL)
          Length = 258

 Score =  465 bits (1197), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 227/247 (91%), Positives = 241/247 (97%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           TSTEK+Y+LNDKI VAVAGLTADAEILINTARVHAQ YLKTYNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKIAVAVAGLTADAEILINTARVHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAG+DDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGHDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGEND-KIYQKIFKPEEIKQLLL 239
           K+D+KVD AI+LALKTLSKTTDSSALTYDR+EFATI+KG ND ++YQKIFKP+EIK LL+
Sbjct: 181 KEDMKVDGAIDLALKTLSKTTDSSALTYDRLEFATIRKGPNDGEVYQKIFKPQEIKDLLV 240

Query: 240 KTGITKK 246
           KTGI+KK
Sbjct: 241 KTGISKK 247

>ZYRO0D09746g Chr4 complement(825992..826753) [762 bp, 253 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 253

 Score =  464 bits (1193), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 226/245 (92%), Positives = 236/245 (96%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           TSTEK+YRLNDKI VAVAGLT+DAEILINTAR+HAQ YLKTYNE+IPVEILV+RLSDIKQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTSDAEILINTARIHAQNYLKTYNEDIPVEILVKRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQLLLK 240
           KDDIKVD AIELALKTLSKTTDSSALTYDRVEFATIK GEN K+YQK+FKPEEI+ LL+K
Sbjct: 181 KDDIKVDGAIELALKTLSKTTDSSALTYDRVEFATIKLGENGKLYQKVFKPEEIQTLLVK 240

Query: 241 TGITK 245
            GITK
Sbjct: 241 NGITK 245

>NDAI0G00890 Chr7 complement(186538..187302) [765 bp, 254 aa] {ON}
           Anc_3.499
          Length = 254

 Score =  462 bits (1190), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 223/247 (90%), Positives = 241/247 (97%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT IGIM  DGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTGIGIMVPDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           TS EK+Y+LNDKITVAVAGLTADAEILINTAR+HAQ YLKTYNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSIEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGEND-KIYQKIFKPEEIKQLLL 239
           KDD+++DEAIELALKTLSKTTDSS+LTYD++EFATIKKG+ND ++YQKI+KP+EIK+LL+
Sbjct: 181 KDDMRLDEAIELALKTLSKTTDSSSLTYDKLEFATIKKGKNDGEVYQKIYKPDEIKELLI 240

Query: 240 KTGITKK 246
           KTG+TKK
Sbjct: 241 KTGVTKK 247

>NCAS0E00760 Chr5 (139964..140743) [780 bp, 259 aa] {ON} Anc_3.499
          Length = 259

 Score =  462 bits (1189), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 225/247 (91%), Positives = 241/247 (97%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DG+VLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMADDGLVLAAERKVTSTLLEQD 60

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           TSTEK+Y+LNDKITVAVAGLTADAEILINTARV+AQ YLKTYNEEIPVEILVRRLSDIKQ
Sbjct: 61  TSTEKLYKLNDKITVAVAGLTADAEILINTARVYAQSYLKTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKG-ENDKIYQKIFKPEEIKQLLL 239
           KD++K+D+AIELALKTLSKTTDSS+LTYD++E ATIKKG   D++YQKI+KPEE+K+LLL
Sbjct: 181 KDNMKLDDAIELALKTLSKTTDSSSLTYDKLELATIKKGTTTDEVYQKIYKPEELKELLL 240

Query: 240 KTGITKK 246
           KTGITKK
Sbjct: 241 KTGITKK 247

>TPHA0A05700 Chr1 (1291206..1291976) [771 bp, 256 aa] {ON} Anc_3.499
           YGR135W
          Length = 256

 Score =  461 bits (1186), Expect = e-166,   Method: Compositional matrix adjust.
 Identities = 223/246 (90%), Positives = 238/246 (96%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAEDGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           TSTEK+Y+LND ITVAVAGLTADAEILINTARV AQ YL+TYNE+IPVE+LVR+LSDIKQ
Sbjct: 61  TSTEKLYKLNDNITVAVAGLTADAEILINTARVFAQNYLQTYNEDIPVEVLVRKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD+R GYQL+TSNPSGNYTGWKAISVGANTSAAQTLLQM++
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERLGYQLFTSNPSGNYTGWKAISVGANTSAAQTLLQMEF 180

Query: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQLLLK 240
           KDDIK++ AIELALKTLSKTTDSSALTYDRVEFATIKKGEN+K+YQKI+KPEEIKQLL K
Sbjct: 181 KDDIKLEGAIELALKTLSKTTDSSALTYDRVEFATIKKGENNKVYQKIYKPEEIKQLLSK 240

Query: 241 TGITKK 246
            GITKK
Sbjct: 241 AGITKK 246

>KAFR0C02020 Chr3 (400697..401473) [777 bp, 258 aa] {ON} Anc_3.499
           YGR135W
          Length = 258

 Score =  459 bits (1180), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 223/247 (90%), Positives = 237/247 (95%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSALLEQD 60

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           TS EK+Y+LNDKITVAVAGLTADAEILINTAR+HAQ YLKTYNE+IPVEILVRRLSDIKQ
Sbjct: 61  TSVEKLYKLNDKITVAVAGLTADAEILINTARIHAQNYLKTYNEDIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD+RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGE-NDKIYQKIFKPEEIKQLLL 239
           KD+I +D+A+ELALKTLSK TDSS LTYDR+EFATIKKG+ NDKIYQKIF P+EIK LL+
Sbjct: 181 KDEITLDDAMELALKTLSKVTDSSTLTYDRLEFATIKKGKTNDKIYQKIFTPDEIKSLLV 240

Query: 240 KTGITKK 246
           KTGI+KK
Sbjct: 241 KTGISKK 247

>SAKL0F02530g Chr6 complement(218391..219149) [759 bp, 252 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 252

 Score =  455 bits (1170), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 221/246 (89%), Positives = 236/246 (95%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           TS+EK+Y+LND ITVAVAGLTADAEILINTARV+AQ YL+TYNEEIPVEILVRRLSDIKQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVYAQNYLQTYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD+RYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDERYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQLLLK 240
           KD I +D AIELALKTLSKTTDSSALT+DR+EFATIKKG N ++YQKI+KP+EI+ LL K
Sbjct: 181 KDGINLDGAIELALKTLSKTTDSSALTHDRIEFATIKKGSNGQLYQKIYKPQEIQTLLSK 240

Query: 241 TGITKK 246
           TGITKK
Sbjct: 241 TGITKK 246

>TDEL0D05670 Chr4 (1020517..1021284) [768 bp, 255 aa] {ON} Anc_3.499
           YGR135W
          Length = 255

 Score =  454 bits (1167), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 221/246 (89%), Positives = 237/246 (96%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA+DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMATDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           TSTEK+YRLNDKITVAVAGLTADAEILINTARV+AQ YL+TYNE+IPVEILV+RLSDIKQ
Sbjct: 61  TSTEKLYRLNDKITVAVAGLTADAEILINTARVYAQNYLRTYNEDIPVEILVKRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ+DY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQVDY 180

Query: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQLLLK 240
           KDD+K++ AIELALKTLSKTTDSSALT DR+EFATI+K  + K+YQKIFKPEEI+ LL+K
Sbjct: 181 KDDVKLEGAIELALKTLSKTTDSSALTNDRIEFATIQKAPDGKLYQKIFKPEEIQSLLVK 240

Query: 241 TGITKK 246
            GITKK
Sbjct: 241 HGITKK 246

>CAGL0I10406g Chr9 complement(1030282..1031055) [774 bp, 257 aa]
           {ON} highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135w proteasome subunit Y13
          Length = 257

 Score =  450 bits (1157), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 217/247 (87%), Positives = 238/247 (96%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIM S+GIVLAAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTSEGIVLAAERKVTSTLLEQD 60

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           TSTEK+Y+LND+ TVAVAGLTADAEILINTAR+HAQ YLKTYNEEIPVE+LVR+LSDIKQ
Sbjct: 61  TSTEKLYKLNDRTTVAVAGLTADAEILINTARIHAQNYLKTYNEEIPVEMLVRKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQ+GGLRP+GVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQYGGLRPYGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATI-KKGENDKIYQKIFKPEEIKQLLL 239
           KD++ +D+A+ELALKTLSKTTDSS+LTYDR+EFAT+ KKGE ++  QKIFKP EIKQLL+
Sbjct: 181 KDEMTLDDAVELALKTLSKTTDSSSLTYDRLEFATLKKKGETEEFEQKIFKPAEIKQLLI 240

Query: 240 KTGITKK 246
           KTGI+KK
Sbjct: 241 KTGISKK 247

>KNAG0B00760 Chr2 complement(141533..142312) [780 bp, 259 aa] {ON}
           Anc_3.499 YGR135W
          Length = 259

 Score =  443 bits (1140), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 214/247 (86%), Positives = 233/247 (94%), Gaps = 1/247 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG++A DGIV+AAERKVTSTLLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVLAQDGIVIAAERKVTSTLLEQD 60

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           TSTEK+YRLNDKI VAVAGLTADAEILINTARVH Q YLKTY E+IPVE+LV+R+SDIKQ
Sbjct: 61  TSTEKLYRLNDKIVVAVAGLTADAEILINTARVHCQNYLKTYGEDIPVEMLVKRMSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAG DDRYG+QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY
Sbjct: 121 SYTQHGGLRPFGVSFIYAGVDDRYGFQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKG-ENDKIYQKIFKPEEIKQLLL 239
           KD+I ++EA ELALKTLSKTTDSSALTYDRVEF+TIK+G E  ++ QKI+KP EIKQLL+
Sbjct: 181 KDEITLEEATELALKTLSKTTDSSALTYDRVEFSTIKRGKEEGQVIQKIYKPSEIKQLLV 240

Query: 240 KTGITKK 246
           K+GITKK
Sbjct: 241 KSGITKK 247

>Ecym_1230 Chr1 complement(475398..476153) [756 bp, 251 aa] {ON}
           similar to Ashbya gossypii AFR318W
          Length = 251

 Score =  441 bits (1134), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 214/246 (86%), Positives = 229/246 (93%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           TS+EK+YRLND ITVAVAGLTADAEILINTAR+HAQ YLK YNEEIPVEILVRRLSDIKQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILINTARLHAQNYLKMYNEEIPVEILVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANT AAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQLLLK 240
           KD+I  + AIELALKTLSKTTD+S+LT DR+EFATIK+  N K+ QKI+KP EIK+LL K
Sbjct: 181 KDEITFENAIELALKTLSKTTDNSSLTDDRLEFATIKQDSNGKLVQKIYKPSEIKELLQK 240

Query: 241 TGITKK 246
           +GI K+
Sbjct: 241 SGIMKQ 246

>Kwal_47.18898 s47 (1019765..1020520) [756 bp, 251 aa] {ON} YGR135W
           (PRE9) - proteasome component Y13 [contig 189] FULL
          Length = 251

 Score =  437 bits (1124), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 214/246 (86%), Positives = 226/246 (91%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIG+MA DGIVLAAERKVTS LLEQ 
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           +S+EK+Y+LND ITVAVAGLTADAEILINTAR+ AQ YLKTYNEEIPVEILVRRLSD+KQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKTYNEEIPVEILVRRLSDVKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYDDR+GYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRFGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQLLLK 240
           KDDI V EA ELALKTLSKTTDSS LT +RVEFATI K EN KI QKIFKP EI+ LL +
Sbjct: 181 KDDITVKEATELALKTLSKTTDSSTLTSERVEFATITKLENGKIAQKIFKPREIETLLNE 240

Query: 241 TGITKK 246
           TGI KK
Sbjct: 241 TGINKK 246

>KLTH0G02376g Chr7 complement(185961..186716) [756 bp, 251 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 251

 Score =  437 bits (1123), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 212/246 (86%), Positives = 229/246 (93%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRR+DSRTTIFSPEGRLYQVEYALESISHAGTAIG+MA DGIVLAAERKVTS LLEQ 
Sbjct: 1   MGSRRFDSRTTIFSPEGRLYQVEYALESISHAGTAIGVMAKDGIVLAAERKVTSKLLEQG 60

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           +S+EK+Y+LND ITVAVAGLTADAEILINTAR+ AQ YLK+YNEEIPVEILVRRLSD+KQ
Sbjct: 61  SSSEKLYKLNDNITVAVAGLTADAEILINTARLFAQNYLKSYNEEIPVEILVRRLSDVKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFG SFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANTSAAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGASFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQLLLK 240
           KDDI V+EA ELALKTLSKTTDSS LT +RVEF+TI K +N KI QKIFKP+EI+ LL K
Sbjct: 181 KDDITVEEATELALKTLSKTTDSSTLTPERVEFSTITKLDNGKIAQKIFKPQEIETLLNK 240

Query: 241 TGITKK 246
           TG+TKK
Sbjct: 241 TGVTKK 246

>KLLA0E03917g Chr5 complement(356540..357289) [750 bp, 249 aa] {ON}
           highly similar to uniprot|P23638 Saccharomyces
           cerevisiae YGR135W PRE9 20S proteasome beta-type subunit
           the only nonessential 20S subunit
          Length = 249

 Score =  433 bits (1114), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 213/246 (86%), Positives = 224/246 (91%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIM   GIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMTEQGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           TS+EK+Y+LND ITVAVAGLTADAEILINTARV AQ YLKTYNEEIPVE+LVRRLSD+KQ
Sbjct: 61  TSSEKLYKLNDNITVAVAGLTADAEILINTARVQAQSYLKTYNEEIPVEMLVRRLSDLKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNY+GWKAISVGANT AAQTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYSGWKAISVGANTQAAQTLLQMDY 180

Query: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQLLLK 240
           KDDI +D AIELALKTLSKTTDSS LT++R+EFATI K    KIYQKI+KP EI  LL K
Sbjct: 181 KDDITLDGAIELALKTLSKTTDSSVLTHERLEFATISKDAEGKIYQKIYKPTEIATLLEK 240

Query: 241 TGITKK 246
           T I KK
Sbjct: 241 TEIVKK 246

>AFR318W Chr6 (1013015..1013770) [756 bp, 251 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR135W (PRE9)
          Length = 251

 Score =  430 bits (1105), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 207/246 (84%), Positives = 227/246 (92%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMA DGIVLAAERKVTS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMAKDGIVLAAERKVTSKLLEQD 60

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           TS+EK+YRLND ITVAVAGLTADAEIL+NTAR+HAQ YLK YNEEIPVE+LVRRLSDIKQ
Sbjct: 61  TSSEKLYRLNDNITVAVAGLTADAEILVNTARLHAQNYLKMYNEEIPVEVLVRRLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GYTQHGGLRPFGVSFIYAGYD RYGYQLYTSNPSGNY+GWKAISVGANT A QTLLQMDY
Sbjct: 121 GYTQHGGLRPFGVSFIYAGYDARYGYQLYTSNPSGNYSGWKAISVGANTQAVQTLLQMDY 180

Query: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQLLLK 240
           KDD+  D+AI+LALKTLSKTTDSS+L+++R+EFATI++  + K+ QKI+K  EIK LL K
Sbjct: 181 KDDLTFDDAIKLALKTLSKTTDSSSLSHERLEFATIQRNADGKVVQKIYKLGEIKDLLEK 240

Query: 241 TGITKK 246
           TGI K+
Sbjct: 241 TGINKQ 246

>TBLA0D02920 Chr4 complement(718377..719153) [777 bp, 258 aa] {ON}
           Anc_3.499 YGR135W
          Length = 258

 Score =  404 bits (1039), Expect = e-144,   Method: Compositional matrix adjust.
 Identities = 199/248 (80%), Positives = 219/248 (88%), Gaps = 2/248 (0%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGT+IGIM+ DGIVL AERK+TS LLEQD
Sbjct: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTSIGIMSKDGIVLLAERKITSKLLEQD 60

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
              EK+Y+L+DKIT+AVAGLTADAEILIN AR  AQ YL TYNEEIPVEILV++LSDIKQ
Sbjct: 61  ILNEKLYKLSDKITLAVAGLTADAEILINIARQFAQNYLMTYNEEIPVEILVKKLSDIKQ 120

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
            YTQHGGLRPFGVSFIYAGYDD  G QLYTSNPSGNYTGWKAIS+GANTSAAQTLLQMDY
Sbjct: 121 SYTQHGGLRPFGVSFIYAGYDDILGPQLYTSNPSGNYTGWKAISIGANTSAAQTLLQMDY 180

Query: 181 KDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIK--KGENDKIYQKIFKPEEIKQLL 238
           KDD+ +++A+EL LKTLSKTTDSS LTYDRVE + IK  K  ++KI QKI+ P EIKQLL
Sbjct: 181 KDDMNLNDAMELGLKTLSKTTDSSNLTYDRVELSIIKIDKENDNKIIQKIYNPAEIKQLL 240

Query: 239 LKTGITKK 246
           +K GI KK
Sbjct: 241 IKFGINKK 248

>Ecym_8151 Chr8 (318925..318968,319052..319760) [753 bp, 250 aa]
           {ON} similar to Ashbya gossypii ADL354W 1-intron
          Length = 250

 Score =  162 bits (411), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 92/247 (37%), Positives = 145/247 (58%), Gaps = 16/247 (6%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A++G+V+A E+K  STL   DT  +
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANSTLTLTDT-LD 62

Query: 65  KIYRLNDKITVAVAGLTADAEILINTARVHA-QEYLKTYNEEIPVEILVRRLSDIKQGYT 123
           KI ++   I    +G+  D  +LIN +R  A   Y+KTY E  P +ILV +++ I Q  T
Sbjct: 63  KISKITPDIGAVYSGMGPDFRVLINKSRKTAYGSYMKTYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+   + LY  +PSG+Y  WKA ++G   +AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDNHNEFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNNE 182

Query: 184 IKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQ------------KIFKP 231
           +++++AI +AL TL ++ +      + +E A I + END +              + F P
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGETIEVAVIGE-ENDDLLGYKGDATARGPRFRKFTP 240

Query: 232 EEIKQLL 238
           +EI   L
Sbjct: 241 QEINDRL 247

>ADL354W Chr4 (85188..85231,85297..86005) [753 bp, 250 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YML092C
           (PRE8); 1-intron
          Length = 250

 Score =  162 bits (410), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 85/221 (38%), Positives = 138/221 (62%), Gaps = 4/221 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A++G+V+A E+K  +TL  +DT  +
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKANTTLTIKDT-LD 62

Query: 65  KIYRLNDKITVAVAGLTADAEILINTARVHA-QEYLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+ ++   I    +G+  D  +LIN +R  A   Y K Y E  P +ILV +++ I Q  T
Sbjct: 63  KVSQITPDIGAVYSGMGPDFRVLINKSRKTAYGSYRKAYGEYPPTKILVSQIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 IKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKI 224
           +++++AI +AL TL ++ +      + +E A + + END +
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGETIELAVVGE-ENDDM 221

>KNAG0J00180 Chr10 (20275..21027) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  162 bits (409), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 83/221 (37%), Positives = 136/221 (61%), Gaps = 3/221 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A++G+V+A E+K +S L   DT + 
Sbjct: 4   RYAFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKATNGVVIATEKKSSSPLALTDTLS- 62

Query: 65  KIYRLNDKITVAVAGLTADAEILINTAR-VHAQEYLKTYNEEIPVEILVRRLSDIKQGYT 123
           KI  +   I    +G+  D  +L++ +R V    Y + YNE  P ++LV  ++++ Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEVMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYDD  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDDHRGFSLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 IKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKI 224
           +++++AI +AL TL ++ +      D +E   I +  ND++
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIGIIGEPNNDQL 222

>SAKL0H02068g Chr8 (202802..203587) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  162 bits (409), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 97/238 (40%), Positives = 141/238 (59%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  S+G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK----QG 121
           I  ++  I  A++GLTADA  +I  ARV A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARVSAVTHNLYYDEDIGVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYDAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQL 237
           +   + + EA  L LK L +  +   L  +  + +++ + E  KIY      E IK+L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSSVTRDEGFKIYSDEKTAEIIKEL 243

>KLTH0E16324g Chr5 (1450336..1450379,1450467..1451175) [753 bp, 250
           aa] {ON} similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  161 bits (407), Expect = 4e-48,   Method: Compositional matrix adjust.
 Identities = 84/219 (38%), Positives = 134/219 (61%), Gaps = 3/219 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A++G+++A E+K TS+L   + S  
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIRATNGVIIATEKKSTSSLALTE-SLS 62

Query: 65  KIYRLNDKITVAVAGLTADAEILINTAR-VHAQEYLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  +   I  A +G+  D  +LI+ +R V    Y + YNE  P +ILV  ++ I Q  T
Sbjct: 63  KVAHITPDIGAAYSGMGPDFRVLIDKSRKVAHTHYKRIYNEYPPTKILVAEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+  GY LY  +PSG+Y  WKA ++G   +AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDE 182

Query: 184 IKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGEND 222
           +++++AI +AL TL ++ +      D +E A + +   D
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAVVGEENQD 220

>Kwal_56.24780 s56 complement(1144302..1145090) [789 bp, 262 aa]
           {ON} YGR253C (PUP2) - 1:1 [contig 160] FULL
          Length = 262

 Score =  161 bits (407), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 91/226 (40%), Positives = 135/226 (59%), Gaps = 8/226 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+  S+G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLEGD-SIEK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK----QG 121
           I  +   +  A++GLTADA  +I  ARV A  +   Y+EEI VE L + + D+     +G
Sbjct: 67  IVEIERHVGCAMSGLTADARSMIEHARVSAVTHNLYYDEEISVESLTQSICDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDQEQGYQLYHAEPSGTFYRFNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIY 225
           +   + + EA  L L+ L +  +   L  D  + +++ K +  K+Y
Sbjct: 187 WHSSLTLKEAELLVLRILKQVMEEK-LDEDNAQLSSVTKEDGFKVY 231

>TPHA0H01190 Chr8 complement(263603..264385) [783 bp, 260 aa] {ON}
           Anc_5.64 YGR253C
          Length = 260

 Score =  160 bits (405), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 138/238 (57%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK----QG 121
           I  ++  I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  ILEIDRHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++GA +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDEGYQLYHAEPSGTFYRYNAKAIGAGSEGAQSELQNE 186

Query: 180 YKDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQL 237
           +   + + EA  L LK L +  +   L  +  + ++I K E  KIY      E +KQ+
Sbjct: 187 WHSSLTLKEAELLVLKVLKQVMEEK-LDENNTQLSSITKDEGFKIYTNERTAELVKQV 243

>NDAI0C03400 Chr3 complement(779360..780151) [792 bp, 263 aa] {ON}
           Anc_5.64
          Length = 263

 Score =  159 bits (403), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 138/238 (57%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  S+G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK----QG 121
           I  +   +  A++GLTADA  +I  ARV A  +   Y+E++ VE L + + D+     +G
Sbjct: 67  IVEIEHHVGCAMSGLTADARSMIEHARVAAVNHNLYYDEDMKVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYDD  GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDDDEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQL 237
           +   + + EA  L LK L +  +   L  +  + + I K    +IY      E IK++
Sbjct: 187 WHSSLTLREAEVLVLKILKQVMEEK-LDENNAQLSCITKDNGFQIYDNAKTAEIIKEM 243

>TBLA0C06620 Chr3 complement(1598566..1599354) [789 bp, 262 aa] {ON}
           Anc_5.64 YGR253C
          Length = 262

 Score =  159 bits (403), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 96/238 (40%), Positives = 138/238 (57%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  S+G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSRLLESD-SIEK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK----QG 121
           I  +   I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIEKHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQL 237
           +   + + EA  L LK L +  +   L  + V+ + + K E  KIY      E IK+L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LNENNVQLSCVTKEEGFKIYSDEKLSEIIKEL 243

>AER296W Chr5 (1181448..1182230) [783 bp, 260 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR253C (PUP2)
          Length = 260

 Score =  159 bits (401), Expect = 3e-47,   Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 142/238 (59%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK----QG 121
           I  ++  I  A++GLTADA  +I  AR+ +  +   Y+EEI VE L + + D+     +G
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEIGVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKEDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQL 237
           +   + + EA  L LK L +  +   L  +  + +++ K +  +IY +    E IK+L
Sbjct: 187 WYSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSSVTKEQGFRIYPESETAEIIKEL 243

>KLLA0B11836g Chr2 (1034800..1035564) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P40303 Saccharomyces cerevisiae
           YOL038W PRE6 20S proteasome alpha-type subunit
          Length = 254

 Score =  158 bits (400), Expect = 6e-47,   Method: Compositional matrix adjust.
 Identities = 79/204 (38%), Positives = 127/204 (62%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  +D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGADCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I ++++ + ++ AGL AD+ ILI  ARV AQ +  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY-KDD 183
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A S+G N++  +  L+ +Y K++
Sbjct: 124 GGVRPFGVSVLIAGFDPRDNKPRLYQTEPSGIYSAWCAQSIGRNSNTVREFLEKNYNKNE 183

Query: 184 IKVD--EAIELALKTLSKTTDSSA 205
              D  E ++L +K+L +   + A
Sbjct: 184 PPADEKECVKLTIKSLLEVVQTGA 207

>Kpol_1062.2 s1062 (5124..5906) [783 bp, 260 aa] {ON} (5124..5906)
           [783 nt, 261 aa]
          Length = 260

 Score =  157 bits (398), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 95/238 (39%), Positives = 137/238 (57%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTREGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK----QG 121
           I  +++ I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIDNHIGCAMSGLTADARSMIEHARTSAVTHNLYYDEDISVETLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDRDQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQL 237
           +   + + EA  L LK L +  +   L     + ++I K    KIY      E IK+L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDESNTQLSSITKENGFKIYNDDKTAELIKEL 243

>NCAS0D01340 Chr4 (244060..244845) [786 bp, 261 aa] {ON} Anc_5.64
          Length = 261

 Score =  157 bits (397), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 137/238 (57%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  S+G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK----QG 121
           I  +   I  A++GLTADA  +I  ARV A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIEHHIGCAMSGLTADARSMIEHARVAAVNHNLYYDEDIKVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD+  GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDNDEGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQL 237
           +   + + EA  L LK L +  +   L     + + + K    +IY      E IK+L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDESNAQLSCVTKENGFQIYDDAKTAEIIKEL 243

>CAGL0I02442g Chr9 complement(216120..216902) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253c PUP2
          Length = 260

 Score =  157 bits (396), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 90/238 (37%), Positives = 141/238 (59%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG++ S+G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK----QG 121
           I  ++  +  A++GLTADA  ++  ARV A  +   Y+E+I +E L + + D+     +G
Sbjct: 67  IVEIDRHVGCAMSGLTADARSMLEHARVSAVTHNLYYDEDIKIESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQL 237
           +   + + EA +L LK L +  +   L  +  + ++I K +  +IY      E IK+ 
Sbjct: 187 WHSSLTLKEAEQLVLKILKQVMEEK-LDENNAQLSSITKDDGFQIYSDSKTAEIIKEF 243

>Ecym_5100 Chr5 complement(221199..221984) [786 bp, 261 aa] {ON}
           similar to Ashbya gossypii AER296W
          Length = 261

 Score =  157 bits (396), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 93/238 (39%), Positives = 140/238 (58%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  ++G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATNEGVVLGVEKRVTSPLLESD-SIEK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK----QG 121
           I  ++  I  A++GLTADA  +I  AR+ +  +   Y+EEI VE L + + D+     +G
Sbjct: 67  IVEVDKHIGCAMSGLTADARSMIEHARISSVTHNLYYDEEISVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKEEGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQL 237
           +   + + EA  L LK L +  +   L  +  + +++ +     IY +    E I+QL
Sbjct: 187 WYSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSSVTEEHGFSIYPESKTAEIIEQL 243

>KAFR0B04440 Chr2 (923770..924552) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  156 bits (395), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 92/238 (38%), Positives = 138/238 (57%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TA+GI  S+G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAVGICTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK----QG 121
           I  ++  +  A++GLTADA  +I  ARV A  +   Y+E+I +E L + + D+     +G
Sbjct: 67  IVEIDRHVGCAMSGLTADARSMIEHARVAAVSHNLYYDEDIKIESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQL 237
           +   + + EA  L LK L +  +   L  +  + + + K +  KIY      E IK L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSCVTKSDGFKIYSDEKVAEIIKDL 243

>NCAS0F01030 Chr6 (202937..203698) [762 bp, 253 aa] {ON} Anc_7.120
          Length = 253

 Score =  156 bits (394), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 78/204 (38%), Positives = 123/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI  +D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I +++  + ++ +GL AD+ ILI  ARV AQ +  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD- 183
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDNKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNRDE 183

Query: 184 --IKVDEAIELALKTLSKTTDSSA 205
               V+E + L +K+L +   + A
Sbjct: 184 PPKNVEECVRLTVKSLLEVVQTGA 207

>CAGL0H07007g Chr8 complement(694778..695530) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092c PRE8
          Length = 250

 Score =  155 bits (392), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 82/219 (37%), Positives = 133/219 (60%), Gaps = 3/219 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A++G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KIYRLNDKITVAVAGLTADAEILINTAR-VHAQEYLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R V    Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGIGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+  GY LY  +PSG+Y  WKA S+G  ++AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNNE 182

Query: 184 IKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGEND 222
           +++++AI +AL TL ++ +      D +E A I +   D
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAVIGEPNTD 220

>KAFR0L02080 Chr12 (395922..396674) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  155 bits (392), Expect = 7e-46,   Method: Compositional matrix adjust.
 Identities = 80/219 (36%), Positives = 134/219 (61%), Gaps = 3/219 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A++G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KIYRLNDKITVAVAGLTADAEILINTAR-VHAQEYLKTYNEEIPVEILVRRLSDIKQGYT 123
           KI  +   I    +G+  D  +L++ +R V    Y + YNE  P ++LV  +++I Q  T
Sbjct: 63  KIELITPDIGAVYSGMGPDYRVLVDKSRKVAHTHYKRIYNEYPPTKLLVSEIAEIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHQGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNDE 182

Query: 184 IKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGEND 222
           +++++AI +AL TL ++ +      D +E   I +   D
Sbjct: 183 LELEDAIHIALLTLKESIEGE-FNGDTIEIGVIGEPNQD 220

>KLTH0H00528g Chr8 (57753..58538) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 261

 Score =  155 bits (392), Expect = 8e-46,   Method: Compositional matrix adjust.
 Identities = 88/226 (38%), Positives = 133/226 (58%), Gaps = 8/226 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG+  S+G+VL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVATSEGVVLGVEKRVTSPLLEGD-SIEK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK----QG 121
           I  +   +  A++GLTADA  +I  ARV +  +   Y+E+I +E L + + D+     +G
Sbjct: 67  IVEIERHVGCAMSGLTADARSMIEHARVSSVTHNLYYDEDISIESLTQSICDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDSEQGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIY 225
           +   + + EA  L LK L +  +   L     + + + K +  K+Y
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDEGNAQLSCVTKEDGFKVY 231

>TDEL0G00880 Chr7 (179880..180662) [783 bp, 260 aa] {ON} Anc_5.64
           YGR253C
          Length = 260

 Score =  155 bits (391), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 91/238 (38%), Positives = 136/238 (57%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  S+G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVVLGVEKRATSPLLEAD-SIEK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I  ++  I  A++GLTADA  +I  AR  A  +   Y+E++ VE L + + D+   + + 
Sbjct: 67  IVEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDMSVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDKESGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQL 237
           +   + + EA  L LK L +  +   L  +  + ++  K +  KIY      E IK+L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSSTTKEDGFKIYDDSKTAEIIKEL 243

>KLLA0A05093g Chr1 (454423..455211) [789 bp, 262 aa] {ON} highly
           similar to uniprot|P32379 Saccharomyces cerevisiae
           YGR253C PUP2 Alpha subunit of the 20S proteasome
           involved in ubiquitin-dependent catabolism human homolog
           is subunit zeta
          Length = 262

 Score =  155 bits (391), Expect = 1e-45,   Method: Compositional matrix adjust.
 Identities = 90/226 (39%), Positives = 137/226 (60%), Gaps = 9/226 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIG++ ++GIVL  E++VTS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGVVTNEGIVLGVEKRVTSALLESD-SIEK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK----QG 121
           I  ++  I  A++GLTADA  ++  ARV+A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEVDTHIGCAMSGLTADARSMLEHARVNAVTHDLYYDEKITVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ +  GYD   G+QLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIGGYDQEQGFQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIY 225
           +   + + EA  L LK L +  +   L  +  + ++I K E  +IY
Sbjct: 187 WHSSLTLKEAESLVLKILKQVMEEK-LDENNAQLSSITK-EGFQIY 230

>KAFR0G03030 Chr7 complement(630616..631380) [765 bp, 254 aa] {ON}
           Anc_7.120 YOL038W
          Length = 254

 Score =  154 bits (389), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 77/204 (37%), Positives = 124/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+  ++ +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGTNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I ++++ I ++ +GL AD+ ILI  ARV AQ +  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLARYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD- 183
           GG+RPFGVS + AG D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGLDPRDNTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNKDE 183

Query: 184 --IKVDEAIELALKTLSKTTDSSA 205
               V+E ++L +K+L +   + A
Sbjct: 184 PPSTVEECVKLTIKSLLEVVQTGA 207

>ZYRO0C11770g Chr3 complement(920017..920799) [783 bp, 260 aa] {ON}
           highly similar to uniprot|P32379 Saccharomyces
           cerevisiae YGR253C PUP2 Alpha subunit of the 20S
           proteasome involved in ubiquitin-dependent catabolism
           human homolog is subunit zeta
          Length = 260

 Score =  154 bits (389), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 94/238 (39%), Positives = 136/238 (57%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  S+G++L  E++  S LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATSEGVILGVEKRANSPLLEAD-SIEK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK----QG 121
           I  ++  I  A++GLTADA  +I  AR  A  +   Y+E I VE L + + D+     +G
Sbjct: 67  ILEVDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDENISVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AGYD   GYQL+ + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 ASGEERLMSRPFGVALLIAGYDKDDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQL 237
           +   + + EA  L LK L +  +   L  +  + ++I K E  KIY      E IK L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSSITKEEGFKIYDDKKTAEIIKAL 243

>TBLA0J01980 Chr10 (468588..469352) [765 bp, 254 aa] {ON} Anc_7.120
           YOL038W
          Length = 254

 Score =  154 bits (388), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 77/204 (37%), Positives = 123/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++      +GI  +D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCTVGIKGTDCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I ++++ I ++ +GL AD+ ILI  ARV AQ +  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIVLSFSGLNADSRILIEKARVEAQSHKLTVEDPVTVEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD- 183
           GG+RPFG+S + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGISTLIAGFDPRDNTPRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYDRDE 183

Query: 184 --IKVDEAIELALKTLSKTTDSSA 205
                +E I+L +K+L +   + A
Sbjct: 184 PPSTAEECIKLTIKSLLEVVQTGA 207

>KLLA0D10373g Chr4 complement(876175..876927) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type
           subunit,
          Length = 250

 Score =  153 bits (387), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 130/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI +++GIV+A E+K +S+L   DT   
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALAAVKQGVTSLGIKSTNGIVIATEKKSSSSLALPDT-VS 62

Query: 65  KIYRLNDKITVAVAGLTADAEILINTAR-VHAQEYLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ AR V    Y + Y E  P +ILV  ++ I Q  T
Sbjct: 63  KVSLITPDIGAVYSGMGPDFRVLVDKARKVAHTNYKRIYGEYPPTKILVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG Y  WKA ++G  +SAA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSVLVAGHDEHNGFGLYQVDPSGAYFPWKATAIGKGSSAAKTFLEKRWNEE 182

Query: 184 IKVDEAIELALKTLSKTTDSSALTYDRVEFATI 216
           +++++AI +AL TL ++ +      D +E A +
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAIV 214

>SAKL0F04224g Chr6 (335860..335894,335967..336690) [759 bp, 252 aa]
           {ON} highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 252

 Score =  153 bits (387), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 77/204 (37%), Positives = 123/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI  +D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I +++  + ++ AGL AD+ ILI  ARV AQ +  T  + + ++ L R ++ I+Q YTQ 
Sbjct: 64  ISQIDTHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSIDYLTRYIAGIQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD- 183
           GG+RPFGVS + AG+D   G  +LY + PSG Y+ W A ++G N+   +  L+ +Y  + 
Sbjct: 124 GGVRPFGVSTLIAGFDPNDGVPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYSKEE 183

Query: 184 --IKVDEAIELALKTLSKTTDSSA 205
                 EA++L +K+L +   + A
Sbjct: 184 PPATEQEAVKLTVKSLLEVVQTGA 207

>NDAI0E00160 Chr5 complement(10576..11328) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  152 bits (385), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 131/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL +++   T+IGI A++GIV+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSIGIKATNGIVIATEKKSSSPLALTETLS- 62

Query: 65  KIYRLNDKITVAVAGLTADAEILINTAR-VHAQEYLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R V    Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHSNYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHRGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 IKVDEAIELALKTLSKTTDSSALTYDRVEFATI 216
           +++++AI +AL TL ++ +      D +E A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAVI 214

>SAKL0D00440g Chr4 complement(37327..38035,38098..38141) [753 bp,
           250 aa] {ON} highly similar to uniprot|P23639
           Saccharomyces cerevisiae YML092C PRE8 20S proteasome
           beta-type subunit
          Length = 250

 Score =  152 bits (385), Expect = 7e-45,   Method: Compositional matrix adjust.
 Identities = 79/219 (36%), Positives = 132/219 (60%), Gaps = 3/219 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A++G+++A E+K +S L   + S  
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTE-SLS 62

Query: 65  KIYRLNDKITVAVAGLTADAEILINTAR-VHAQEYLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R V    Y + Y E  P +ILV  ++   Q  T
Sbjct: 63  KVALITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKILVSEIAKTMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+  GY LY  +PSG+Y  WKA ++G + +AA+T L+  + ++
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHNGYGLYQVDPSGSYFPWKATAIGKSATAAKTFLEKRWNEE 182

Query: 184 IKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGEND 222
           +++++AI +AL TL ++ +      D +E A + +  ND
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIAIVSEENND 220

>TPHA0C04930 Chr3 (1064804..1065556) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  152 bits (385), Expect = 8e-45,   Method: Compositional matrix adjust.
 Identities = 80/220 (36%), Positives = 134/220 (60%), Gaps = 5/220 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTL-LEQDTST 63
           RY    T FSP G+L Q++YAL ++    T++GI A++G+++A E+K +S+L L +D S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKTSSSLALTEDIS- 62

Query: 64  EKIYRLNDKITVAVAGLTADAEILINTAR-VHAQEYLKTYNEEIPVEILVRRLSDIKQGY 122
            KI  L   I    +G+  D  +L++ +R V    Y + Y E    ++LV  ++ + Q  
Sbjct: 63  -KISALTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPSTKLLVSEIAKVMQEA 121

Query: 123 TQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           TQ GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA S+G  ++AA+T L+  + +
Sbjct: 122 TQSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATSIGKGSTAAKTFLEKRWNN 181

Query: 183 DIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGEND 222
           ++++++AI +AL TL ++ +      D +E A +    ND
Sbjct: 182 ELELEDAIHIALLTLKESVEGE-FNGDTIEIAVVGDENND 220

>KNAG0K00450 Chr11 complement(75675..76478) [804 bp, 267 aa] {ON}
           Anc_5.64 YGR253C
          Length = 267

 Score =  153 bits (386), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 93/238 (39%), Positives = 133/238 (55%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI  S+G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGITTSEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I  ++  I  A++GLTADA  +I  AR  A  +   Y+E I VE L + + D+   + + 
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTSAITHDLYYDENIKVESLTQSVCDLALRFGEG 126

Query: 126 GG------LRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
                    RPFGV+ + AGYD   GYQLY + PSG +  + A ++G+ +  AQ+ LQ +
Sbjct: 127 AAGEERLMSRPFGVALLIAGYDADDGYQLYHAEPSGTFYRYNAKAIGSGSEGAQSELQNE 186

Query: 180 YKDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQL 237
           +   + + +A  L LK L +  +   L  + V+   I K    +IY      E IK L
Sbjct: 187 WHSSLNMRDAEVLTLKILKQVMEEK-LDQNNVQLCCITKDGGFEIYDNKKTGEIIKLL 243

>KLTH0F13574g Chr6 complement(1116049..1116778,1116859..1116893)
           [765 bp, 254 aa] {ON} highly similar to uniprot|P40303
           Saccharomyces cerevisiae YOL038W PRE6 20S proteasome
           alpha-type subunit
          Length = 254

 Score =  152 bits (385), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 76/204 (37%), Positives = 120/204 (58%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI   D +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVIGCERRSTLKLQDPRITPSK 63

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I +++  + ++ AGL AD+ ILI  ARV AQ +  T  + + V+ L R ++ ++Q YTQ 
Sbjct: 64  IAKIDSHVVLSFAGLNADSRILIEKARVEAQSHKLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDR-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDI 184
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGVYSAWSAQAIGRNSKTVREFLEKNYARDA 183

Query: 185 KV---DEAIELALKTLSKTTDSSA 205
                 E ++L +K L +   + A
Sbjct: 184 PPATEQECVKLTVKALLEVVQTGA 207

>Suva_13.56 Chr13 complement(87087..87839) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  151 bits (382), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 130/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A++G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKTSSPLAMSETLS- 62

Query: 65  KIYRLNDKITVAVAGLTADAEILINTAR-VHAQEYLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R V    Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 IKVDEAIELALKTLSKTTDSSALTYDRVEFATI 216
           +++++AI +AL TL ++ +      D +E A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAII 214

>NDAI0H01520 Chr8 (363987..364745) [759 bp, 252 aa] {ON} Anc_7.120
          Length = 252

 Score =  151 bits (382), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 122/204 (59%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI   + +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKNCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I +++  + ++ +GL AD+ ILI  AR+ AQ +  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHLVLSFSGLNADSRILIEKARIEAQSHRLTLEDPVTVEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD- 183
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  + 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDKPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLEKNYNREE 183

Query: 184 --IKVDEAIELALKTLSKTTDSSA 205
               VDE + L +++L +   + A
Sbjct: 184 PPENVDECVRLTVRSLLEVVQTGA 207

>Kpol_455.5 s455 (4683..5432) [750 bp, 249 aa] {ON} (4683..5432)
           [750 nt, 250 aa]
          Length = 249

 Score =  151 bits (382), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 80/222 (36%), Positives = 133/222 (59%), Gaps = 5/222 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTL-LEQDTST 63
           RY    T FSP G+L Q++YAL ++    T++GI A++G+++A E+K +S L L +D S 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVIIATEKKSSSPLALTEDVS- 62

Query: 64  EKIYRLNDKITVAVAGLTADAEILINTAR-VHAQEYLKTYNEEIPVEILVRRLSDIKQGY 122
            KI  L   I    +G+  D  +L++ +R V    Y + Y E  P ++LV  ++ I Q  
Sbjct: 63  -KISLLTPDIGAVYSGMGPDFRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEIAKIMQEA 121

Query: 123 TQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKD 182
           TQ GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + +
Sbjct: 122 TQSGGVRPFGVSLLVAGHDEHNGFSLYQVDPSGSYFPWKATAIGKGSIAAKTFLEKRWNN 181

Query: 183 DIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKI 224
           ++++++AI +AL TL ++ +      D +E A +     D +
Sbjct: 182 ELELEDAIHIALLTLKESVEGE-FNGDTIEIAIVGNNNQDML 222

>Skud_13.51 Chr13 complement(85368..86120) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  151 bits (381), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 130/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A++G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLS- 62

Query: 65  KIYRLNDKITVAVAGLTADAEILINTAR-VHAQEYLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R V    Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 IKVDEAIELALKTLSKTTDSSALTYDRVEFATI 216
           +++++AI +AL TL ++ +      D +E A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAII 214

>YML092C Chr13 complement(85987..86739) [753 bp, 250 aa] {ON}
           PRE8Alpha 2 subunit of the 20S proteasome
          Length = 250

 Score =  150 bits (380), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 130/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A++G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAMSETLS- 62

Query: 65  KIYRLNDKITVAVAGLTADAEILINTAR-VHAQEYLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R V    Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTSYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 IKVDEAIELALKTLSKTTDSSALTYDRVEFATI 216
           +++++AI +AL TL ++ +      D +E A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAII 214

>ZYRO0G04136g Chr7 complement(335007..335771) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038W PRE6 20S proteasome alpha-type
           subunit
          Length = 254

 Score =  150 bits (380), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 78/223 (34%), Positives = 126/223 (56%), Gaps = 7/223 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYA E++     A+GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYASEAVKRGTCAVGIKGKDCVVLGCERRSTLKLQDSRITPSK 63

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I +++  + ++ +GL AD+ ILI  ARV AQ +  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVSVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYD-DRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD- 183
           GG+RPFGV+ + AG+D D    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVATLIAGFDKDDDTPKLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYNRDE 183

Query: 184 --IKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKI 224
                DE + L  ++L +   + A     +E   ++ G   +I
Sbjct: 184 PPATADECVRLTTRSLLEVVQTGA---KNIEITVVRPGSKIEI 223

>CAGL0F01199g Chr6 complement(124304..125068) [765 bp, 254 aa] {ON}
           highly similar to uniprot|P40303 Saccharomyces
           cerevisiae YOL038w PRE6
          Length = 254

 Score =  150 bits (379), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 79/207 (38%), Positives = 122/207 (58%), Gaps = 9/207 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTST-- 63
           YD   +IFSP+G ++QVEYALE++     A+G+   D +VL  ER+  STL  QDT    
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGLKGKDCVVLGCERR--STLKLQDTRVIA 61

Query: 64  EKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYT 123
            K+  ++  + ++ AGL AD+ IL+N ARV AQ +  T  + + VE + R ++ ++Q YT
Sbjct: 62  SKVLPIDSHLVLSFAGLNADSRILVNMARVEAQSHRLTLEDPVTVEYMARYVAGVQQKYT 121

Query: 124 QHGGLRPFGVSFIYAGYDDR--YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
           Q GG+RPFGVS + AG+D R     +LY + PSG Y+ W A ++G N+   +  L+ +Y 
Sbjct: 122 QSGGVRPFGVSTLIAGFDPRDTENPRLYQTEPSGIYSSWCAQAIGRNSKTVREFLEKNYN 181

Query: 182 DD---IKVDEAIELALKTLSKTTDSSA 205
            +      +E I L +K L +   + A
Sbjct: 182 REEPPSNKEECIRLTVKALLEVVQTGA 208

>AAR012C Chr1 complement(364905..365625,365693..365727) [756 bp, 251
           aa] {ON} syntenic homolog of Saccharomyces cerevisiae
           YOL038W (PRE6); 1-intron
          Length = 251

 Score =  150 bits (379), Expect = 6e-44,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 119/204 (58%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP G ++QVEYALE++      +GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGIKGEDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I R+++ + ++ AGL AD+ ILI  ARV AQ +  T  + + VE + R ++ ++Q YTQ 
Sbjct: 64  ISRIDNHLILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDI 184
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y    
Sbjct: 124 GGVRPFGVSTLVAGFDPRDARPRLYQTEPSGIYSAWAAQAIGRNSKTVREFLEKNYSKHT 183

Query: 185 KV---DEAIELALKTLSKTTDSSA 205
                 + ++L +K+L +   + A
Sbjct: 184 PPASEQDCVKLTVKSLLEVVQTGA 207

>Smik_13.43 Chr13 complement(83092..83844) [753 bp, 250 aa] {ON}
           YML092C (REAL)
          Length = 250

 Score =  150 bits (379), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 79/213 (37%), Positives = 130/213 (61%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    T++GI A++G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVKQGVTSLGIKATNGVVIATEKKSSSPLAISETLS- 62

Query: 65  KIYRLNDKITVAVAGLTADAEILINTAR-VHAQEYLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  L   I    +G+  D  +L++ +R V    Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSLLTPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  + AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLIAGHDEFNGFSLYQVDPSGSYFPWKATAIGKGSVAAKTFLEKRWNDE 182

Query: 184 IKVDEAIELALKTLSKTTDSSALTYDRVEFATI 216
           +++++AI +AL TL ++ +      D +E A I
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIELAII 214

>Skud_15.119 Chr15 (214242..215006) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  150 bits (379), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 76/220 (34%), Positives = 128/220 (58%), Gaps = 7/220 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   + +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           + +++  + ++ +GL AD+ ILI  ARV AQ +  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYG-YQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDARDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGEN 221
               V+E ++L +++L +   + A     +E   +K   N
Sbjct: 184 PPATVEECVKLTVRSLLEVVQTGA---KNIEITVVKPDSN 220

>TPHA0I02070 Chr9 (460632..461402) [771 bp, 256 aa] {ON} Anc_7.120
           YOL038W
          Length = 256

 Score =  150 bits (379), Expect = 7e-44,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 123/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     ++GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGEDCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I ++++ I ++ +GL AD+ ILI  AR+ AQ +  T  + + +E L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHIILSFSGLNADSRILIEKARIEAQSHKLTLEDPVSIEYLTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYD-DRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDI 184
           GG+RPFGVS + AG+D +    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPNDNKPRLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNYNKDE 183

Query: 185 KV---DEAIELALKTLSKTTDSSA 205
                +E I+L +K+L +   + A
Sbjct: 184 PPKNKEECIKLTVKSLLEVVQTGA 207

>Kwal_YGOB_Anc_7.120 s55 complement(642281..643010,643097..643131)
           [765 bp, 254 aa] {ON} ANNOTATED BY YGOB -
          Length = 254

 Score =  149 bits (377), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 120/204 (58%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+GI   D +V+  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGIKGKDCVVVGCERRSTLKLQDPRITPSK 63

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I +++  + ++ AGL AD+ ILI  ARV AQ +  T  + + V+ L R ++ ++Q YTQ 
Sbjct: 64  ISKIDSHVVLSFAGLNADSRILIEKARVEAQSHRLTLEDPVSVDYLTRYVAGVQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDR-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDI 184
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTTPKLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYVRDA 183

Query: 185 KV---DEAIELALKTLSKTTDSSA 205
                 + ++L +K L +   + A
Sbjct: 184 PPATEQDCVKLTVKALLEVVQTGA 207

>YOL038W Chr15 (255337..256101) [765 bp, 254 aa] {ON}  PRE6Alpha 4
           subunit of the 20S proteasome; may replace alpha 3
           subunit (Pre9p) under stress conditions to create a more
           active proteasomal isoform; GFP-fusion protein relocates
           from cytosol to the mitochondrial surface upon oxidative
           stress
          Length = 254

 Score =  149 bits (377), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 123/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   + +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           + +++  + ++ +GL AD+ ILI  ARV AQ +  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYG-YQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDIKVDEAIELALKTLSKTTDSSA 205
               V+E ++L +++L +   + A
Sbjct: 184 PPATVEECVKLTVRSLLEVVQTGA 207

>YGR253C Chr7 complement(998358..999140) [783 bp, 260 aa] {ON}
           PUP2Alpha 5 subunit of the 20S proteasome involved in
           ubiquitin-dependent catabolism; human homolog is subunit
           zeta
          Length = 260

 Score =  150 bits (378), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 92/238 (38%), Positives = 135/238 (56%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK----QG 121
           I  ++  I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQL 237
           +   + + EA  L LK L +  +   L  +  + + I K +  KIY      E IK+L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSCITKQDGFKIYDNEKTAELIKEL 243

>Suva_15.131 Chr15 (227798..228562) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  149 bits (377), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 73/204 (35%), Positives = 123/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   + +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           + +++  + ++ +GL AD+ ILI  ARV AQ +  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYG-YQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDSRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDIKVDEAIELALKTLSKTTDSSA 205
               V+E ++L +++L +   + A
Sbjct: 184 PPATVEECVKLTVRSLLEVVQTGA 207

>Suva_7.549 Chr7 complement(953986..954768) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  149 bits (377), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 92/238 (38%), Positives = 135/238 (56%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK----QG 121
           I  ++  I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQL 237
           +   + + EA  L LK L +  +   L  +  + + I K +  KIY      E IK+L
Sbjct: 187 WHSSLTLKEAELLVLKILKQVMEEK-LDENNAQLSCITKEDGFKIYDDSKTAELIKEL 243

>TDEL0B00400 Chr2 (73242..73994) [753 bp, 250 aa] {ON} Anc_8.871
           YML092C
          Length = 250

 Score =  149 bits (375), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 79/220 (35%), Positives = 133/220 (60%), Gaps = 5/220 (2%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YA  ++    T+IGI A++G+V+A+E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGIKATNGVVIASEKKSSSPLALTETLS- 62

Query: 65  KIYRLNDKITVAVAGLTADAEILINTAR-VHAQEYLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R V    Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KVSVITPDIGAVYSGMGPDFRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEVAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AGYD+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  +  +
Sbjct: 123 QSGGVRPFGVSLLVAGYDEHSGFGLYQVDPSGSYFPWKATAIGRGSTAAKTFLEKRWNAE 182

Query: 184 IKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDK 223
           +++++AI + L TL ++ +      D +E A +  GE +K
Sbjct: 183 LELEDAIHIVLLTLKESVEGE-FNGDTIEIAVV--GEENK 219

>Smik_16.54 Chr16 (97704..98486) [783 bp, 260 aa] {ON} YGR253C
           (REAL)
          Length = 260

 Score =  149 bits (375), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 92/238 (38%), Positives = 135/238 (56%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGIATKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK----QG 121
           I  ++  I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQL 237
           +   + + EA  L LK L +  +   L  +  + + I K +  KIY      E IK+L
Sbjct: 187 WHSSLTLKEAELLILKILKQVMEEK-LDENNAQLSCITKQDGFKIYDDKKTAELIKEL 243

>Kpol_1023.108 s1023 (252377..253141) [765 bp, 254 aa] {ON}
           (252377..253141) [765 nt, 255 aa]
          Length = 254

 Score =  149 bits (375), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 80/233 (34%), Positives = 134/233 (57%), Gaps = 10/233 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     ++GI   + +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCSVGIKGENCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I ++++ + ++ +GL AD+ ILI  AR+ AQ +  T  + I VE L R ++ ++Q YTQ 
Sbjct: 64  ISKIDNHVILSFSGLNADSRILIEKARIEAQSHKLTLEDPISVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYD-DRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDI 184
           GG+RPFG+S + AG+D +    +LY + PSG Y+ W A ++G N+   +  L+ +Y  + 
Sbjct: 124 GGVRPFGISTLIAGFDPNDKTPKLYQTEPSGIYSSWTAQTIGRNSKTVREFLENNYDRNE 183

Query: 185 K---VDEAIELALKTLSKTTDSSA------LTYDRVEFATIKKGENDKIYQKI 228
               V+E ++L +K+L +   + A      +     E  T+   E DK  Q+I
Sbjct: 184 PPKTVEECVKLTVKSLLEVVQTGAKNIEITVVKPDSEILTLDNDEIDKYVQEI 236

>Skud_7.586 Chr7 complement(972832..973614) [783 bp, 260 aa] {ON}
           YGR253C (REAL)
          Length = 260

 Score =  149 bits (375), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 92/238 (38%), Positives = 135/238 (56%), Gaps = 8/238 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   + FSPEGRL+QVEY+LE+I    TAIGI   +G+VL  E++ TS LLE D S EK
Sbjct: 8   YDRGVSTFSPEGRLFQVEYSLEAIKLGSTAIGISTKEGVVLGVEKRATSPLLESD-SIEK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK----QG 121
           I  ++  I  A++GLTADA  +I  AR  A  +   Y+E+I VE L + + D+     +G
Sbjct: 67  IVEIDRHIGCAMSGLTADARSMIEHARTAAVTHNLYYDEDINVESLTQSVCDLALRFGEG 126

Query: 122 YTQHGGL--RPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
            +    L  RPFGV+ + AG+D   GYQL+ + PSG +  + A ++G+ +  AQ  L  +
Sbjct: 127 ASGEERLMSRPFGVALLIAGHDADDGYQLFHAEPSGTFYRYNAKAIGSGSEGAQAELLNE 186

Query: 180 YKDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQL 237
           +   + + EA  L LK L +  +   L  +  + + I K +  KIY      E IK+L
Sbjct: 187 WHSSLSLKEAELLILKILKQVMEEK-LDENNAQLSCITKEDGFKIYDDNKTAELIKEL 243

>Ecym_1272 Chr1 (552861..552895,553024..553744) [756 bp, 251 aa]
           {ON} similar to Ashbya gossypii AAR012C  1-intron
          Length = 251

 Score =  148 bits (373), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 75/204 (36%), Positives = 121/204 (59%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP G ++QVEYALE++      +G+  +D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPNGHIFQVEYALEAVKRGTCTVGVKGTDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I +++  + ++ AGL AD+ ILI  ARV AQ +  T  + + VE + R ++ ++Q YTQ 
Sbjct: 64  ISKIDRHVILSFAGLNADSRILIEKARVEAQSHRLTLEDPVTVEYMTRYIAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDR-YGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY-KDD 183
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y K +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDTRPRLYQTEPSGIYSAWSAQAIGRNSKTVREFLEKNYSKHN 183

Query: 184 IKVDE--AIELALKTLSKTTDSSA 205
               E   ++L +K+L +   + A
Sbjct: 184 PPTSEEACVKLTVKSLLEVVQTGA 207

>NCAS0B00150 Chr2 complement(10879..11631) [753 bp, 250 aa] {ON}
           Anc_8.871
          Length = 250

 Score =  147 bits (372), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 76/215 (35%), Positives = 131/215 (60%), Gaps = 3/215 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL +++   T++GI A++G+V+A E+K +S L   +T + 
Sbjct: 4   RYSFSLTTFSPSGKLGQIDYALTAVNQGVTSLGIKATNGVVIATEKKSSSPLALTETLS- 62

Query: 65  KIYRLNDKITVAVAGLTADAEILINTAR-VHAQEYLKTYNEEIPVEILVRRLSDIKQGYT 123
           K+  +   I    +G+  D  +L++ +R V    Y + Y    P ++LV  ++ I Q  T
Sbjct: 63  KVELITPDIGAVYSGMGPDYRVLVDKSRKVAHTNYKRIYGVYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RPFGVS + AG+D+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + D+
Sbjct: 123 QSGGVRPFGVSLLVAGHDEHKGFSLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNDE 182

Query: 184 IKVDEAIELALKTLSKTTDSSALTYDRVEFATIKK 218
           +++++AI +AL TL ++ +      D +E   I +
Sbjct: 183 LELEDAIHIALLTLKESVEGE-FNGDTIEIGVISE 216

>Smik_15.129 Chr15 (221503..222267) [765 bp, 254 aa] {ON} YOL038W
           (REAL)
          Length = 254

 Score =  147 bits (372), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 72/204 (35%), Positives = 123/204 (60%), Gaps = 4/204 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+   + +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVKRGTCAVGVKGKNCVVLGCERRSTLKLQDTRITPSK 63

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           + +++  + ++ +GL AD+ ILI  ARV AQ +  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  VSKIDSHLVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYG-YQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY---K 181
           GG+RPFGVS + AG+D R    +LY + PSG Y+ W A ++G N+   +  L+ +Y   +
Sbjct: 124 GGVRPFGVSTLIAGFDPRDDEPKLYQTEPSGIYSSWSAQTIGRNSKTVREFLEKNYDRKE 183

Query: 182 DDIKVDEAIELALKTLSKTTDSSA 205
               V++ ++L +++L +   + A
Sbjct: 184 PPATVEDCVKLTVRSLLEVVQTGA 207

>TDEL0H03300 Chr8 complement(552725..553495) [771 bp, 256 aa] {ON}
           Anc_7.120 YOL038W
          Length = 256

 Score =  147 bits (372), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 76/218 (34%), Positives = 125/218 (57%), Gaps = 7/218 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYA E++     A+GI   D +VL  ER+ T  L +   +  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYAAEAVKRGTCAVGIKGRDCVVLGCERRSTLKLQDPRITPSK 63

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I  ++  + ++ +GL AD+ ILI  ARV AQ +  T  + + VE L R ++ ++Q YTQ 
Sbjct: 64  ISTIDSHVVLSFSGLNADSRILIEKARVEAQSHRLTLEDPVTVEYLTRYVAGVQQRYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD- 183
           GG+RPFGV+ + AG+D +    +LY + PSG Y+ W A ++G N+   +  L+ +Y  D 
Sbjct: 124 GGVRPFGVATLIAGFDPQDDTPRLYQTEPSGIYSAWTAQTIGRNSKTVREFLEKNYNRDE 183

Query: 184 --IKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKG 219
                +E ++L +++L +   + A     +E   +K G
Sbjct: 184 PPATAEECVKLTVRSLLEVVQTGA---KNIEITLVKPG 218

>TBLA0C06340 Chr3 complement(1530163..1530933) [771 bp, 256 aa] {ON}
           Anc_8.871 YML092C
          Length = 256

 Score =  147 bits (371), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 84/227 (37%), Positives = 128/227 (56%), Gaps = 9/227 (3%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YAL ++    TA+GI A++G+VLA E+K  S+L   + S +
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYALTAVKQGVTALGIKATNGVVLATEKKSGSSLALAE-SLD 62

Query: 65  KIYRLNDKITVAVAGLTADAEILINTARVHAQ-EYLKTYNEEIPVEILVRRLSDIKQGYT 123
           KI  L   I    AG+  D  +L++ AR  A   Y + Y E  P   LV  ++ I Q  T
Sbjct: 63  KISLLTPNIGTVYAGMGPDCRVLVDKARKAAHTNYKRVYGEYPPTRQLVADVAAIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDD------RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
           Q GG+RPFGVS + AG+D+        G+ LY  +PSG Y  WKA +VG    AA+T L+
Sbjct: 123 QSGGVRPFGVSLLVAGHDNANENDSNSGFALYQVDPSGAYFPWKATAVGRGAVAAKTFLE 182

Query: 178 MDYKDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKI 224
             + D++++++A+ +AL  L +  +      D +E A + +  ND +
Sbjct: 183 KRWHDELELEDAVHIALLALREAVEGE-FNGDTLEIAVVGEPNNDML 228

>ZYRO0A00616g Chr1 complement(41163..41915) [753 bp, 250 aa] {ON}
           highly similar to uniprot|P23639 Saccharomyces
           cerevisiae YML092C PRE8 20S proteasome beta-type subunit
          Length = 250

 Score =  145 bits (367), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 75/213 (35%), Positives = 127/213 (59%), Gaps = 3/213 (1%)

Query: 5   RYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           RY    T FSP G+L Q++YA  ++    T+IG+ A++G+V+A E+K +S L   +T   
Sbjct: 4   RYSFSLTTFSPNGKLGQIDYAFTAVKQGVTSIGVKATNGVVIATEKKSSSPLALTET-LN 62

Query: 65  KIYRLNDKITVAVAGLTADAEILINTAR-VHAQEYLKTYNEEIPVEILVRRLSDIKQGYT 123
           KI ++   I    +G+  D  +L++ +R V    Y + Y E  P ++LV  ++ I Q  T
Sbjct: 63  KISQITPNIGTVYSGMGPDYRVLVDKSRKVAHTHYKRIYGEYPPTKLLVSEIAKIMQEAT 122

Query: 124 QHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
           Q GG+RP+G S + AGYD+  G+ LY  +PSG+Y  WKA ++G  ++AA+T L+  + ++
Sbjct: 123 QSGGVRPYGASLLVAGYDEHTGFGLYQVDPSGSYFPWKATAIGKGSTAAKTFLEKRWNEE 182

Query: 184 IKVDEAIELALKTLSKTTDSSALTYDRVEFATI 216
           +++++AI   L TL ++ +      D +E A I
Sbjct: 183 LELEDAIHTVLLTLKESVEGE-FNGDTIEIAVI 214

>KNAG0L01020 Chr12 complement(188232..189032) [801 bp, 266 aa] {ON}
           Anc_7.120 YOL038W
          Length = 266

 Score =  140 bits (353), Expect = 7e-40,   Method: Compositional matrix adjust.
 Identities = 68/176 (38%), Positives = 106/176 (60%), Gaps = 1/176 (0%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +IFSP+G ++QVEYALE++     A+G+     +VL  ER+ T  L +  T+  K
Sbjct: 4   YDRALSIFSPDGHIFQVEYALEAVRRGTCAVGVKGPRCVVLGCERRSTLKLQDPRTTPSK 63

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           +  ++  + ++ AGL+ADA +LI  AR  AQ +  T  + + VE + R ++ I+Q YTQ 
Sbjct: 64  VALVDTHVALSFAGLSADARVLIERARTEAQSHRLTLEDPVSVEYMARYIAGIQQKYTQS 123

Query: 126 GGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
           GG+RPFGVS + AG+D      +LY + PSG Y+ W A ++G N    +  L+ +Y
Sbjct: 124 GGVRPFGVSTLVAGFDSGDDTPRLYHTEPSGIYSAWTAQTIGRNAKTVREFLEKNY 179

>ZYRO0C00792g Chr3 (60472..61344) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 290

 Score =  126 bits (317), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 68/195 (34%), Positives = 110/195 (56%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  +DG+V A E+ V+S LL    +  K
Sbjct: 8   YDLANSVFSPDGRNFQVEYAVKAVENGTTSIGIRCNDGVVFAVEKLVSSKLLVPKRNV-K 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I  ++  +    +GL  D   L+N  R  AQ + KT+ E IP++ L  RL    Q +T +
Sbjct: 67  IQTIDRHVGCVYSGLIPDGRHLVNRGREEAQSHKKTFGESIPLQALADRLGYYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM---DYKD 182
             +RPFGV+ I+ G DD+ G  LY   PSG + G+K  + G     A+  L+     + +
Sbjct: 127 NSVRPFGVTAIFGGVDDK-GPHLYMLEPSGTFWGYKGAATGKGRQTAKAELEKVIDQHPE 185

Query: 183 DIKVDEAIELALKTL 197
            +   +A++ A K +
Sbjct: 186 GLSAKDAVKEAAKVI 200

>Kpol_538.40 s538 complement(86524..87348) [825 bp, 274 aa] {ON}
           complement(86524..87348) [825 nt, 275 aa]
          Length = 274

 Score =  125 bits (314), Expect = 5e-34,   Method: Compositional matrix adjust.
 Identities = 66/195 (33%), Positives = 110/195 (56%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI  +DG+V A E+ ++S LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCNDGVVFAVEKLISSKLLVPKKNV-K 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I  ++  I    +GL  D   L+N  R  ++ + + Y++ IP+     R+    Q +T +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESKSFSQMYSKRIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY---KD 182
             +RPFGVS I+ G DD  G  LY   PSG+Y G+K  + G+    A+T L+  +    D
Sbjct: 127 NSVRPFGVSAIFGGIDDE-GSHLYMIEPSGSYWGYKGAAAGSGRQIAKTELEKLFDKNPD 185

Query: 183 DIKVDEAIELALKTL 197
            +   EAI+ A + +
Sbjct: 186 GLSAREAIKQAARII 200

>KLTH0D00902g Chr4 (86268..86270,86342..87172) [834 bp, 277 aa] {ON}
           highly similar to uniprot|P21242 Saccharomyces
           cerevisiae YOR362C PRE10 20S proteasome alpha-type
           subunit
          Length = 277

 Score =  124 bits (310), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 70/194 (36%), Positives = 107/194 (55%), Gaps = 4/194 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA+++  +  T++G+   DGIVLA E+ VTS LL      +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAAENGATSVGMKFKDGIVLAVEKLVTSKLL-VPGKNKK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I  ++  +  A +GL  D   L+N  R  A  + KTY   IP+  L  RL    Q +T +
Sbjct: 67  IQTIDRHVGCAYSGLMPDGRHLVNRGREEASSFKKTYATPIPLPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--MDYKDD 183
             +RPFG++ I  G DD  G  LY   PSG Y G+K  + G    +A+  L+  +  K +
Sbjct: 127 NSVRPFGITAIVGGVDDD-GAHLYMLEPSGTYWGYKGAATGKGRQSAKAELEKVISNKPE 185

Query: 184 IKVDEAIELALKTL 197
           +   EA++ A + +
Sbjct: 186 LDAREAVKEAARII 199

>Smik_15.546 Chr15 complement(963345..964211) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  124 bits (311), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 97/172 (56%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  +DG+V A E+ +TS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I  ++  I    +GL  D   L+N  R  A  + K YN  IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYNTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGV-DKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>TBLA0E00690 Chr5 complement(136929..137765) [837 bp, 278 aa] {ON}
           Anc_7.20 YOR362C
          Length = 278

 Score =  124 bits (310), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 106/195 (54%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI   DG+V A E+ ++S LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSVGIKCDDGVVFAVEKIISSKLLVPKRNV-K 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I  ++  I    +GL  D   L+N  R  A  + K Y + IPV  L  R+S   Q YT +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRYLVNRGREEASNFKKLYTKPIPVSALADRISQYVQAYTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK---D 182
             +RPFG+S I  G D+  G  LY   PSG   G+K  + G    AA+  L+  +    D
Sbjct: 127 NSVRPFGISAIIGGIDED-GSHLYMVEPSGTCWGYKGAATGKGRQAAKAELEKLFDRSTD 185

Query: 183 DIKVDEAIELALKTL 197
            + V +AI+ A + +
Sbjct: 186 GLSVKDAIKEAARVI 200

>ADR401C Chr4 complement(1425757..1426593,1426655..1426657) [840 bp,
           279 aa] {ON} Syntenic homolog of Saccharomyces
           cerevisiae YOR362C (PRE10); 1-intron
          Length = 279

 Score =  124 bits (310), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 69/232 (29%), Positives = 124/232 (53%), Gaps = 7/232 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TS LL    + +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIRCKDGVVFAVEKLITSKLLVPHKN-KK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I  ++  I    +GL  D   L+N  R  A ++ K Y + IP+     R+    Q +T +
Sbjct: 67  IQTVDKHIGCVYSGLMPDGRHLVNIGRQEAADFRKYYRQPIPLPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM---DYKD 182
             +RPFG+  I+ G D++ G  LY   PSG Y G++  + G    AA+  L+    + K 
Sbjct: 127 NSVRPFGIIAIFGGVDEK-GPHLYMLEPSGAYWGYRGAAAGKGRQAAKAELEKLIGNDKS 185

Query: 183 DIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEI 234
           ++   +A++ A + +    + +      +E +     E D +++++  P+E+
Sbjct: 186 ELSARDAVKEAARIIYVAHEDNKEKEFEIELSWCSASETDGLHKEV--PKEL 235

>Skud_15.530 Chr15 complement(955569..956435) [867 bp, 288 aa] {ON}
           YOR362C (REAL)
          Length = 288

 Score =  124 bits (310), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 69/195 (35%), Positives = 106/195 (54%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  +DG+V A E+ +TS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I  ++  I    +GL  D   L+N  R  A  + K Y   IPV     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYKTPIPVPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM---DYKD 182
             +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+     + D
Sbjct: 127 NSVRPFGVSTIFGGV-DKDGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDQHTD 185

Query: 183 DIKVDEAIELALKTL 197
            +   EA++ A + +
Sbjct: 186 GLTAKEAVKQAARII 200

>CAGL0H06105g Chr8 (596149..597021) [873 bp, 290 aa] {ON} highly
           similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362c PRE10
          Length = 290

 Score =  123 bits (308), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 68/194 (35%), Positives = 106/194 (54%), Gaps = 4/194 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA +++ +  T+IGI  +DG+V A E+ +TS LL  + +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYANKAVENGATSIGIKFNDGVVFAVEKIITSKLLVPNKNL-K 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I  ++  I V  +GL  D   L+N AR  +Q + K Y   IPV+    R+    Q +T  
Sbjct: 67  IQTVDKHIGVVYSGLIPDGRHLVNRAREESQNFRKMYGSAIPVDAFAERVGQYVQAHTLF 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--MDYKDD 183
             +RPFGV+ I+ G  D+ G  LY   PSG Y G+   + G     A+  L+  +D   +
Sbjct: 127 NSVRPFGVTAIFGGC-DKNGPHLYMLEPSGTYWGYNGAATGKGRQTAKAELEKLLDKTPE 185

Query: 184 IKVDEAIELALKTL 197
           +   EA + A + +
Sbjct: 186 MSAKEAAKHAARII 199

>YOR362C Chr15 complement(1017880..1018746) [867 bp, 288 aa] {ON}
           PRE10Alpha 7 subunit of the 20S proteasome
          Length = 288

 Score =  122 bits (307), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 68/195 (34%), Positives = 106/195 (54%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  +DG+V A E+ +TS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCNDGVVFAVEKLITSKLLVPQKNV-K 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I  ++  I    +GL  D   L+N  R  A  + K Y   IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM---DYKD 182
             +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+     + +
Sbjct: 127 NSVRPFGVSTIFGGV-DKNGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKLVDHHPE 185

Query: 183 DIKVDEAIELALKTL 197
            +   EA++ A K +
Sbjct: 186 GLSAREAVKQAAKII 200

>Suva_8.419 Chr8 complement(753633..754511) [879 bp, 292 aa] {ON}
           YOR362C (REAL)
          Length = 292

 Score =  122 bits (306), Expect = 9e-33,   Method: Compositional matrix adjust.
 Identities = 65/172 (37%), Positives = 96/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ +TS LL    +T K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGTTSIGIKCDDGVVFAVEKLITSKLLVPQKNT-K 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I  ++  I    +GL  D   L+N  R  A  + K Y   IP+     RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKLYKTPIPIPAFADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G  D+ G  LY   PSG+Y G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSTIFGGV-DKDGAHLYMLEPSGSYWGYKGAATGKGRQSAKAELE 177

>KAFR0C05000 Chr3 (992380..993225) [846 bp, 281 aa] {ON} Anc_7.20
           YOR362C
          Length = 281

 Score =  122 bits (305), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 67/195 (34%), Positives = 108/195 (55%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI  +DG+V A E+ +TS L+  + +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCNDGVVFAVEKLITSKLMVPNKNI-K 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I  ++  I    +GL  D   L+N  R  +  + K Y + IP+  L  RL    Q +T +
Sbjct: 67  IQTIDRHIGCVYSGLIPDGRHLVNRGREESSSFKKLYGKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--MDYKDD 183
             +RPFG++ I+ G D+  G  LY   PSG+Y G+K  + G     A+  L+  +D   D
Sbjct: 127 NSVRPFGITAIFGGVDED-GSHLYMLEPSGSYWGYKGAATGKGRQTAKAELEKLIDRNPD 185

Query: 184 -IKVDEAIELALKTL 197
                EA++ A K +
Sbjct: 186 GFSAREALKHAAKVI 200

>KLLA0A03487g Chr1 (316951..316953,317116..317940) [828 bp, 275 aa]
           {ON} similar to uniprot|P21242 Saccharomyces cerevisiae
           YOR362C PRE10 20S proteasome alpha-type subunit
          Length = 275

 Score =  120 bits (300), Expect = 5e-32,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 96/172 (55%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T++GI   DG+VLA E+ +TS LL      +K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSLGIKCEDGVVLAVEKLITSKLL-VPGKNKK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I  ++  I    +GL  D   L+N  R  A  + K Y+  IP+     R+    Q +T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKMYSTPIPIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G D   G  LY   PSG Y G+K+ + G    +A+  L+
Sbjct: 127 NSVRPFGVTAIFGGVDSD-GAHLYMLEPSGTYWGYKSAATGKGRQSAKAELE 177

>Ecym_5019 Chr5 (42044..42046,42100..42954) [858 bp, 285 aa] {ON}
           similar to Ashbya gossypii ADR401C
          Length = 285

 Score =  120 bits (300), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 69/232 (29%), Positives = 119/232 (51%), Gaps = 7/232 (3%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ + S LL   +  EK
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGSTSIGIKCKDGVVFAVEKLINSKLL-VPSKNEK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I  ++  I    +GL  D   L+N  R  A  + K Y + I +     R+    Q +T +
Sbjct: 67  IQTIDKHIGCVYSGLMPDGRHLVNIGRQEANSFRKLYRKPITIPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ---MDYKD 182
             +RPFG+  I+ G DD  G  LY   PSG Y G+K  + G    +A+  L+      K 
Sbjct: 127 NSVRPFGIIAIFGGVDDE-GAHLYMLEPSGAYWGYKGAATGKGRQSAKAELEKLVAGDKP 185

Query: 183 DIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEI 234
           ++   EA++ A + +    + +      +E +     E + +++++  P+E+
Sbjct: 186 ELSAREAVKEAARIIYVAHEDNKEKEFEIELSWCSISETNGLHERV--PKEL 235

>NCAS0I00250 Chr9 complement(31100..31978) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  119 bits (298), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 62/172 (36%), Positives = 93/172 (54%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA++++ +  T+IGI   DG+V A E+ VTS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAVKAVENGATSIGIKCDDGVVFAVEKIVTSKLLVPKRNV-K 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I  ++  I    +GL  D    +N  R  A  + K Y+  IP+     R+    Q +T +
Sbjct: 67  IQGIDRHIGCVYSGLIPDGRHFVNRGREEASNFKKLYSNAIPIPAFADRIGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGV+ I+ G D+  G  LY   PSG Y G+K  + G     A+  L+
Sbjct: 127 NSVRPFGVTAIFGGIDEN-GPHLYMLEPSGTYWGYKGAATGKGRQTAKAELE 177

>Ecym_7233 Chr7 (485803..486543) [741 bp, 246 aa] {ON} similar to
           Ashbya gossypii AGL089W
          Length = 246

 Score =  118 bits (295), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 75/248 (30%), Positives = 124/248 (50%), Gaps = 17/248 (6%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I   + +VL  ++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIKGKNCVVLVNQKKVPDKLLDP 60

Query: 60  DTSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK 119
            T +  ++ ++  I +   G   DA  +    +  A E+   Y  +IPV +L +RL+++ 
Sbjct: 61  ATVS-YMFPISKHIGMCATGPIGDARNVAVRCKSMAAEFRYEYGYDIPVHVLAKRLANLA 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   D+  G  ++  +P+G YTG+KA + G       T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEKGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 180 YKDDIKVD--------EAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKP 231
           +K  + VD        + +E A+  +S +  +   + D      +   E DK Y  +   
Sbjct: 180 FK-KLNVDCLQEETSEKVVEFAITQMSASLGTDFSSKD----LEVGIAEADKFY--VLGQ 232

Query: 232 EEIKQLLL 239
           EEI+Q L+
Sbjct: 233 EEIEQRLV 240

>SAKL0D14476g Chr4 complement(1189461..1190303,1190367..1190369)
           [846 bp, 281 aa] {ON} similar to uniprot|P21242
           Saccharomyces cerevisiae YOR362C PRE10 20S proteasome
           alpha-type subunit
          Length = 281

 Score =  117 bits (294), Expect = 5e-31,   Method: Compositional matrix adjust.
 Identities = 66/194 (34%), Positives = 106/194 (54%), Gaps = 4/194 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   +++SP+GR +QVEYA++++ +  T++GI   DG+V A E+ VTS LL    + +K
Sbjct: 8   YDLSNSVYSPDGRNFQVEYAVKAVENGATSVGIKFRDGVVFAVEKLVTSKLLVPGKN-KK 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I  ++  I    +GL  D   L+N  R  A  + K Y++ IPV     R+    Q +T +
Sbjct: 67  IQTVDRHIGCVYSGLMPDGRHLVNRGREEAASFKKLYSQPIPVPAFADRVGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--MDYKDD 183
             +RPFGV+ I+ G  D+ G  LY   PSG Y G+   + G    +A+  L+     K D
Sbjct: 127 NSVRPFGVTAIFGGV-DKDGAHLYMLEPSGTYWGYTGAATGKGRQSAKAELEKLATSKPD 185

Query: 184 IKVDEAIELALKTL 197
           +   EA++ A + +
Sbjct: 186 LSPREAVKEAARII 199

>KNAG0E00230 Chr5 (29197..30036) [840 bp, 279 aa] {ON} Anc_7.20
           YOR362C
          Length = 279

 Score =  117 bits (292), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 64/188 (34%), Positives = 101/188 (53%), Gaps = 10/188 (5%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA +++ +  T++G++  DG+VLA E+ V S LL + +   K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAAKAVENGATSVGLLCEDGVVLAVEKLVASKLLVKASPQNK 67

Query: 66  IYRLNDKIT-------VAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDI 118
               N KI         A +GL  D   L+N AR  +Q++ + Y  +IP   L  R+   
Sbjct: 68  GSGANTKIQTVGRHIGCACSGLVPDGRHLVNRAREESQQFKQLYKRDIPPVALADRMGQY 127

Query: 119 KQGYTQHGGLRPFGVSFIYAGYDDRYGY-QLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
            Q +T +  +RPFGV+ I+ G D       LY   PSG Y G++  + G    +A+  L+
Sbjct: 128 VQAHTLYNSVRPFGVAAIFGGVDPETAEPHLYMLEPSGVYWGYRGAATGKGRQSAKAELE 187

Query: 178 --MDYKDD 183
             +  +DD
Sbjct: 188 KLISSRDD 195

>KLLA0A05027g Chr1 (450398..451138) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  116 bits (290), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 65/205 (31%), Positives = 105/205 (51%), Gaps = 9/205 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     +I I +    V+ +++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKAANQPNLNSIAIRSKTASVVISQKKVPDKLLDP 60

Query: 60  DTSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK 119
            T +  I+ +   I     G   DA  +    +  A E+   Y  +IP  +L +R++++ 
Sbjct: 61  KTVS-YIFPVARHIGFCATGPVPDARNIALRCKAEASEFRYKYGYDIPCSVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP G+   +  YD+  G  ++  +P+G YTG+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGIILTFISYDEETGPAIFKCDPAGYYTGYKATATGPKQQELNSALEKH 179

Query: 180 YK--DDIKVDE-----AIELALKTL 197
           +K   D K+DE      +E  + TL
Sbjct: 180 FKKLKDDKIDEESWEKTVEFGITTL 204

>TDEL0H04310 Chr8 complement(742283..743107) [825 bp, 274 aa] {ON}
           Anc_7.20 YOR362C
          Length = 274

 Score =  116 bits (291), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 72/238 (30%), Positives = 117/238 (49%), Gaps = 31/238 (13%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QV+YA++++ +  T+IGI   DG+V A E+ VTS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVQYAVKAVENGTTSIGIKFKDGVVFAVEKLVTSKLLVPKKNV-K 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I  ++  I    +GL  D   L+N  R  +  + K Y + IP+  L  RL    Q +T +
Sbjct: 67  IQVVDRHIGCVYSGLMPDGRQLVNRGREESSSFKKLYQKPIPIPALADRLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQT----------- 174
             +RPFGV+ I+ G D+  G  LY   PSG + G+K  + G     A+            
Sbjct: 127 NSVRPFGVTAIFGGIDEE-GPHLYMLEPSGAHWGYKGAATGKGRQTAKAELEKLVDKHPE 185

Query: 175 -------------LLQMDYKDDIKVDEAIELALKTLSKTTD-----SSALTYDRVEFA 214
                        ++ M ++D+ + D  +E++  +LS+T          L  + +EFA
Sbjct: 186 GLTGREAVKQAAKIIHMAHEDNKEKDFELEISWCSLSETGGLHKFVEGELLEEAIEFA 243

>AGL089W Chr7 (539399..540139) [741 bp, 246 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGL011C (SCL1)
          Length = 246

 Score =  115 bits (289), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 62/182 (34%), Positives = 94/182 (51%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I      VL  ++KV   LLE 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSVAIRGKSCTVLVNQKKVPDKLLEP 60

Query: 60  DTSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK 119
            T T  ++ +   I +   G  ADA  +    R  A E+   Y  ++PV +L +R +++ 
Sbjct: 61  STVT-YLFPIAKHIGMCATGPIADARNVAVRCRAMAAEFRYEYGYDMPVHVLAKRFANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   D+  G  ++  +P+G YTG+KA + G       T L+  
Sbjct: 120 QTYTQRAYMRPLGVVLTFISVDEEEGPSIFKCDPAGYYTGYKATATGPKQQELITALEKH 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>NDAI0A08770 Chr1 complement(2020318..2021196) [879 bp, 292 aa] {ON}
           Anc_7.20
          Length = 292

 Score =  116 bits (290), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 65/195 (33%), Positives = 102/195 (52%), Gaps = 5/195 (2%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR +QVEYA +++ +  T+IGI   DG+V A E+ +TS LL    +  K
Sbjct: 8   YDLSNSVFSPDGRNFQVEYAGKAVENGATSIGIKCKDGVVFAVEKIITSKLLVPKKNV-K 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I  ++  I    +GL  D   L+N  R  A  + K Y+  IP+     RL    Q +T +
Sbjct: 67  IQGVDRHIGCVYSGLIPDGRHLVNRGREEAASFKKMYDLPIPISAFAERLGQYVQAHTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM---DYKD 182
             +RPFGV+ I+ G D++ G  LY   PSG   G+   + G     A+  L+     + D
Sbjct: 127 NSVRPFGVTSIFGGIDEK-GPHLYMLEPSGTCWGYNGAATGKGRQTAKAELEKLADQHPD 185

Query: 183 DIKVDEAIELALKTL 197
            +   +A++ A K +
Sbjct: 186 GLTTRDAVKYAAKII 200

>TBLA0C04080 Chr3 complement(987028..987789) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  114 bits (286), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 66/201 (32%), Positives = 104/201 (51%), Gaps = 10/201 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     +I I  +   V+  ++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNKCAVIVNQKKVPDKLLDPSTVS- 70

Query: 65  KIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            I+ ++  I +   G   DA+     A+    EY   Y  ++P ++L +R+++I Q YTQ
Sbjct: 71  YIFPISKTIGLVANGPIPDAKNAATKAKTETAEYRYKYGYDMPCDVLAKRMANIAQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGA-----NTSAAQTLLQMD 179
              +RP GV   +  YD+  G  +Y ++P+G Y G+KA + G      NT       + D
Sbjct: 131 RAYMRPLGVILTFISYDEELGPSIYKTDPAGYYVGYKATATGPKQQEINTGLENWFKKND 190

Query: 180 YKDDIKVD---EAIELALKTL 197
            K+ I  D   + +E A+  L
Sbjct: 191 VKEKINEDAWEKVVEFAITQL 211

>TPHA0N00240 Chr14 (44110..44943) [834 bp, 277 aa] {ON} Anc_7.20
           YOR362C
          Length = 277

 Score =  115 bits (287), Expect = 5e-30,   Method: Compositional matrix adjust.
 Identities = 59/172 (34%), Positives = 94/172 (54%), Gaps = 2/172 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YD   ++FSP+GR++QVEYA +++ +  T+IGI  +DG+V A E+ ++S LL    +  K
Sbjct: 8   YDLSNSVFSPDGRIFQVEYANKAVENGATSIGIKCTDGVVFAVEKIISSKLLVPKKNV-K 66

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQH 125
           I  ++  I    +GL  D   L+N  R  +  + K Y + I +     R+    Q YT +
Sbjct: 67  IQVIDRHIGCVYSGLIPDGRHLVNRGREESANFKKVYGQPIGIPAFADRIGQYIQAYTLY 126

Query: 126 GGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ 177
             +RPFGVS I+ G D   G  LY   P+G + G+K  + G    +A+  L+
Sbjct: 127 NSVRPFGVSAIFGGIDSE-GPHLYMVEPNGAFWGYKGAATGKGRQSAKAELE 177

>KNAG0E01180 Chr5 complement(232483..233184) [702 bp, 233 aa] {ON}
           Anc_5.1 YMR314W
          Length = 233

 Score =  112 bits (281), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 68/192 (35%), Positives = 99/192 (51%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +S    L A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYACLVALKRNADEL---S 57

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +KI + +D + +++AGL  DA +L N  R H       YN E+ +E +   LSD  Q
Sbjct: 58  SYQKKIIKCDDHVGLSLAGLAPDARVLSNFVRQHCNYSKLVYNRELSMEKIGYLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  ++T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLVGY-DKSGPHLIEFQPSGNILELYGAAIGARSQGSRTYLERVM 176

Query: 181 KDDIKVDEAIEL 192
            D + V++A EL
Sbjct: 177 DDFLPVEDATEL 188

>YMR314W Chr13 (901709..902413) [705 bp, 234 aa] {ON}  PRE5Alpha 6
           subunit of the 20S proteasome
          Length = 234

 Score =  112 bits (280), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 74/229 (32%), Positives = 113/229 (49%), Gaps = 8/229 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +KI + ++ + +++AGL  DA +L N  R         +N ++ VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN T     ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVTELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDDIKV----DEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIY 225
              IK+    DE I+  ++ +S++    +LT D +  A + K     IY
Sbjct: 177 DTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIVGKDTPFTIY 225

>Kpol_1061.45 s1061 complement(125355..126125) [771 bp, 256 aa] {ON}
           complement(125355..126125) [771 nt, 257 aa]
          Length = 256

 Score =  112 bits (281), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 60/177 (33%), Positives = 97/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     +I I  ++  V+  ++KV   LL+ +T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKACNQTNINSIAIRGNNCSVIINQKKVPDKLLDAETVS- 71

Query: 65  KIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            I++++  I +   G   DA       +  A E+   Y  ++PV++L +R++++ Q YTQ
Sbjct: 72  YIFQISRTIGMVANGPIPDARNAAIRCKAEAAEFRYKYGYDMPVDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y S+PSG Y G+KA + G       T L+  +K
Sbjct: 132 RAYMRPLGVILTFVSLDEEKGPSIYKSDPSGYYVGYKATATGPKQQEISTSLENFFK 188

>Kwal_27.9720 s27 complement(34522..35043) [522 bp, 173 aa] {ON}
           YML092C (PRE8) - proteasome component Y7 [contig 336]
           FULL
          Length = 173

 Score =  110 bits (274), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 55/144 (38%), Positives = 89/144 (61%), Gaps = 2/144 (1%)

Query: 80  LTADAEILINTAR-VHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYA 138
           +  D  +LI+ +R V   +Y + YNE  P +ILV  ++ I Q  TQ GG+RPFGVS + A
Sbjct: 1   MGPDFRVLIDKSRKVAHTQYKRIYNEYPPTKILVAEVAKIMQEATQSGGVRPFGVSLLVA 60

Query: 139 GYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLS 198
           GYD+  G+ LY  +PSG+Y  WKA ++G   +AA+T L+  + D++++++AI +AL TL 
Sbjct: 61  GYDEHNGFGLYQVDPSGSYFPWKATAIGKGATAAKTFLEKRWNDELELEDAIHIALLTLK 120

Query: 199 KTTDSSALTYDRVEFATIKKGEND 222
           ++ +      D +E A + +   D
Sbjct: 121 ESVEGE-FNGDTIEIAVVGEENQD 143

>Smik_13.531 Chr13 (884471..885172) [702 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  111 bits (278), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 74/225 (32%), Positives = 112/225 (49%), Gaps = 10/225 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +KI + +D + +++AGL  DA +L N  R         +N ++ VE     L D  Q
Sbjct: 58  SYQKKIIKCDDHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVEKAGYLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDDIKV----DEAIELALKTLSKTTDSSALTYDRVEFATIKKGEN 221
              IK+    DE I+  ++ +S++    +LT D +  A +  GEN
Sbjct: 177 DTFIKIDGNPDELIKAGIEAISQSLRDESLTVDNLSIAIV--GEN 219

>Skud_13.488 Chr13 (875208..875912) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  110 bits (274), Expect = 1e-28,   Method: Compositional matrix adjust.
 Identities = 71/220 (32%), Positives = 109/220 (49%), Gaps = 8/220 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +KI + ++ + +++AGL  DA +L N  R         +N ++ VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAVERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       S+GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTSIGARSQGAKTYLERTL 176

Query: 181 KDDIKV----DEAIELALKTLSKTTDSSALTYDRVEFATI 216
              IK+    DE I+  ++ +S++    +LT D +  A +
Sbjct: 177 DTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAVV 216

>CAGL0M14003g Chr13 (1383750..1384451) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314w PRE5
          Length = 233

 Score =  108 bits (270), Expect = 4e-28,   Method: Compositional matrix adjust.
 Identities = 76/241 (31%), Positives = 114/241 (47%), Gaps = 11/241 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ + D  VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKDYAVLVALKRNADEL---S 57

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +KI + ++ + +++AGL  DA +L N  R         YN ++ VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSQLVYNRKLSVEKAGHMLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGYDNS-GPHLLEFQPSGNTLEVYGSAIGARSQGAKTYLERVL 176

Query: 181 KDDIKVDEAIEL---ALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQL 237
            D + + +A EL    ++ L ++     L  D +  A + K     I   I+  E + Q 
Sbjct: 177 DDYLAITDATELIKSGVEALRQSLKDETLNTDNLSIAVVGK----DIPFTIYDGESVSQY 232

Query: 238 L 238
           L
Sbjct: 233 L 233

>KLTH0B09504g Chr2 complement(779619..780320) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  108 bits (270), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 69/219 (31%), Positives = 109/219 (49%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKFAVLVALKRNADEL---S 57

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +KI + ++ + +++AGL  D  +L N  R         YN ++ +E     LSD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GPHLLEFQPSGNTLELYGSAIGARSQGAKTYLERTL 176

Query: 181 KDDIKVDEA---IELALKTLSKTTDSSALTYDRVEFATI 216
           +D +++D+A   I +A++ L +      L+   +  A +
Sbjct: 177 QDYLELDDADDLIRVAVEALRQCLKDEVLSTKNLSIAVV 215

>KLTH0E07788g Chr5 (715745..716485) [741 bp, 246 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 246

 Score =  108 bits (271), Expect = 5e-28,   Method: Compositional matrix adjust.
 Identities = 57/182 (31%), Positives = 95/182 (52%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I  +D  V+  ++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSMAIRGNDCCVVINQKKVPDKLLDP 60

Query: 60  DTSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK 119
            T +  ++ ++  I +   G   DA      A+    EY   Y  ++P ++L +R++++ 
Sbjct: 61  STMS-YLFPISKHIGMVANGPIPDARNAALRAKAEVAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   D+  G  +Y  +P+G Y G+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>Suva_13.507 Chr13 (884695..885399) [705 bp, 234 aa] {ON} YMR314W
           (REAL)
          Length = 234

 Score =  108 bits (270), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 69/220 (31%), Positives = 109/220 (49%), Gaps = 8/220 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNTHAVLVALKRNADEL---S 57

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +KI + ++ + +++AGL  DA +L N  R         +N ++ +E     L D  Q
Sbjct: 58  SFQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLAIERAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIIGY-DKSGAHLLEFQPSGNVMELYGTAIGARSQGAKTYLERTL 176

Query: 181 KDDIKV----DEAIELALKTLSKTTDSSALTYDRVEFATI 216
              IK+    DE I+  ++ +S++    +LT D +  A +
Sbjct: 177 DTFIKIDGNPDELIKAGVEAISQSLRDESLTVDNLSIAIV 216

>TPHA0F00670 Chr6 (153895..154668) [774 bp, 257 aa] {ON} Anc_4.110
           YGL011C
          Length = 257

 Score =  108 bits (271), Expect = 6e-28,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 94/177 (53%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +  +D  V+  ++KV   LL+ DT + 
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKACNQTNINSVAVRGNDCTVIINQKKVPDKLLDADTVS- 71

Query: 65  KIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            I+ ++  I +   G   DA       +  A E+   Y  ++P ++L +R++++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGPIPDARNAALRCKAEAAEFRYKYGYDMPADVLAKRMANLAQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y S+PSG Y G+K  + G       T L+  +K
Sbjct: 132 RAYMRPLGVILTFISVDEEKGPSIYKSDPSGYYIGYKVTATGPKQQEIATSLENFFK 188

>ZYRO0G10164g Chr7 (814364..815125) [762 bp, 253 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 253

 Score =  108 bits (271), Expect = 7e-28,   Method: Compositional matrix adjust.
 Identities = 60/202 (29%), Positives = 105/202 (51%), Gaps = 10/202 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ I   +  V+ +++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTSINSLAIRGKNCSVIISQKKVPDKLLDPSTVS- 70

Query: 65  KIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            I++++  I + + G   DA      A+    E+   +  ++P ++L +R++++ Q YTQ
Sbjct: 71  YIFKISKTIGMVINGPIPDARNAALRAKAETAEFRYKFGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ------- 177
              +RP GV   Y   D+  G  +Y S+P+G + G+KA + G       T L+       
Sbjct: 131 RAYMRPLGVIQTYVSVDEEQGPSIYKSDPAGYFVGYKATATGPKQQEITTRLENYIKKTP 190

Query: 178 -MDYKDDIKVDEAIELALKTLS 198
             DY  +   ++ +E  + TL+
Sbjct: 191 SQDYMQEESWEKVVEFGITTLT 212

>Kwal_47.17493 s47 (426759..427499) [741 bp, 246 aa] {ON} YGL011C
           (SCL1) - Proteasome subunit YC7alpha/Y8 (protease yscE
           subunit 7) [contig 207] FULL
          Length = 246

 Score =  108 bits (269), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 58/182 (31%), Positives = 98/182 (53%), Gaps = 2/182 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     +I I  +D  V+ +++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSIAIRGTDCCVIISQKKVPDKLLDP 60

Query: 60  DTSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK 119
            T +  +++++  + +   G   DA      A+  A EY   Y  ++P ++L +R++++ 
Sbjct: 61  STMS-YLFQISRHVGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPADVLAKRMANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   D+  G  +Y  +P+G Y G+KA + G       + L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTSALEKY 179

Query: 180 YK 181
           +K
Sbjct: 180 FK 181

>Kwal_26.9483 s26 complement(1238526..1239227) [702 bp, 233 aa] {ON}
           YMR314W (PRE5) - alpha-type of subunit of 20S proteasome
           [contig 73] FULL
          Length = 233

 Score =  107 bits (268), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 69/221 (31%), Positives = 108/221 (48%), Gaps = 7/221 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGVRSKKHAVLVALKRNADEL---S 57

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +KI + ++ + +++AGL  D  +L N  R         YN ++ +E     LSD  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDGRVLSNFLRQQCNYSSLVYNRKLSLEKAGNLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GPHLLEFQPSGNTLELYGAAIGARSQGAKTYLERTL 176

Query: 181 KDDIKV---DEAIELALKTLSKTTDSSALTYDRVEFATIKK 218
            + +++   DE I +A++ L +      L+   +  A + K
Sbjct: 177 NEYLEIEDEDELIGVAVEALKQCLKDETLSTKNLSIAIVSK 217

>YGL011C Chr7 complement(474489..475247) [759 bp, 252 aa] {ON}
           SCL1Alpha 1 subunit of the 20S proteasome involved in
           the degradation of ubiquitinated substrates; 20S
           proteasome is the core complex of the 26S proteasome;
           essential for growth; detected in the mitochondria
          Length = 252

 Score =  108 bits (269), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 58/177 (32%), Positives = 96/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +   D  V+ +++KV   LL+  T+  
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKDCTVVISQKKVPDKLLDP-TTVS 70

Query: 65  KIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            I+ ++  I + V G   DA      A+  A E+   Y  ++P ++L +R++++ Q YTQ
Sbjct: 71  YIFCISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>SAKL0H21956g Chr8 (1918407..1919153) [747 bp, 248 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011C SCL1 Proteasome subunit YC7alpha/Y8 (protease
           yscE subunit 7)
          Length = 248

 Score =  107 bits (268), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 56/184 (30%), Positives = 101/184 (54%), Gaps = 2/184 (1%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQ 59
           M +  YD   TIFSPEGRLYQVEYA ++ +     ++ I  ++ +V+ +++KV   LL+ 
Sbjct: 1   MSAAGYDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGTNCVVVVSQKKVPDKLLDS 60

Query: 60  DTSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK 119
           +T +  I++++  + +   G   DA      A+  A E+   Y  ++P ++L +R++++ 
Sbjct: 61  NTVS-YIFKVSPHVGMVANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRIANLS 119

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMD 179
           Q YTQ   +RP GV   +   D+  G  +Y  +P+G + G+KA + G       T L+  
Sbjct: 120 QIYTQRAYMRPLGVILTFVSVDEENGPSVYKCDPAGYFVGYKATATGPKQQELDTSLEKF 179

Query: 180 YKDD 183
           +K +
Sbjct: 180 FKKN 183

>ZYRO0C01144g Chr3 complement(78422..79123) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  107 bits (266), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 68/222 (30%), Positives = 111/222 (50%), Gaps = 7/222 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKLGSVTVGLRSNKHAVVVALKRNADDL---S 57

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +KI + ++ + +++AGL  DA +L N  R         YN ++ VE +   L D  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDARVLSNFLRQQCNYSQLVYNRKLSVERVGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLVVGYDNS-GPHLLEFQPSGNVLELYGTAIGARSQGAKTYLEKTL 176

Query: 181 KDDIKV---DEAIELALKTLSKTTDSSALTYDRVEFATIKKG 219
           +  ++V   +E I+L ++ L ++     L+   +  A + +G
Sbjct: 177 EQFLEVEDPNELIKLGVEALRQSLKDETLSTKNLSIAVVGEG 218

>NCAS0A01640 Chr1 complement(320645..321406) [762 bp, 253 aa] {ON}
           Anc_4.110
          Length = 253

 Score =  107 bits (267), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 55/177 (31%), Positives = 96/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +  ++  V+  ++KV   LL+  T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNVNSVAVRGTNCTVVINQKKVPDKLLDPSTVS- 71

Query: 65  KIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            I+ ++  + +   G   DA      A++ A E+   Y  ++P ++L +R++++ Q YTQ
Sbjct: 72  YIFPISRHVGMVANGPIPDARNAAMRAKMEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPRQQEITTSLENYFK 188

>Suva_7.270 Chr7 complement(465865..466623) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  107 bits (266), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 61/187 (32%), Positives = 101/187 (54%), Gaps = 3/187 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ I   +  V+ +++KV   LL+ +T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAIRGKNCTVVISQKKVPDKLLDPNTVS- 70

Query: 65  KIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            I+ ++  I + V G   DA      A+  A E+   Y  ++P ++L +R++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDI 184
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K   
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKS- 189

Query: 185 KVDEAIE 191
           K+D   E
Sbjct: 190 KIDHINE 196

>TPHA0A05670 Chr1 (1284623..1285324) [702 bp, 233 aa] {ON} 
          Length = 233

 Score =  106 bits (264), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 72/221 (32%), Positives = 111/221 (50%), Gaps = 7/221 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ + +  V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKNYAVITALKRNADEL---S 57

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +KI R ++ + +++AGL  DA +L N  R         +N ++ VE     LSD  Q
Sbjct: 58  SYQKKIIRCDEHLGLSLAGLAPDARVLSNYLRQQCNYSQLVFNRKLSVEKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--M 178
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+  M
Sbjct: 118 QNTQSYGGRPYGVGLLIIGYDNS-GAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLERVM 176

Query: 179 DYKDDIK-VDEAIELALKTLSKTTDSSALTYDRVEFATIKK 218
           D   +I+  +E I+  ++ L ++     LT D +  A + K
Sbjct: 177 DKYIEIEDPEELIKTCVEALRQSLKDETLTTDNLSIAIVGK 217

>Smik_7.279 Chr7 complement(466525..467283) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  106 bits (264), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 57/177 (32%), Positives = 96/177 (54%), Gaps = 2/177 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +   +  V+ +++KV   LL+  T+  
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDP-TTVS 70

Query: 65  KIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            I+ ++  I + V G   DA      A+  A E+   Y  ++P ++L +R++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFK 187

>NCAS0D02310 Chr4 complement(433672..434373) [702 bp, 233 aa] {ON}
           Anc_5.1
          Length = 233

 Score =  105 bits (263), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 69/219 (31%), Positives = 108/219 (49%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +S   VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSSKYAVLVALKRNADEL---S 57

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +KI + ++ + +A+AGL  DA +L N  R         +N ++ VE     L D  Q
Sbjct: 58  SFQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQCNYSDMVFNRKLSVEKAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIVGY-DKSGPHLLEFQPSGNTLELYGSAIGARSQGAKTYLERVL 176

Query: 181 KDDIKVDEAIEL---ALKTLSKTTDSSALTYDRVEFATI 216
              +++++A EL    ++ L ++     L+ D +  A +
Sbjct: 177 DKFVEIEDAEELIKTGVEALKQSLKDETLSTDNLSIAIV 215

>Kpol_1060.1 s1060 complement(1850..2551) [702 bp, 233 aa] {ON}
           complement(1850..2551) [702 nt, 234 aa]
          Length = 233

 Score =  105 bits (263), Expect = 6e-27,   Method: Compositional matrix adjust.
 Identities = 71/219 (32%), Positives = 111/219 (50%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   VLAA ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSNKYAVLAALKRNADEL---S 57

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +KI + ++ + +++AGL  DA +L N  R         +N ++ VE     LSD  Q
Sbjct: 58  SYQKKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCHYSQLVFNRKLSVEKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--M 178
             TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+  M
Sbjct: 118 QNTQSYGGRPYGVGLLLIGYDNS-GAHLLEFQPSGNTLEVYGSAIGARSQGAKTYLEKVM 176

Query: 179 DYKDDIK-VDEAIELALKTLSKTTDSSALTYDRVEFATI 216
           D   D++  +E I+  ++ L ++     LT + +  A +
Sbjct: 177 DNFVDLEDPEELIKTCVEALRQSLKDETLTTENLSIAIV 215

>KLLA0A10153g Chr1 complement(892398..893099) [702 bp, 233 aa] {ON}
           highly similar to uniprot|P40302 Saccharomyces
           cerevisiae YMR314W PRE5 20S proteasome alpha-type
           subunit
          Length = 233

 Score =  105 bits (262), Expect = 7e-27,   Method: Compositional matrix adjust.
 Identities = 75/242 (30%), Positives = 119/242 (49%), Gaps = 13/242 (5%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASD-GIVLAAERKVTSTLLEQ 59
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++   +V+A +R       E 
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSTKYAVVVALKRNAD----EL 56

Query: 60  DTSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK 119
            +  +KI + +D + V++AGL  DA +L N  R         YN ++ +E     LSD  
Sbjct: 57  SSYQKKIIKCDDHLGVSLAGLAPDARVLSNYLRQQCNYSSLVYNRKLALERAGYLLSDKA 116

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM- 178
           Q  TQ  G RP+GV  +  GYD+  G  L    PSGN       ++GA +  A+T L+  
Sbjct: 117 QKNTQSYGGRPYGVGLLLIGYDNT-GAHLLEFQPSGNTLELYGTAIGARSQGAKTYLERV 175

Query: 179 --DYKDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQ 236
             D+++    DE I+  ++ L  +     L+   +  A +    +DK +  I+  E+++ 
Sbjct: 176 LDDFREIEDADELIKHGVEALRHSLKDETLSTKNLSIAIVG---HDKPF-TIYDGEDVQP 231

Query: 237 LL 238
            L
Sbjct: 232 YL 233

>Skud_7.276 Chr7 complement(477638..478396) [759 bp, 252 aa] {ON}
           YGL011C (REAL)
          Length = 252

 Score =  105 bits (262), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 60/187 (32%), Positives = 100/187 (53%), Gaps = 3/187 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +   +  V+ +++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLYQVEYAFKATNQTNINSLAVRGKNCTVVISQKKVPDKLLDPATVS- 70

Query: 65  KIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            I+ ++  I + V G   DA      A+  A E+   Y  ++P ++L +R++++ Q YTQ
Sbjct: 71  YIFSISRTIGMVVNGPIPDARNAALRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDI 184
              +RP GV   +   D+  G  +Y ++P+G Y G+KA + G       T L+  +K   
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYYVGYKATATGPKQQEITTNLENHFKKS- 189

Query: 185 KVDEAIE 191
           K+D   E
Sbjct: 190 KIDHIKE 196

>CAGL0A00407g Chr1 (41556..42320) [765 bp, 254 aa] {ON} highly
           similar to uniprot|P21243 Saccharomyces cerevisiae
           YGL011c SCL1
          Length = 254

 Score =  105 bits (262), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 68/240 (28%), Positives = 120/240 (50%), Gaps = 10/240 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRLYQVEYA ++ +     ++ +   +  V+  ++KV   LL+  T + 
Sbjct: 13  YDRHITIFSPEGRLYQVEYAFKATNQTNLNSLAVRGKNCSVIINQKKVPDKLLDPSTVS- 71

Query: 65  KIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            I++++  I +   G   DA      A+  A E+   Y  ++P ++L +R++++ Q YTQ
Sbjct: 72  YIFKISKTIGMVANGPIPDARNAAARAKGEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK--- 181
              +RP GV   +   D+  G  +Y  +P+G Y G+KA + G       T L+  YK   
Sbjct: 132 RAYMRPLGVILTFISVDEELGPSIYKCDPAGYYVGYKATATGPKQQELTTSLENYYKKKN 191

Query: 182 --DDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQLLL 239
               + ++E  ++    +++  DS    + + +       EN  I   I  P+EI++ L+
Sbjct: 192 VGSHLDMEEWEKVVEFGITQMIDSLGTEFSKKDLEIGVATENKFI---ILTPDEIEERLV 248

>TDEL0F02360 Chr6 complement(436203..436964) [762 bp, 253 aa] {ON}
           Anc_4.110 YGL011C
          Length = 253

 Score =  104 bits (260), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 56/179 (31%), Positives = 96/179 (53%), Gaps = 2/179 (1%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +   +  V+  ++KV   LLE  T + 
Sbjct: 13  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGRNSTVVINQKKVPDKLLEASTVS- 71

Query: 65  KIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            I+ ++  I +   G   DA      A+  A EY   Y  ++P ++L +R++++ Q YTQ
Sbjct: 72  YIFPISRTIGMVANGAIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 131

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDD 183
              +RP GV   +   D+  G  +Y ++P+G + G+KA + G       T L+  +K++
Sbjct: 132 RAYMRPLGVILTFVSVDEELGPSIYKTDPAGYFVGYKATATGPKQQEISTRLENSFKNN 190

>Ecym_5650 Chr5 complement(1313015..1313716) [702 bp, 233 aa] {ON}
           similar to Ashbya gossypii AGL336W
          Length = 233

 Score =  104 bits (259), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 65/192 (33%), Positives = 98/192 (51%), Gaps = 4/192 (2%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +   +VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSEKYVVLVALKRNADEL---S 57

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +KI + ++ + +++AGL  DA +L N  R         YN  + +      LSD  Q
Sbjct: 58  SYQKKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSQLVYNRNLSLVKAGHLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLAGYDNS-GAHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 176

Query: 181 KDDIKVDEAIEL 192
           ++ +K++ A EL
Sbjct: 177 EEYLKIETADEL 188

>KNAG0D03540 Chr4 complement(648200..648958) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score =  103 bits (257), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 64/200 (32%), Positives = 103/200 (51%), Gaps = 9/200 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ I      V+  ++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNVNSMAIRGETCSVIVNQKKVPDKLLDPSTVS- 70

Query: 65  KIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            I+ ++  I +   G   DA      A+  A EY   Y  ++P ++L +R++++ Q YTQ
Sbjct: 71  YIFPISKTIGMVANGPIPDARNAALRAKAEAAEYRYKYGYDMPCDVLAKRMANLSQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK--- 181
              +RP GV   +   D+  G  +Y S+P+G Y G+KA + G       T L+  +K   
Sbjct: 131 RAYMRPLGVILTFVSVDEELGPSIYKSDPAGYYVGYKATATGPKQQEITTNLENYFKKSK 190

Query: 182 -DDIKVD---EAIELALKTL 197
            D +K D   + +E A+  L
Sbjct: 191 TDTLKEDAWEKVVEFAITHL 210

>NDAI0I02640 Chr9 (613923..614624) [702 bp, 233 aa] {ON} Anc_5.1
          Length = 233

 Score =  102 bits (254), Expect = 1e-25,   Method: Compositional matrix adjust.
 Identities = 67/219 (30%), Positives = 107/219 (48%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    VL A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSVTVGLRSKKHAVLVALKRNADEL---S 57

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +KI + ++ + +A+AGL  DA +L N  R         YN ++ VE     L D  Q
Sbjct: 58  SYQKKIIKCDEHLGLALAGLAPDARVLSNYLRQQCNYSSLIYNRKLSVEKAGHLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  G+D+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLIVGHDNS-GPHLLEFQPSGNTVELYGSAIGARSQGAKTYLERVL 176

Query: 181 KDDIKVDEAIEL---ALKTLSKTTDSSALTYDRVEFATI 216
              I++++  EL    +++L ++     L+ + +  A +
Sbjct: 177 DQFIEIEDPEELIKTGVESLKQSLKDETLSTENLSIAIV 215

>AGL336W Chr7 (81511..82431) [921 bp, 306 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR314W (PRE5)
          Length = 306

 Score =  103 bits (257), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 68/221 (30%), Positives = 111/221 (50%), Gaps = 7/221 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ ++  +VL A ++    L    
Sbjct: 74  MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSNKYVVLVALKRNADEL---S 130

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +KI + +D + +++AGL  DA +L N  R         Y  ++ V    + LSD  Q
Sbjct: 131 SYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQQCNYSQLVYARDLSVVKAGQLLSDKAQ 190

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  + AGYD+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 191 KNTQSYGGRPYGVGLLLAGYDNS-GAHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 249

Query: 181 KDDIKVDEA---IELALKTLSKTTDSSALTYDRVEFATIKK 218
           ++ +++++A   I+  ++ L  +     L+   +  A + K
Sbjct: 250 EEYLEIEDADALIKHGVEALKHSLKDETLSTKNLSIAIVGK 290

>TBLA0C07190 Chr3 (1742456..1743157) [702 bp, 233 aa] {ON} Anc_5.1
           YMR314W
          Length = 233

 Score =  101 bits (251), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 68/219 (31%), Positives = 107/219 (48%), Gaps = 7/219 (3%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  +  FSP GRL+QVEYALE+I      +G+ +    VL A ++    L    
Sbjct: 1   MFRNNYDGDSVTFSPTGRLFQVEYALEAIKQGSVTVGLRSHKYAVLVALKRNADEL---S 57

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           +  +KI + +  + +++AGL  DA +L N  R         ++ ++ VE     LSD  Q
Sbjct: 58  SYQKKIIKCDTHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFDRKLSVEKAGSLLSDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  GYD+  G  L    PSGN       S+GA +  A+T L+   
Sbjct: 118 QNTQSYGGRPYGVGLLVIGYDNS-GSHLLEFQPSGNVLELYGSSIGARSQGAKTYLERVL 176

Query: 181 KDDIKVD---EAIELALKTLSKTTDSSALTYDRVEFATI 216
            D +++D   E I++ ++ L ++     LT   +  A +
Sbjct: 177 DDFLEIDNVEELIKVGVEALKQSLKDEDLTTQNLSIAFV 215

>KAFR0I02720 Chr9 (551846..552553) [708 bp, 235 aa] {ON} Anc_5.1
           YMR314W
          Length = 235

 Score = 98.6 bits (244), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 109/224 (48%), Gaps = 11/224 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASD-GIVLAAERKVTSTLLEQ 59
           M    YD  T  FSP GRL+Q+EYA+E+I      +G+ + +   V+A +R       E 
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQLEYAIEAIKQGSVTVGLRSKNYACVVALKRNAD----EL 56

Query: 60  DTSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIK 119
            +  +KI + +D + +++AGL  DA +L N  R         +N ++ VE     LSD  
Sbjct: 57  SSYQKKIIKCDDHMGLSLAGLAPDARVLSNFLRQQCNYSKLVFNRDLSVEKAGFLLSDKA 116

Query: 120 QGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQM- 178
           Q  TQ  G RP+GV  +  GY D+ G  L    PSGN       ++GA +  ++T L+  
Sbjct: 117 QKNTQSYGGRPYGVGLLVVGY-DKTGPHLLEFQPSGNVMELYGTAIGARSQGSKTYLERV 175

Query: 179 --DYK--DDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKK 218
             ++K  +D   +  I++ ++ + ++     L  D +    + K
Sbjct: 176 LDEFKELEDEDPESIIKVGVQAIQQSLKDEVLNTDNLSIGIVGK 219

>SAKL0H00946g Chr8 (106740..107441) [702 bp, 233 aa] {ON} highly
           similar to uniprot|P40302 Saccharomyces cerevisiae
           YMR314W PRE5 20S proteasome alpha-type subunit
          Length = 233

 Score = 98.2 bits (243), Expect = 4e-24,   Method: Compositional matrix adjust.
 Identities = 66/224 (29%), Positives = 110/224 (49%), Gaps = 9/224 (4%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQD 60
           M    YD  T  FSP GRL+QVEYALE+I      +G+ +    V+ A ++    L    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVEYALEAIKQGSATVGLRSKKHAVVVALKRNADEL---S 57

Query: 61  TSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQ 120
           +   KI + ++ + +++AGL  DA +L N  R         +N ++ +E     L D  Q
Sbjct: 58  SYQNKIIKCDEHMGLSLAGLAPDARVLSNYLRQQCNYSSLVFNRKLSLEKAGYLLCDKAQ 117

Query: 121 GYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDY 180
             TQ  G RP+GV  +  G+D+  G  L    PSGN       ++GA +  A+T L+   
Sbjct: 118 KNTQSYGGRPYGVGLLLIGHDNS-GPHLLEFQPSGNTLELYGAAIGARSQGAKTYLERVM 176

Query: 181 KDDIKVDEAIEL---ALKTLSKTTDSSALTYDRVEFATIKKGEN 221
           ++ +++++A EL    ++ L ++     L+   +  A +  GEN
Sbjct: 177 EEYLEIEDADELIKKGVEALKQSLKDETLSTKNLSIAIV--GEN 218

>KAFR0F03430 Chr6 complement(682440..683198) [759 bp, 252 aa] {ON}
           Anc_4.110 YGL011C
          Length = 252

 Score = 97.4 bits (241), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 56/200 (28%), Positives = 104/200 (52%), Gaps = 9/200 (4%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAG-TAIGIMASDGIVLAAERKVTSTLLEQDTSTE 64
           YD   TIFSPEGRL+QVEYA ++ +     ++ +   +  V+  ++KV   LL+  T + 
Sbjct: 12  YDRHITIFSPEGRLFQVEYAFKATNQTNINSLAVRGKNCAVVINQKKVPDKLLDPATLS- 70

Query: 65  KIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQ 124
            I+ ++  + +   G   DA      A+  A E+   Y  ++P + L +R++++ Q YTQ
Sbjct: 71  YIFPISRHVGMLANGPIPDARNAALRAKAEAAEFRYKYGYDMPCDALAKRMANLAQIYTQ 130

Query: 125 HGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ------- 177
              +RP GV   +  +D+  G  +Y ++P+G + G+KA + G       T L+       
Sbjct: 131 RAYMRPLGVILTFISFDEELGPSIYKTDPAGYFVGYKATATGPKQQEITTSLENYFKKNN 190

Query: 178 MDYKDDIKVDEAIELALKTL 197
           +D+ ++   ++ +E A+  L
Sbjct: 191 VDHLEEESWEKVVEFAITHL 210

>TDEL0G00240 Chr7 complement(46296..47012) [717 bp, 238 aa] {ON}
           Anc_5.1 YMR314W
          Length = 238

 Score = 90.1 bits (222), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 69/246 (28%), Positives = 114/246 (46%), Gaps = 16/246 (6%)

Query: 1   MGSRRYDSRTTIFSPEGRLYQVEY-----ALESISHAGTAIGIMASDGIVLAAERKVTST 55
           M    YD  T  FSP GRL+QV+Y     ALE+I      +G+ +    VL A ++    
Sbjct: 1   MFRNNYDGDTVTFSPTGRLFQVDYTKLYDALEAIKQGSVTVGLHSKKYAVLVALKRNADE 60

Query: 56  LLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRL 115
           L    +   KI + ++ + +++AGL  DA +L N  R         +N ++ VE     L
Sbjct: 61  L---SSYQRKIIKCDEHLGLSLAGLAPDARVLSNYLRQQCNYSNLVFNRKLSVEKAGHLL 117

Query: 116 SDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTL 175
            D  Q  TQ  G RP+GV  +  G+ D+ G  L    PSGN       ++GA +  A+T 
Sbjct: 118 CDKAQKNTQSYGGRPYGVGLLIIGH-DKSGAHLLEFQPSGNTLELYGSAIGARSQGAKTY 176

Query: 176 LQMDYKDDIKVDEAIEL---ALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPE 232
           L+      +++++  EL    ++ L ++     L+ + +  A +  GE+    Q  +  E
Sbjct: 177 LERTLDTFLEIEDPNELIKQGVEALRQSLKDETLSNNNLSIAIV--GEDLPFTQ--YDNE 232

Query: 233 EIKQLL 238
            + Q L
Sbjct: 233 AVSQFL 238

>Kwal_26.6819 s26 (77152..77742) [591 bp, 196 aa] {ON} YOR362C
           (PRE10) - proteasome component YC1 (protease yscE
           subunit 1) [contig 44] FULL
          Length = 196

 Score = 70.1 bits (170), Expect = 7e-14,   Method: Compositional matrix adjust.
 Identities = 44/150 (29%), Positives = 72/150 (48%), Gaps = 3/150 (2%)

Query: 83  DAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDD 142
           D   L+N AR  A  + KTY   I +  L  RL    Q +T +  +RPFG++ I  G D+
Sbjct: 3   DGRHLVNRAREEAASFKKTYGTPITLPALADRLGQYVQAHTLYNSVRPFGITAIVGGVDE 62

Query: 143 RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--MDYKDDIKVDEAIELALKTLSKT 200
             G  LY   PSG+Y G+K  + G    +A+  L+  +  K DI   EA++ A + +   
Sbjct: 63  N-GAHLYMLEPSGSYWGYKGAATGKGRQSAKAELEKILSSKPDISAKEAVKEAARVVYLA 121

Query: 201 TDSSALTYDRVEFATIKKGENDKIYQKIFK 230
            D +      +E +     E + +++ + K
Sbjct: 122 HDDNKEKEFELEMSWCSVSETNGLHKAVPK 151

>NDAI0D03560 Chr4 complement(848282..848800) [519 bp, 172 aa] {ON}
           Anc_4.110
          Length = 172

 Score = 62.0 bits (149), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 32/103 (31%), Positives = 53/103 (51%)

Query: 79  GLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYA 138
           G   DA      A+  A E+   Y  ++P ++L +R++++ Q YTQ   +RP GV   + 
Sbjct: 5   GPIPDARNAATRAKAEAAEFRYKYGYDMPCDVLAKRMANLSQIYTQRAYMRPLGVILTFV 64

Query: 139 GYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYK 181
             D+  G  +Y S+P+G Y G+KA + G       T L+  +K
Sbjct: 65  SVDEELGPSIYKSDPAGYYVGYKATATGPKQQEITTNLENYFK 107

>SAKL0G04290g Chr7 (354481..355266) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 58.2 bits (139), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 60/227 (26%), Positives = 106/227 (46%), Gaps = 16/227 (7%)

Query: 20  YQVEYALESISHA-------GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLND 71
           YQ    L + SHA       GT I G+  + G+V+AA+ + T   +  D + EK++R++ 
Sbjct: 9   YQRNQFLAAKSHAQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCEKLHRISP 68

Query: 72  KITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPF 131
           +I  A AG  AD E +      + + +    N E  V   V  L  +KQ   ++ G    
Sbjct: 69  RIWCAGAGTAADTEAVTQLIGSNIELHSLYTNREPRV---VSALQMLKQHLFKYQG--HV 123

Query: 132 GVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIE 191
           G   I AG D   G  L++ +  G+       S+G+ + AA  +L+ ++K ++  +EAIE
Sbjct: 124 GAYLIVAGVDPT-GAHLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWKQNLSREEAIE 182

Query: 192 LALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPE--EIKQ 236
           LA   +     +   +   V+   ++ G++ ++ +    P   E KQ
Sbjct: 183 LASNAIEAGIWNDLGSGSNVDICVMEVGKDAELLRNYLTPNVREAKQ 229

>Smik_15.337 Chr15 complement(586945..587730) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 57.4 bits (137), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 80/160 (50%), Gaps = 6/160 (3%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTARV 93
           T +G+  +DG+V+AA+ + T   +  D +  K++R++ KI  A AG  AD E +      
Sbjct: 31  TIVGVKYNDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGS 90

Query: 94  HAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNP 153
           +  E    Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ + 
Sbjct: 91  NI-ELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIHA 144

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELA 193
            G+      +S+G+ + AA  +L+  +K D+  DEA++LA
Sbjct: 145 HGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAVKLA 184

>KAFR0C05300 Chr3 (1062416..1063201) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 56.6 bits (135), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 52/182 (28%), Positives = 86/182 (47%), Gaps = 14/182 (7%)

Query: 20  YQVEYALESISH--------AGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLND 71
           YQ    L S SH          T +G+  + G+V+AA+ + T   +  D +  K++R++ 
Sbjct: 9   YQRNSFLSSKSHKQPKATSTGTTIVGVKFNGGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  KITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPF 131
           +I  A AG  AD E +      + + +  +   E  V   V  L  +KQ   ++ G    
Sbjct: 69  RIWCAGAGTAADTEAVTQLISSNIELHSLSTRREPRV---VTTLQMLKQHLFRYQG--HI 123

Query: 132 GVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIE 191
           G   I AG D   G  L++ +  G+      +S+G+ + AA  +L+  ++ DI  DEAIE
Sbjct: 124 GAYLIVAGVDPT-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESKWRADISKDEAIE 182

Query: 192 LA 193
           LA
Sbjct: 183 LA 184

>Skud_15.321 Chr15 complement(579715..580500) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 56.2 bits (134), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 53/205 (25%), Positives = 96/205 (46%), Gaps = 8/205 (3%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTARV 93
           T +G+  ++G+V+AA+ + T   +  D +  K++R++ KI  A AG  AD E +      
Sbjct: 31  TIVGVKYNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGS 90

Query: 94  HAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNP 153
           +  E    Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ + 
Sbjct: 91  NI-ELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIHA 144

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTYDRVEF 213
            G+      +S+G+ + AA  +L+  +K D+  DEAI+LA   +     +   +   V+ 
Sbjct: 145 HGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAIKLASDAIQAGIWNDLGSGSNVDV 204

Query: 214 ATIKKGENDKIYQKIFKPE--EIKQ 236
             ++ G++ +  +    P   E KQ
Sbjct: 205 CVMEVGKDAEYLRNYLTPNVRETKQ 229

>KNAG0B03800 Chr2 complement(729075..729860) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 51/205 (24%), Positives = 97/205 (47%), Gaps = 8/205 (3%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTARV 93
           T +G+   +G+V+AA+ + T   +  D +  K++R++ +I  A AG  AD E +      
Sbjct: 32  TIVGVKFHNGVVIAADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTEAVTQLIGS 91

Query: 94  HAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNP 153
           +  E    Y +  P   +V  L  +KQ   ++ G    G   I AG D   G  L++   
Sbjct: 92  NV-ELHSLYAKRQPR--VVTALQMLKQHLFKYQG--HIGAYLIVAGTDPT-GAHLFSVQA 145

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTYDRVEF 213
            G+      +S+G+ + AA  +L+ ++K+D+  +EAI+LA   +     +   +   V+ 
Sbjct: 146 HGSTDVGFYLSLGSGSLAAMAVLESNWKEDLSKEEAIKLASDAIQAGIWNDLGSGSNVDL 205

Query: 214 ATIKKGENDKIYQKIFKPE--EIKQ 236
             ++ G++ +  +    P   E KQ
Sbjct: 206 CVMETGKDAEYLRNYITPNVREAKQ 230

>Suva_8.208 Chr8 complement(380119..380904) [786 bp, 261 aa] {ON}
           YOR157C (REAL)
          Length = 261

 Score = 55.5 bits (132), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 47/160 (29%), Positives = 79/160 (49%), Gaps = 6/160 (3%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTARV 93
           T +G+   +G+V+AA+ + T   +  D +  K++R++ KI  A AG  AD E +      
Sbjct: 31  TIVGVKYKNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGS 90

Query: 94  HAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNP 153
           +  E    Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ + 
Sbjct: 91  NI-ELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIHA 144

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELA 193
            G+      +S+G+ + AA  +L+  +K D+  DEAI+LA
Sbjct: 145 HGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKDEAIKLA 184

>NDAI0C01170 Chr3 complement(235314..236105) [792 bp, 263 aa] {ON}
           Anc_5.507 YOR157C
          Length = 263

 Score = 55.1 bits (131), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 52/205 (25%), Positives = 96/205 (46%), Gaps = 8/205 (3%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTARV 93
           T +G+   DG+V+AA+ + T   +  D +  K++R++ KI  A AG  AD E +      
Sbjct: 32  TIVGLKYRDGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGS 91

Query: 94  HAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNP 153
           +  E    Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ + 
Sbjct: 92  NI-ELHSLYTSRSPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIHA 145

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTYDRVEF 213
            G+      +S+G+ + AA  +L+  ++ ++  +EAIELA + +     +   +   V+ 
Sbjct: 146 HGSTDVGYYLSLGSGSLAAMAVLESQWRPELSKEEAIELASQAIQAGIWNDLGSGSNVDV 205

Query: 214 ATIKKGENDKIYQKIFKPE--EIKQ 236
             ++ G++ +  +    P   E KQ
Sbjct: 206 CVMEVGKDAEYLRNYVTPNVREAKQ 230

>YOR157C Chr15 complement(630966..631751) [786 bp, 261 aa] {ON}
           PUP1Beta 2 subunit of the 20S proteasome; endopeptidase
           with trypsin-like activity that cleaves after basic
           residues; synthesized as a proprotein before being
           proteolytically processed for assembly into 20S
           particle; human homolog is subunit Z
          Length = 261

 Score = 54.3 bits (129), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 46/160 (28%), Positives = 80/160 (50%), Gaps = 6/160 (3%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTARV 93
           T +G+  ++G+V+AA+ + T   +  D +  K++R++ KI  A AG  AD E +      
Sbjct: 31  TIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISPKIWCAGAGTAADTEAVTQLIGS 90

Query: 94  HAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNP 153
           +  E    Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ + 
Sbjct: 91  NI-ELHSLYTSREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GSHLFSIHA 144

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELA 193
            G+      +S+G+ + AA  +L+  +K D+  +EAI+LA
Sbjct: 145 HGSTDVGYYLSLGSGSLAAMAVLESHWKQDLTKEEAIKLA 184

>ZYRO0D12034g Chr4 (1020703..1021488) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 261

 Score = 53.9 bits (128), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 78/160 (48%), Gaps = 6/160 (3%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTARV 93
           T +G+    G+V+AA+ + T   +  D +  K++R+  +I  A AG  AD E +      
Sbjct: 31  TIVGVKYDKGVVIAADTRSTQGPIVADKNCAKLHRMAPRIWCAGAGTAADTEAVTQLIGS 90

Query: 94  HAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNP 153
           + + + +  N E  V   V  L  +KQ   ++ G    G   I AG D   G  L++   
Sbjct: 91  NLELHSQYANREPRV---VSALQMLKQHLFRYQG--HIGAYLIVAGVDPT-GAHLFSVQA 144

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELA 193
            G+      +S+G+ + AA   L+ ++K ++  DEA++LA
Sbjct: 145 HGSTDVGHYLSLGSGSLAAMATLESNWKQNLTKDEAVKLA 184

>Kpol_534.57 s534 (145742..146389) [648 bp, 215 aa] {ON}
           (145742..146389) [648 nt, 216 aa]
          Length = 215

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 90/209 (43%), Gaps = 16/209 (7%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+K+ R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHAQEYLKTYNE---EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y E   E+   I      + K   T            I AGYD+    Q+
Sbjct: 79  QYHLEMYTAQYGEPSTEVAASIFKTLCYENKDNLT---------AGIIVAGYDEANKGQV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTY 208
           Y+    G+         G+ ++        ++K+D+  +E IE    +LS+       + 
Sbjct: 130 YSIPLGGSVHRQPYAIAGSGSAFIYGYCDKNFKEDMTKEETIEFMKHSLSQAIKWDGSSG 189

Query: 209 DRVEFATIKKGENDKIYQKIFKPEEIKQL 237
             +    + K   +++   IF P+E ++L
Sbjct: 190 GVIRMVVLTKDGAERL---IFYPDEYEKL 215

>Kpol_2002.109 s2002 (258951..259598) [648 bp, 215 aa] {ON}
           (258951..259598) [648 nt, 216 aa]
          Length = 215

 Score = 52.4 bits (124), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/209 (22%), Positives = 90/209 (43%), Gaps = 16/209 (7%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+K+ R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHAQEYLKTYNE---EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y E   E+   I      + K   T            I AGYD+    Q+
Sbjct: 79  QYHLEMYTAQYGEPSTEVAASIFKTLCYENKDNLT---------AGIIVAGYDEANKGQV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTY 208
           Y+    G+         G+ ++        ++K+D+  +E IE    +LS+       + 
Sbjct: 130 YSIPLGGSVHRQPYAIAGSGSTFIYGYCDKNFKEDMTKEETIEFMKHSLSQAIKWDGSSG 189

Query: 209 DRVEFATIKKGENDKIYQKIFKPEEIKQL 237
             +    + K   +++   IF P+E ++L
Sbjct: 190 GVIRMVVLTKDGAERL---IFYPDEYEKL 215

>TDEL0A03710 Chr1 (663138..663923) [786 bp, 261 aa] {ON} Anc_5.507
           YOR157C
          Length = 261

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 54/182 (29%), Positives = 86/182 (47%), Gaps = 14/182 (7%)

Query: 20  YQVEYALESISHA-------GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLND 71
           YQ    L S SHA       GT I G+  ++G+V+AA+ + T   +  D +  K++R++ 
Sbjct: 9   YQRNNFLASKSHAQPKATSTGTTIVGVKFNNGVVIAADTRSTQGPIVADKNCAKLHRISP 68

Query: 72  KITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPF 131
           +I  A AG  AD E +      +  E    Y    P   +V  L  +KQ   ++ G    
Sbjct: 69  RIWCAGAGTAADTEAVTQLISSNL-ELHSLYASREPR--VVSALQMLKQHLFKYQG--HI 123

Query: 132 GVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIE 191
           G   I AG D   G  L++ +  G+       S+G+ + AA  +L+  +K D+  +EAI 
Sbjct: 124 GAYLIVAGVDPT-GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKQDLTKEEAIN 182

Query: 192 LA 193
           LA
Sbjct: 183 LA 184

>KLLA0A02233g Chr1 complement(198766..199554) [789 bp, 262 aa] {ON}
           highly similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 262

 Score = 52.8 bits (125), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/198 (23%), Positives = 92/198 (46%), Gaps = 6/198 (3%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTARV 93
           T +G+  + G+++AA+ + T   +  D + EK++R+  +I  A AG  AD E +      
Sbjct: 32  TIVGVKFNGGVIIAADTRSTQGPIVADKNCEKLHRIAPRIWCAGAGTAADTEAVTQLISS 91

Query: 94  HAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNP 153
           +  E    Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ + 
Sbjct: 92  NI-ELHSLYTGREPR--VVSSLQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIHA 145

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTYDRVEF 213
            G+       S+G+ + AA  +L+ ++  D+  +EAI+LA   +     +   +   V+ 
Sbjct: 146 HGSTDVGYYQSLGSGSLAAMAVLEANWNQDLSKEEAIKLASDAIEAGIWNDLGSGSNVDV 205

Query: 214 ATIKKGENDKIYQKIFKP 231
             ++ G++ ++ +    P
Sbjct: 206 CVMEVGKDAQLLRNYLCP 223

>Kwal_47.18748 s47 complement(955252..956043) [792 bp, 263 aa] {ON}
           YOR157C (PUP1) - putative proteasome subunit [contig
           190] FULL
          Length = 263

 Score = 51.6 bits (122), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 51/214 (23%), Positives = 102/214 (47%), Gaps = 15/214 (7%)

Query: 27  ESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAE- 85
           ++ S   T +G+  + G+V+AA+ + T   +  + +  K++R++ KI  A AG  AD E 
Sbjct: 24  QATSTGTTIVGVKYNGGVVIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTEE 83

Query: 86  ---ILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDD 142
              ++ +   +H+      Y    P   +V  L  +KQ   ++ G    G   I AG D 
Sbjct: 84  VTKLIGSNLELHS-----LYASRAPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDP 134

Query: 143 RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTD 202
             G  L++ +  G+       S+G+ + AA  +L+  +K+DI  +EA++LA   +     
Sbjct: 135 T-GAHLFSIHAHGSTDVGYYQSLGSGSLAAMAVLESHWKEDINREEAMQLASDAIEAGIW 193

Query: 203 SSALTYDRVEFATIKKGENDKIYQKIFKPEEIKQ 236
           +   +   V+   ++ G+ D  Y + +K   +++
Sbjct: 194 NDLGSGSNVDLCVMEVGK-DAEYLRNYKTPNVRE 226

>AGL324W Chr7 (102113..102844) [732 bp, 243 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBL041W (PRE7)
          Length = 243

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 44/204 (21%), Positives = 84/204 (41%), Gaps = 21/204 (10%)

Query: 32  AGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTA 91
           AGT +GI   D  VLA + + T+          K++   D I ++  G  AD + L+   
Sbjct: 31  AGTILGIAGEDFAVLAGDTRHTTGYSINSREEPKVFDCGDNILISANGFAADGDALVKRF 90

Query: 92  RVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
           +   + Y   +N+++ ++   R +  +  G      + P+ V  I AG D+     +Y+ 
Sbjct: 91  KNSMKWYRFDHNKKMTIKSAARSIQHLLYGKR----MFPYYVHTIIAGLDEEGKGAVYSY 146

Query: 152 NPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD---------------IKVDEAIELAL 194
           +P G+Y   +  + GA  S     L  Q+++K+                + VDE + L  
Sbjct: 147 DPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPDSNGTKKRALRFLSVDEVVRLVR 206

Query: 195 KTLSKTTDSSALTYDRVEFATIKK 218
              +  T+      D ++   + K
Sbjct: 207 DAFTSATERHIHVGDGLQIMIVTK 230

>Kpol_218.1 s218 complement(238..1023) [786 bp, 261 aa] {ON}
           complement(238..1023) [786 nt, 262 aa]
          Length = 261

 Score = 50.8 bits (120), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 78/160 (48%), Gaps = 6/160 (3%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTARV 93
           T +G+    G+V+AA+ + T   +  D +  K++R+  +I  A AG  AD E +      
Sbjct: 31  TIVGVKFDGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAADTEAVTQLIGS 90

Query: 94  HAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNP 153
           + + +    N E  V   V  L  +KQ   ++ G    G   I AG D   G  L++ + 
Sbjct: 91  NIELHSLYSNREPRV---VSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIHA 144

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELA 193
            G+       S+G+ + AA  +L+ ++K D+  +EAI+LA
Sbjct: 145 HGSTDVGYYHSLGSGSLAAMAVLESNWKQDLTKEEAIKLA 184

>CAGL0L04312g Chr12 complement(504465..505250) [786 bp, 261 aa] {ON}
           highly similar to uniprot|P25043 Saccharomyces
           cerevisiae YOR157c PUP1
          Length = 261

 Score = 50.8 bits (120), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 78/160 (48%), Gaps = 6/160 (3%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTARV 93
           T +G+  + G+V+AA+ + T   +  D +  K++R++ +I  A AG  AD E +      
Sbjct: 31  TIVGVKFAGGVVIAADTRSTQGPIVADKNCAKLHRISPRIWCAGAGTAADTEAVTQLIGS 90

Query: 94  HAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNP 153
           +  E    Y    P   +V  L  +KQ   ++ G    G   I AG D   G  L++ + 
Sbjct: 91  NI-ELHSLYTNRSPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSIHA 144

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELA 193
            G+       S+G+ + AA  +L+  +K D+  +EAI+LA
Sbjct: 145 HGSTDVGYYQSLGSGSLAAMAVLESHWKPDMTKEEAIQLA 184

>TBLA0D01750 Chr4 complement(430768..431547) [780 bp, 259 aa] {ON}
           Anc_5.507 YOR157C
          Length = 259

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 78/164 (47%), Gaps = 14/164 (8%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTARV 93
           T +G+  ++G+++AA+ + T   +  D +  K++R+  +I  A AG  AD E +      
Sbjct: 31  TIVGVKFNNGVIIAADTRSTQGPIVADKNCAKLHRMAPRIWCAGAGTAADTEAVTQLVGS 90

Query: 94  HAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDR----YGYQLY 149
           +  E    Y    P   +V  L  +KQ   ++ G    G   I AG D      +  Q +
Sbjct: 91  NL-ELHSLYTHREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDPTGPHLFAVQAH 145

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELA 193
            S   G Y      S+G+ + AA  +L+ ++K D+  +EA++LA
Sbjct: 146 GSTDVGFYH-----SLGSGSLAAMAVLETNWKQDLTKEEAMKLA 184

>Ecym_5458 Chr5 (940918..941694) [777 bp, 258 aa] {ON} similar to
           Ashbya gossypii AAR119W
          Length = 258

 Score = 50.4 bits (119), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/205 (22%), Positives = 97/205 (47%), Gaps = 8/205 (3%)

Query: 34  TAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTARV 93
           T +G+   +G+V+AA+ + T   +  + + EK+++++ +I  A AG  AD + +      
Sbjct: 31  TIVGVKFENGVVIAADTRSTQGPIVANKNCEKLHKISSRIWCAGAGTAADTDAVTGLIGS 90

Query: 94  HAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSNP 153
           + + +      E  V   V  L  +KQ   ++ G    G   I AG D   G  L++ + 
Sbjct: 91  NLELHSLFTGREPRV---VSALQKLKQHLFKYQG--HIGAYLIVAGVDPT-GAHLFSVHA 144

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTYDRVEF 213
            G+       S+G+ + AA  +L+ ++K+ +  +EAI+LA   +     +   +   V+ 
Sbjct: 145 HGSTDVGYYQSLGSGSLAAMAVLEANWKEHLTKEEAIKLAADAIEAGIWNDLGSGSNVDV 204

Query: 214 ATIKKGENDKIYQKIFKPE--EIKQ 236
             ++ G++ ++ +    P   E KQ
Sbjct: 205 CVMEVGKDAELLRNYITPNVREAKQ 229

>TPHA0E02050 Chr5 complement(426185..426970) [786 bp, 261 aa] {ON}
           Anc_5.507 YOR157C
          Length = 261

 Score = 50.1 bits (118), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 48/171 (28%), Positives = 81/171 (47%), Gaps = 7/171 (4%)

Query: 24  YALESISHAGTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTA 82
           YA    +  GT I G+    G+V+AA+ + T   +  D +  K++R+  +I  A AG  A
Sbjct: 20  YAQPKATSTGTTIVGVKFKGGVVIAADTRSTQGPIVADKNCAKLHRIAPRIWCAGAGTAA 79

Query: 83  DAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDD 142
           D E +      +  E    Y E  P   +V  L  +KQ   ++ G    G   I AG D 
Sbjct: 80  DTEAVTQLIGSNI-ELHSLYTERAPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGVDP 134

Query: 143 RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELA 193
             G  L++ +  G+       ++G+ + AA  +L+  +K D+  ++AI+LA
Sbjct: 135 T-GAHLFSIHAHGSTDVGYYHTLGSGSLAAMAVLESQWKQDLSKEDAIKLA 184

>NCAS0A14880 Chr1 complement(2932325..2933050) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 52/237 (21%), Positives = 98/237 (41%), Gaps = 26/237 (10%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLND 71
           +S E R   +E+     S + GT +GI   D  VLA + + T+          K++   D
Sbjct: 8   YSSEVRNTPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KITVAVAGLTADAEILINTARVHAQEYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRP 130
            I ++  G  AD E L+   +   + Y   +N+ ++ +    R +  +  G        P
Sbjct: 68  NIVISANGFAADGEALVKRFKNSLKWYHFDHNDKKLAMSSAARNIQHLLYGKR----FFP 123

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD----- 183
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+      
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGT 183

Query: 184 ----------IKVDEAIELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFK 230
                     + ++EAI+L     +  T+      D +E   + K   D + ++ F+
Sbjct: 184 DGKVKRPLKYLTIEEAIKLVRDAFTSATERHIHVGDGLEILIVTK---DGVRKEFFE 237

>KAFR0B00650 Chr2 (129107..129832) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 50/225 (22%), Positives = 88/225 (39%), Gaps = 30/225 (13%)

Query: 20  YQVEYALESISH--------AGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLND 71
           Y  E A + I H         GT +GI   D  VLA + + T+          K++   D
Sbjct: 8   YSNEVAQQPIEHRFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KITVAVAGLTADAEILINTARVHAQEYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRP 130
            I ++  G  AD E L+   +   + Y   +N+ ++ ++   R +  +  G        P
Sbjct: 68  NIVISANGFAADGEALVKRFKNSIKWYHFDHNDKKLSIKSAARNIQHLLYGKR----FFP 123

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD----- 183
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+      
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGS 183

Query: 184 ----------IKVDEAIELALKTLSKTTDSSALTYDRVEFATIKK 218
                     + +DE I L     +  T+      D +E   + K
Sbjct: 184 DGKVKRPLKYLNIDEVISLVRDAFTSATERHIHVGDGLEILIVTK 228

>KNAG0F03590 Chr6 complement(674528..675274) [747 bp, 248 aa] {ON}
           Anc_7.480 YBL041W
          Length = 248

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 49/221 (22%), Positives = 90/221 (40%), Gaps = 21/221 (9%)

Query: 15  PEGRLYQVEYALESIS-HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKI 73
           P      +E+     S + GT +GI   D  VLA + + T+       S  K++ + D I
Sbjct: 19  PSAMSQPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRSESKVFDVGDGI 78

Query: 74  TVAVAGLTADAEILINTARVHAQEYLKTYNEE-IPVEILVRRLSDIKQGYTQHGGLRPFG 132
            ++  G  AD+  L+   R   + Y    NE+ + +    R +  +  G        P+ 
Sbjct: 79  VISANGFAADSTALVKRFRNSLKWYHFNENEKRLSLSAAARNIQHLLYGKR----FFPYY 134

Query: 133 VSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD------- 183
           V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+        
Sbjct: 135 VHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYVPGTGE 194

Query: 184 ------IKVDEAIELALKTLSKTTDSSALTYDRVEFATIKK 218
                 + V+E ++L   + +  T+      D +E   + K
Sbjct: 195 KRPITYLSVEEVVKLVRDSFTSATERHIHVGDGLEILIVTK 235

>NDAI0J00600 Chr10 (125252..125977) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 48/225 (21%), Positives = 93/225 (41%), Gaps = 23/225 (10%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLND 71
           +S E     +E+A    + + GT +GI   D  +LA + + T+          K++   D
Sbjct: 8   YSSEVNSTPIEHAFNPYTDNGGTILGIAGEDFAILAGDTRHTTDYSINSRYEPKVFDCGD 67

Query: 72  KITVAVAGLTADAEILINTARVHAQEYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRP 130
            I ++  G  AD E L+   +   + Y   +N+ ++ ++   R +  +  G        P
Sbjct: 68  NIVISANGFAADGEALVKRFKNSLKWYHFDHNDKKLSMKSAARNIQHLLYGKR----FFP 123

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD----- 183
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+      
Sbjct: 124 YYVHTIIAGLDENGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQFEPGT 183

Query: 184 ----------IKVDEAIELALKTLSKTTDSSALTYDRVEFATIKK 218
                     + +DE I+L   + +  T+      D +E   + K
Sbjct: 184 DGKVKKPLKYLSIDEVIKLVRDSFTSATERHIHVGDGLEILIVTK 228

>KLTH0G03168g Chr7 (249621..250412) [792 bp, 263 aa] {ON} highly
           similar to uniprot|P25043 YOR157C Saccharomyces
           cerevisiae PUP1 Endopeptidase with trypsin- like
           activity that cleaves after basic residues
          Length = 263

 Score = 48.9 bits (115), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 44/171 (25%), Positives = 85/171 (49%), Gaps = 14/171 (8%)

Query: 27  ESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAE- 85
           ++ S   T +G+    G+++AA+ + T   +  + +  K++R++ KI  A AG  AD E 
Sbjct: 24  QATSTGTTIVGVKYDGGVLIAADTRSTQGPIVANKNCAKLHRISPKIWCAGAGTAADTEE 83

Query: 86  ---ILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDD 142
              ++ +   +H+      Y    P   +V  L  +KQ   ++ G    G   I AG D 
Sbjct: 84  VTKLIGSNLELHSM-----YASREPR--VVSALQMLKQHLFKYQG--HIGAYLIVAGADP 134

Query: 143 RYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELA 193
             G  L++ +  G+       S+G+ + AA  +L+ +++ D+K +EA++LA
Sbjct: 135 T-GTHLFSIHAHGSTDVGFYQSLGSGSLAAMAVLEANWRPDLKKEEAMQLA 184

>TDEL0E04130 Chr5 complement(771594..772188,772248..772312) [660 bp,
           219 aa] {ON} Anc_5.216 YJL001W
          Length = 219

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 41/206 (19%), Positives = 87/206 (42%), Gaps = 15/206 (7%)

Query: 35  AIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTARVH 94
           ++ +   DG++L A+ + T+     +  T+K+ R+++KI    +G  AD + + +  + H
Sbjct: 26  SMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHEKIWCCRSGSAADTQAIADIVQYH 85

Query: 95  AQEYLKTYNE---EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
              Y   Y E   +    +      + K   T            I AGYD++   ++Y+ 
Sbjct: 86  LDLYTAQYGEPSTKTAAAVFKELCYENKDNLT---------AGIIVAGYDEKNKGEVYSI 136

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTYDRV 211
              G+    K    G+ ++        ++KDD+  DE +     +LS+       +   +
Sbjct: 137 PLGGSMHKQKYAIAGSGSTFIYGYCDKNFKDDMTKDETVNFMKNSLSQAIKWDGSSGGVI 196

Query: 212 EFATIKKGENDKIYQKIFKPEEIKQL 237
               + K   +++   IF PE+ ++L
Sbjct: 197 RMVVLTKEGAERL---IFYPEDYEKL 219

>KLLA0E05633g Chr5 complement(502868..503590) [723 bp, 240 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 240

 Score = 48.5 bits (114), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/159 (23%), Positives = 70/159 (44%), Gaps = 6/159 (3%)

Query: 31  HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + + T+          K++   D I ++  G  AD E L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFECEDNILISANGFAADGEALVKR 86

Query: 91  ARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYT 150
            +     Y   +N+++ ++   R +  +  G      + P+ V  I AG D+     +Y+
Sbjct: 87  FKNSQMWYHFNHNKKLTIKSAARNIQHLLYGKR----MFPYYVHTIIAGLDEEGKGAVYS 142

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDDIKVD 187
            +P G+Y   +  + G+  S     L  Q++ K+  + D
Sbjct: 143 FDPVGSYEREQCRAGGSAASLIMPFLDNQVNLKNQYEPD 181

>NCAS0H02480 Chr8 (491249..492043) [795 bp, 264 aa] {ON} Anc_5.507
          Length = 264

 Score = 48.1 bits (113), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 105/228 (46%), Gaps = 17/228 (7%)

Query: 20  YQVEYALESISHA--------GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLN 70
           YQ   AL + SH+        GT I G+  ++G+++AA+ + T   +  + +  K++R++
Sbjct: 9   YQRNAALAAKSHSQQPKATSTGTTIVGVKYANGVIIAADTRSTQGPIVANKNCAKLHRIS 68

Query: 71  DKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRP 130
            +I  A AG  AD E +      +  E    Y    P   +V  L  +KQ   ++ G   
Sbjct: 69  PRIWCAGAGTAADTEAVTQLIGSNI-ELHSLYTSREPR--VVSALQMLKQHLFKYQG--H 123

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAI 190
            G   I AG D   G  L++ +  G+      +S+G+ + AA  +L+  ++ ++  + A+
Sbjct: 124 IGAYLIVAGTDPT-GAHLFSIHAHGSTDVGYYLSLGSGSLAAMAVLESHWEPEMSKEAAV 182

Query: 191 ELALKTLSKTTDSSALTYDRVEFATIKKGENDKIYQKIFKPE--EIKQ 236
           ELA + +     +   +   V+   ++ G++ +  +    P   E KQ
Sbjct: 183 ELASQAIQAGIFNDLGSGSNVDVCVMEVGKDAEYLRNYLTPNVREAKQ 230

>Smik_10.278 Chr10 (432298..432362,432479..433064) [651 bp, 216 aa]
           {ON} YJL001W (REAL)
          Length = 216

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 42/209 (20%), Positives = 88/209 (42%), Gaps = 16/209 (7%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+K+ R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RVHAQEYLKTY---NEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y   + E    +      + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTY 208
           YT    G+         G+ ++        +++D++  +E +     +LS+       + 
Sbjct: 130 YTIPIGGSVHKLPYAIAGSGSTFIYGYCDKNFRDNMSKEETVNFIKHSLSQAIKWDGSSG 189

Query: 209 DRVEFATIKKGENDKIYQKIFKPEEIKQL 237
             +    +     +++   +F P+E +QL
Sbjct: 190 GVIRMVVLTAAGVERL---VFYPDEYEQL 215

>KLLA0F12936g Chr6 complement(1191839..1192421,1192526..1192590)
           [648 bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 43/172 (25%), Positives = 79/172 (45%), Gaps = 15/172 (8%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+K+ +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHAQEYLKTYNE---EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y E   ++   I      + K   T            I AGYD++   ++
Sbjct: 79  QYHLELYTSQYGEPTTKVAASIFKTLCYENKDHLT---------AGIIVAGYDEKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSA-AQTLLQMDYKDDIKVDEAIELALKTLSK 199
           Y S P G     ++ S+  + SA        +YK+D+  +E IE    +LS+
Sbjct: 130 Y-SIPLGGSVHKQSYSIAGSGSAFIYGYCDKNYKEDMTKEETIEFVKHSLSQ 180

>Skud_10.222 Chr10 (402675..402739,402859..403441) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 45/211 (21%), Positives = 92/211 (43%), Gaps = 20/211 (9%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+K+ R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RVHAQEYLKTY---NEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y   + E    +      + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGPPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTY 208
           YT    G+         G+ ++        ++++++  +E ++    +LS+     A+ +
Sbjct: 130 YTIPIGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQ-----AIKW 184

Query: 209 DRVEFATIKKG--ENDKIYQKIFKPEEIKQL 237
           D      I+      D + + IF P+E ++L
Sbjct: 185 DGSSGGVIRMVVLTADGVERLIFYPDEYERL 215

>Ecym_7171 Chr7 complement(353212..353940) [729 bp, 242 aa] {ON}
           similar to Ashbya gossypii AGL324W
          Length = 242

 Score = 47.4 bits (111), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 86/206 (41%), Gaps = 22/206 (10%)

Query: 31  HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  V+A + + T+       +  K++   D I ++  G  AD + L+  
Sbjct: 28  NGGTILGIAGEDFAVIAGDTRHTTGYSINSRNEPKVFDCGDNILISANGFAADGDALVKK 87

Query: 91  ARVHAQEY-LKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            + + + Y     N+++ ++   R +  +  G      + P+ V  I AG D+     +Y
Sbjct: 88  FKNNLKWYHFDHNNKKMTLKSAARNIQHLLYGKR----MFPYYVHTIIAGLDEDGKGAVY 143

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD---------------IKVDEAIEL 192
           + +P G+Y   +  + GA  S     L  Q+++K+                + +DE IEL
Sbjct: 144 SFDPVGSYEREQCRAGGAAASIIMPFLDNQVNFKNQYEPDSKGTKPKSIRFLSLDEVIEL 203

Query: 193 ALKTLSKTTDSSALTYDRVEFATIKK 218
                +  T+      D ++   I K
Sbjct: 204 VRDAFTSATERHIHVGDSLQIMIITK 229

>YJL001W Chr10 (435163..435227,435344..435926) [648 bp, 215 aa] {ON}
            PRE3Beta 1 subunit of the 20S proteasome, responsible
           for cleavage after acidic residues in peptides
          Length = 215

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/209 (20%), Positives = 89/209 (42%), Gaps = 16/209 (7%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+K+ R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAIADIV 78

Query: 92  RVHAQEYLKTY---NEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y   + E    +      + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAASVFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTY 208
           YT    G+         G+ ++        ++++++  +E ++    +LS+       + 
Sbjct: 130 YTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSG 189

Query: 209 DRVEFATIKKGENDKIYQKIFKPEEIKQL 237
             +    +     +++   IF P+E +QL
Sbjct: 190 GVIRMVVLTAAGVERL---IFYPDEYEQL 215

>TPHA0N00740 Chr14 (164750..165400) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 46.6 bits (109), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 45/210 (21%), Positives = 88/210 (41%), Gaps = 17/210 (8%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+K+ R+ DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHAQEYLKTYNE---EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-Q 147
           +   + Y   + E   ++   I      D K   +            I AG+DD+    +
Sbjct: 79  QYQLELYTAQFGEPSTKVAASIFKTMCYDNKDNLS---------AGIIVAGFDDKENKGE 129

Query: 148 LYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALT 207
           +Y+    G+    K    G+ ++        ++KDD+  DE +     +LS+       +
Sbjct: 130 VYSIPLGGSLHKQKYAIAGSGSAFIYGYCDKNFKDDMTKDETVNFMKHSLSQAIKWDGSS 189

Query: 208 YDRVEFATIKKGENDKIYQKIFKPEEIKQL 237
              +    + K   D + + IF P+E + L
Sbjct: 190 GGVIRMVVLTK---DGVERLIFYPDEYENL 216

>CAGL0F04477g Chr6 complement(446420..447148) [729 bp, 242 aa] {ON}
           highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041w PRE7
          Length = 242

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 75/173 (43%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + + T+          K++   D I ++  G  AD E L+  
Sbjct: 28  NGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIIMSANGFAADGEALVKR 87

Query: 91  ARVHAQEYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+ ++ +    R +  +  G        P+ V  I AG DD     +Y
Sbjct: 88  FKNSIKWYHFDHNDKKLSISSAARNIQHLLYGKR----FFPYYVHTIIAGLDDEGKGAVY 143

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDDI--KVDEAIELALKTLS 198
           + +P G+Y   +  + GA  S     L  Q+++K+      D  ++  LK LS
Sbjct: 144 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYVPGTDGKVKRELKYLS 196

>SAKL0F15092g Chr6 (1215605..1216390) [786 bp, 261 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 261

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/179 (23%), Positives = 78/179 (43%), Gaps = 8/179 (4%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLND 71
           +S E +   +E+     S + GT +GI   D  VLA + + T+          K++   D
Sbjct: 28  YSNETKNVPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 87

Query: 72  KITVAVAGLTADAEILINTARVHAQEYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRP 130
            I ++  G  AD E L+   +   + Y   +N+ ++ +    R +  +  G        P
Sbjct: 88  NILISANGFAADGEALVKRFQNSLKWYHFNHNDRKLSLSSAARNIQHLLYGKR----FFP 143

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDDIKVD 187
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+  + D
Sbjct: 144 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPD 202

>TBLA0C06200 Chr3 (1503862..1504512) [651 bp, 216 aa] {ON} Anc_5.216
           YJL001W
          Length = 216

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 49/208 (23%), Positives = 88/208 (42%), Gaps = 13/208 (6%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T      +  T+K+ R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTMGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPF-GVSFIYAGYDDRYGYQLYT 150
           + H + Y   Y   IP     R  + + Q        + F     I AG+DD+       
Sbjct: 79  QYHLEVYTSQYG--IPS---TRTAASVFQSLCYEN--KDFLSAGIIVAGFDDKSEKGEVY 131

Query: 151 SNPSGNYTGWKAISVGANTSA-AQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTYD 209
           S P G     +  ++  + SA        +YK D+  DE +E    +LS+       +  
Sbjct: 132 SIPLGGSIHKQPYAIAGSGSAFIYGYCDKNYKPDMTKDETVEFMKHSLSQAIKWDGSSGG 191

Query: 210 RVEFATIKKGENDKIYQKIFKPEEIKQL 237
            +    + K   +++   IF PE+ + L
Sbjct: 192 VIRLVVLTKSGVERL---IFYPEDYENL 216

>Kwal_33.15193 s33 (1004538..1005119) [582 bp, 193 aa] {ON} YJL001W
           (PRE3) - Subunit of 20S proteasome [contig 94] FULL
          Length = 193

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 41/205 (20%), Positives = 86/205 (41%), Gaps = 15/205 (7%)

Query: 36  IGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTARVHA 95
           + +   DG++L A+ + T+     +  T+K+ R++DK+    +G  AD + + +  + + 
Sbjct: 1   MAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKVWCCRSGSAADTQAVADIVQHYL 60

Query: 96  QEYLKTYNE---EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTSN 152
           + Y   + E   +    I      + K   T            I AG+DD+   ++Y+  
Sbjct: 61  ELYTAQFGEPSTKTAASIFKTLCYENKDNLT---------AGIIVAGFDDKNKGEVYSIP 111

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTYDRVE 212
             G+    K    G+ ++        ++K+D+  DE I     +LS+       +   + 
Sbjct: 112 LGGSVHKQKYAIAGSGSTFIYGYCDKNFKEDMTKDETISFMKNSLSQAIKWDGSSGGVIR 171

Query: 213 FATIKKGENDKIYQKIFKPEEIKQL 237
              + K   +++   IF PEE + L
Sbjct: 172 MVVLTKEGAERL---IFYPEEYENL 193

>Ecym_8276 Chr8 complement(558691..559273,559391..559455) [648 bp,
           215 aa] {ON} similar to Ashbya gossypii AAL172C 1-intron
          Length = 215

 Score = 45.8 bits (107), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/206 (22%), Positives = 87/206 (42%), Gaps = 10/206 (4%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+K+ R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTYKDGVILGADSRTTTGTYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
           + H   Y   Y E   V       S I   Y     L       I AGYDD+   ++YT 
Sbjct: 79  QHHLDLYAAQYGEP-SVNTAASLFSTIC--YENKDFLT---AGIIVAGYDDKNKGEVYTI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTYDRV 211
              G+         G+ ++        ++K+++  +E I     +LS+       +   +
Sbjct: 133 PLGGSVHKAPYAIAGSGSTFIYGYCDKNFKENMSKEETIRFMKHSLSQAIKWDGSSGGVI 192

Query: 212 EFATIKKGENDKIYQKIFKPEEIKQL 237
               + K   + + + IF PE+ + L
Sbjct: 193 RMVVLTK---EGVERLIFYPEDYESL 215

>TPHA0E02990 Chr5 complement(628441..629091) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 44/210 (20%), Positives = 89/210 (42%), Gaps = 17/210 (8%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+K+ R+ DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVQDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHAQEYLKTYNE---EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-Q 147
           +   + Y   + E   ++   I      D K   +            I AG+DD+    +
Sbjct: 79  QYQLELYTAQFGEPSTKVAASIFKTMCYDNKDNLS---------AGIIVAGFDDKENKGE 129

Query: 148 LYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALT 207
           +Y+    G+    K    G+ ++        +YK+++  DE ++    +LS+       +
Sbjct: 130 VYSIPLGGSLHKQKYAIAGSGSTFIYGYCDKNYKENMTKDETVDFMKHSLSQAIKWDGSS 189

Query: 208 YDRVEFATIKKGENDKIYQKIFKPEEIKQL 237
              +    + K   D + + IF P+E + L
Sbjct: 190 GGVIRMVVVTK---DGVERLIFYPDEYENL 216

>TPHA0M01750 Chr13 (361278..362138) [861 bp, 286 aa] {ON} Anc_3.417
           YPR103W
          Length = 286

 Score = 46.2 bits (108), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 43/173 (24%), Positives = 75/173 (43%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAE--- 85
           I+H  T +      GI++A + + T+       +  K+ R+N  +   +AG  AD +   
Sbjct: 71  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVNKVIRINPFLLGTMAGGAADCQYWE 130

Query: 86  -ILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 131 TWLGSQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 182

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK D+ VDEA+ L  +++
Sbjct: 183 GPTVYYVDSDGTRLKGNVFCVGSGQTFAYGVLDSNYKWDLTVDEALYLGKRSI 235

>TDEL0C03440 Chr3 complement(603757..604482) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 45.8 bits (107), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 87/225 (38%), Gaps = 30/225 (13%)

Query: 20  YQVEYALESISH--------AGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLND 71
           Y  E A   I H         GT +GI   D  VLA + + T+          K++   D
Sbjct: 8   YSNEVAHTPIQHQFNPYTDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRHESKVFDCGD 67

Query: 72  KITVAVAGLTADAEILINTARVHAQEYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRP 130
            I ++  G  AD E L+   +   + Y   +N+ ++ +    R +  +  G        P
Sbjct: 68  NIVMSANGFAADGEALVKRFKNSVKWYHFDHNDKKLSLSSAARNIQHLLYGKR----FFP 123

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD----- 183
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+      
Sbjct: 124 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQFEPGT 183

Query: 184 ----------IKVDEAIELALKTLSKTTDSSALTYDRVEFATIKK 218
                     + ++E I+L     +  T+      D +E   + K
Sbjct: 184 NGKVRRPQTYLSIEEVIKLVRDAFTSATERHIQVGDGLEILIVTK 228

>TBLA0F02680 Chr6 complement(643543..644268) [726 bp, 241 aa] {ON}
           Anc_7.480 YBL041W
          Length = 241

 Score = 45.8 bits (107), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 44/206 (21%), Positives = 83/206 (40%), Gaps = 22/206 (10%)

Query: 31  HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + +  +          K++   D I ++  G  AD E L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRFEPKVFDCGDNIVISANGFAADGEALVQR 86

Query: 91  ARVHAQEYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+ ++ ++   R +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSIKWYHFDHNDKKLTMKSAARNIQHLLYGKR----FFPYYVHTIIAGLDEEGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD---------------IKVDEAIEL 192
           + +P G+Y   +  + GA  S     L  Q+++K+                + +DE I+L
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYVPESNGKVKRPLKYLTIDECIKL 202

Query: 193 ALKTLSKTTDSSALTYDRVEFATIKK 218
                +  T+      D +E   + K
Sbjct: 203 VRDAFTSATERHIQVGDGLEILIVTK 228

>KLTH0E01826g Chr5 (173841..174569) [729 bp, 242 aa] {ON} highly
           similar to uniprot|P23724 Saccharomyces cerevisiae
           YBL041W PRE7 20S proteasome beta-type subunit
          Length = 242

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 49/225 (21%), Positives = 90/225 (40%), Gaps = 23/225 (10%)

Query: 13  FSPEGRLYQVEYALESIS-HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLND 71
           +S E +   +E+     S + GT +GI   D  VLA + + T+          K++   D
Sbjct: 9   YSNEVKNTPIEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGD 68

Query: 72  KITVAVAGLTADAEILINTARVHAQEYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRP 130
            I ++  G  AD   L+   +   + Y   +N+ ++ +    R +  +  G        P
Sbjct: 69  NILISANGFAADGNALVKRFQNSLKWYHFDHNDKKLSMRSAARNIQHLLYGKR----FFP 124

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD----- 183
           + V  I AG D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+      
Sbjct: 125 YYVHTIIAGLDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPDS 184

Query: 184 ----------IKVDEAIELALKTLSKTTDSSALTYDRVEFATIKK 218
                     + V+E ++L     S  T+      D VE   + K
Sbjct: 185 HGTKRKHVKFLTVEEVVQLVRDAFSSATERHIHVGDGVEILIVTK 229

>Suva_12.80 Chr12 (117572..117636,117754..118336) [648 bp, 215 aa]
           {ON} YJL001W (REAL)
          Length = 215

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 42/209 (20%), Positives = 90/209 (43%), Gaps = 16/209 (7%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+K+ R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGSYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHAQEYLKTY---NEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y   + E    I      + K   T            I AGYDD+   ++
Sbjct: 79  QYHLELYTSQYGTPSTETAAAIFKELCYENKDNLT---------AGIIVAGYDDKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTY 208
           YT    G+         G+ ++        ++++++  +E ++    +LS+       + 
Sbjct: 130 YTIPLGGSVHKLPYAIAGSGSTFIYGYCDKNFRENMSKEETVDFIKHSLSQAIKWDGSSG 189

Query: 209 DRVEFATIKKGENDKIYQKIFKPEEIKQL 237
             +    + +   +++   IF P+E ++L
Sbjct: 190 GVIRMVVLTEAGVERL---IFYPDEYERL 215

>Kpol_1028.92 s1028 (211095..211823) [729 bp, 242 aa] {ON}
           (211095..211823) [729 nt, 243 aa]
          Length = 242

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 44/183 (24%), Positives = 79/183 (43%), Gaps = 10/183 (5%)

Query: 22  VEYALESIS-HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGL 80
           +E+     S + GT +GI   D  VLA + + T+          K++   D I ++  G 
Sbjct: 18  IEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNIVISANGF 77

Query: 81  TADAEILINTARVHAQEYLKTYNEE-IPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAG 139
            AD E L+   +   + Y    N++ + +    R +  +  G        P+ V  I AG
Sbjct: 78  AADGEALVKRFKNSIKWYHFDNNDKTLSLSSAARNIQHLLYGKR----FFPYYVHTIIAG 133

Query: 140 YDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDDIKVDE--AIELALK 195
            D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+  + D    ++  LK
Sbjct: 134 LDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPDSDGTVKRPLK 193

Query: 196 TLS 198
            LS
Sbjct: 194 FLS 196

>Kwal_55.19882 s55 (163845..164573) [729 bp, 242 aa] {ON} YBL041W
           (PRE7) - proteasome subunit [contig 159] FULL
          Length = 242

 Score = 45.1 bits (105), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 47/216 (21%), Positives = 87/216 (40%), Gaps = 23/216 (10%)

Query: 22  VEYALESIS-HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGL 80
           +E+     S + GT +GI   D  VLA + + T+          K++   D I ++  G 
Sbjct: 18  IEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDNILISANGF 77

Query: 81  TADAEILINTARVHAQEYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAG 139
            AD   L+   +   + Y   +N+ ++ ++   R +  +  G        P+ V  I AG
Sbjct: 78  AADGTALVKRFQNSLKWYHFDHNDKKLSMKSAARNIQHLLYGKR----FFPYYVHTIIAG 133

Query: 140 YDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD-------------- 183
            D+     +Y+ +P G+Y   +  + GA  S     L  Q+++K+               
Sbjct: 134 LDEEGKGAVYSFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPDSKGTKRKELK 193

Query: 184 -IKVDEAIELALKTLSKTTDSSALTYDRVEFATIKK 218
            + V+E ++L     S  T+      D VE   + K
Sbjct: 194 FLSVEEVVQLVRDAFSSATERHIHVGDGVEILIVTK 229

>Suva_2.77 Chr2 (141199..141924) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 45.1 bits (105), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 76/173 (43%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + +  +          K++   DKI ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDKIVMSANGFAADGDALVKR 86

Query: 91  ARVHAQEYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+ ++ +    R +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDEDGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDDIK--VDEAIELALKTLS 198
           + +P G+Y   +  + GA  S     L  Q+++K+  +   D  ++  LK LS
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTDGKVKKPLKYLS 195

>ZYRO0B10142g Chr2 complement(793497..794079,794163..794227) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 44.7 bits (104), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/209 (21%), Positives = 86/209 (41%), Gaps = 16/209 (7%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T      +  T+K+ R++DK+    +G  AD + + +  
Sbjct: 19  GTSIMAVSFKDGVILGADSRTTMGPYVANRVTDKLTRVHDKVWCCRSGSAADTQAVADIV 78

Query: 92  RVHAQEYLKTYNE---EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + +   Y   Y E        I  +   + K   T            I AGYD++   ++
Sbjct: 79  QYYLDLYTAQYGEPSTRTAAAIFQQLCYENKDALT---------AGIIVAGYDEKNQGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTY 208
           Y+    G+    K    G+ ++        +YKD +  DE ++    +LS+       + 
Sbjct: 130 YSIPIGGSLHKQKYAIAGSGSTFIYGYCDKNYKDGMTKDETVDFIKHSLSQAIKWDGSSG 189

Query: 209 DRVEFATIKKGENDKIYQKIFKPEEIKQL 237
             +    + K   +++   I  PEE + L
Sbjct: 190 GVIRMVVLTKNGVERL---IVYPEEFENL 215

>ZYRO0G17842g Chr7 complement(1467229..1467963) [735 bp, 244 aa]
           {ON} highly similar to uniprot|P23724 Saccharomyces
           cerevisiae YBL041W PRE7 20S proteasome beta-type subunit
          Length = 244

 Score = 44.7 bits (104), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 45/206 (21%), Positives = 80/206 (38%), Gaps = 22/206 (10%)

Query: 31  HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + + T+          K++   D I +   G  AD E L+  
Sbjct: 30  NGGTVLGIAGEDFAVLAGDTRHTTDYSINSRYESKVFDCGDNIVITANGYAADGEALVKR 89

Query: 91  ARVHAQEYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+ ++ +    R +  +  G        P+ V  I AG D+     +Y
Sbjct: 90  FKNSVKWYHFDHNDKKLSLNSAARNIQHLLYGKR----FFPYYVQTIIAGLDEEGKGAVY 145

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD---------------IKVDEAIEL 192
           + +P G+Y   +  + GA  S     L  Q+++ +                + VDE I L
Sbjct: 146 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFHNQYVPESNGRVKRPLKFLSVDEVIRL 205

Query: 193 ALKTLSKTTDSSALTYDRVEFATIKK 218
                +  T+      D +E   + K
Sbjct: 206 VRDAFTSATERHIQVGDGLEILIVTK 231

>KLTH0D03058g Chr4 complement(293867..294730) [864 bp, 287 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 44.7 bits (104), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 44/181 (24%), Positives = 76/181 (41%), Gaps = 12/181 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTLAGGAADCQFWE 131

Query: 87  --LINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGTQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ V+EA+ L  +++   T   
Sbjct: 184 GPTIYYVDSDGTRLKGDMFCVGSGQTFAYGVLDSNYKWDLSVEEALYLGKRSILAATHRD 243

Query: 205 A 205
           A
Sbjct: 244 A 244

>SAKL0G12584g Chr7 complement(1072410..1072992,1073073..1073137)
           [648 bp, 215 aa] {ON} similar to uniprot|P38624
           Saccharomyces cerevisiae YJL001W PRE3 20S proteasome
           beta-type subunit, responsible for cleavage after acidic
           residues in peptides
          Length = 215

 Score = 43.5 bits (101), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 42/209 (20%), Positives = 88/209 (42%), Gaps = 16/209 (7%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+K+ R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHAQEYLKTYNE---EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + H + Y   Y E   +    +      + K   T            I AGYD++   ++
Sbjct: 79  QYHLELYDSQYGEPSTKTAASVFKTLCYENKDNLT---------AGIIVAGYDEKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTY 208
           Y+    G+         G+ ++        ++K+ +  +E I+    +LS+       + 
Sbjct: 130 YSIPLGGSIHKQNYAIAGSGSTFIYGYCDKNFKEGMTKEETIDFIKHSLSQAIKWDGSSG 189

Query: 209 DRVEFATIKKGENDKIYQKIFKPEEIKQL 237
             +    + K   D + + +F P+E + L
Sbjct: 190 GVIRMVVLTK---DGVERLVFYPDEYENL 215

>TDEL0C05540 Chr3 (988954..989817) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 43.9 bits (102), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 39/177 (22%), Positives = 73/177 (41%), Gaps = 4/177 (2%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGSWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 89  NTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGAQCRLHELKEKERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKEGPTV 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSA 205
           Y  +  G         VG+  + A  +L  +YK ++ V+EA+EL  +++   T   A
Sbjct: 188 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDANYKWELGVEEALELGKRSILAATHRDA 244

>TBLA0F01760 Chr6 complement(439214..440077) [864 bp, 287 aa] {ON}
           Anc_3.417 YPR103W
          Length = 287

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 46/202 (22%), Positives = 82/202 (40%), Gaps = 14/202 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H         E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHELRE----KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ V+EA+ L  +++   T   
Sbjct: 184 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLGKRSILAATHRD 243

Query: 205 ALTYDRVEFATIKKGENDKIYQ 226
           A +   +    +   EN  IY 
Sbjct: 244 AYSGGSINLYHVT--ENGWIYH 263

>TPHA0E00420 Chr5 (71900..72625) [726 bp, 241 aa] {ON} Anc_7.480
           YBL041W
          Length = 241

 Score = 43.5 bits (101), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/225 (21%), Positives = 90/225 (40%), Gaps = 24/225 (10%)

Query: 22  VEYALESIS-HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGL 80
           +E+     S + GT +GI   D  VLA + + T+          K++   D I ++  G 
Sbjct: 17  IEHQFNPYSDNGGTILGIAGEDFAVLAGDTRHTTDYSINSRYEPKVFDCGDDIIISANGF 76

Query: 81  TADAEILINTARVHAQEY-LKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAG 139
            AD E L+   +   + Y     ++++ +    R +  +  G        P+ V  I AG
Sbjct: 77  AADGEALVKRFKNSIKWYHFDNNDKKLALSSAARNIQHLLYGKR----FFPYYVHTIIAG 132

Query: 140 YDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD-------------- 183
            D+     +Y+ +P G+Y      + GA  S     L  Q+++K+               
Sbjct: 133 LDEEGKGAVYSFDPVGSYEREFCRAGGAAASLIMPFLDNQVNFKNQYTPDSNGKVKRPFK 192

Query: 184 -IKVDEAIELALKTLSKTTDSSALTYDRVEFATI-KKGENDKIYQ 226
            + +DE I+L     +  T+      D +E   + K+G   + Y+
Sbjct: 193 HLSIDEVIKLVRDAFTSATERHIHVGDGLEILIVTKEGVRKEFYE 237

>Smik_2.73 Chr2 (135009..135734) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 43.1 bits (100), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 43/206 (20%), Positives = 83/206 (40%), Gaps = 22/206 (10%)

Query: 31  HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + +  +          K++   D I ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKR 86

Query: 91  ARVHAQEYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+ ++ +    R +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSLNSAARNIQHLLYGKR----FFPYYVHTIIAGLDENGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD---------------IKVDEAIEL 192
           + +P G+Y   +  + GA  S     L  Q+++K+                + V+E I+L
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLSVEEVIKL 202

Query: 193 ALKTLSKTTDSSALTYDRVEFATIKK 218
              + +  T+      D +E   + K
Sbjct: 203 VRDSFTSATERHIQVGDGLEILIVTK 228

>YBL041W Chr2 (141247..141972) [726 bp, 241 aa] {ON}  PRE7Beta 6
           subunit of the 20S proteasome
          Length = 241

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 43/206 (20%), Positives = 83/206 (40%), Gaps = 22/206 (10%)

Query: 31  HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + +  +          K++   D I ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNIVMSANGFAADGDALVKR 86

Query: 91  ARVHAQEYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+ ++ +    R +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDEDGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDD---------------IKVDEAIEL 192
           + +P G+Y   +  + GA  S     L  Q+++K+                + V+E I+L
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTNGKVKKPLKYLSVEEVIKL 202

Query: 193 ALKTLSKTTDSSALTYDRVEFATIKK 218
              + +  T+      D +E   + K
Sbjct: 203 VRDSFTSATERHIQVGDGLEILIVTK 228

>AAL172C Chr1 complement(39647..40229,40286..40350) [648 bp, 215 aa]
           {ON} syntenic homolog of Saccharomyces cerevisiae
           YJL001W (PRE3); 1-intron
          Length = 215

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 41/206 (19%), Positives = 86/206 (41%), Gaps = 10/206 (4%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+K+ R++D+I    +G  AD + + +  
Sbjct: 19  GTSIMAVKFRDGVILGADSRTTTGTYIANRVTDKLTRVHDRIWCCRSGSAADTQAVADMV 78

Query: 92  RVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
           + + + Y   Y E           S I      H          I AGYDD+   ++Y+ 
Sbjct: 79  QHYLELYTMQYGEP-SASTAASLFSTICYENKDH-----LTAGIIVAGYDDKNKGEVYSI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTYDRV 211
              G+         G+ ++         +++D+  +E I+    +LS+       +   +
Sbjct: 133 PLGGSVHKAPYAIAGSGSTFIYGYCDKHFREDMSKEETIDFMKHSLSQAIKWDGSSGGVI 192

Query: 212 EFATIKKGENDKIYQKIFKPEEIKQL 237
               + +   +++   IF PE+ + L
Sbjct: 193 RMVVLTEAGAERL---IFYPEDYENL 215

>Skud_2.61 Chr2 (125091..125816) [726 bp, 241 aa] {ON} YBL041W
           (REAL)
          Length = 241

 Score = 42.7 bits (99), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 75/173 (43%), Gaps = 9/173 (5%)

Query: 31  HAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINT 90
           + GT +GI   D  VLA + +  +          K++   D + ++  G  AD + L+  
Sbjct: 27  NGGTILGIAGEDFAVLAGDTRNITDYSINSRYEPKVFDCGDNLVMSANGFAADGDALVKR 86

Query: 91  ARVHAQEYLKTYNE-EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLY 149
            +   + Y   +N+ ++ +    R +  +  G        P+ V  I AG D+     +Y
Sbjct: 87  FKNSVKWYHFDHNDKKLSINSAARNIQHLLYGKR----FFPYYVHTIIAGLDENGKGAVY 142

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLL--QMDYKDDIK--VDEAIELALKTLS 198
           + +P G+Y   +  + GA  S     L  Q+++K+  +   D  ++  LK LS
Sbjct: 143 SFDPVGSYEREQCRAGGAAASLIMPFLDNQVNFKNQYEPGTDGKVKKPLKYLS 195

>NDAI0A04860 Chr1 complement(1110021..1110884) [864 bp, 287 aa] {ON}
           Anc_3.417
          Length = 287

 Score = 43.1 bits (100), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 42/173 (24%), Positives = 75/173 (43%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFKGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK  N  I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LKEKNR-ISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK D+ V+EA+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLGKRSI 236

>AEL326C Chr5 complement(37422..38279) [858 bp, 285 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPR103W
           (PRE2)
          Length = 285

 Score = 42.7 bits (99), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 40/198 (20%), Positives = 79/198 (39%), Gaps = 6/198 (3%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 129

Query: 89  NTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    + LS++   Y   G      +  +  GY  + G  +
Sbjct: 130 TWLGAQCRLHELKEKERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKEGPTI 185

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTY 208
           Y  +  G         VG+  + A  +L  +Y+ D+ V++A+ L  +++       A + 
Sbjct: 186 YYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYRWDLSVEDALYLGKRSILAAAHRDAYSG 245

Query: 209 DRVEFATIKKGENDKIYQ 226
             V  + +   EN  +Y 
Sbjct: 246 GSVNLSHVT--ENGWVYH 261

>KLTH0B03102g Chr2 complement(242293..242875,242960..243024) [648
           bp, 215 aa] {ON} highly similar to uniprot|P38624
           YJL001W Saccharomyces cerevisiae PRE3 20S proteasome
           beta-type subunit
          Length = 215

 Score = 42.4 bits (98), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 41/209 (19%), Positives = 89/209 (42%), Gaps = 16/209 (7%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+K+ R+++K+    +G  AD + + +  
Sbjct: 19  GTSIMAVTFRDGVILGADSRTTTGAYIANRVTDKLTRVHEKVWCCRSGSAADTQAVADIV 78

Query: 92  RVHAQEYLKTYNE---EIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
           + + + Y   + E   +    I      + K   T            I AGYD++   ++
Sbjct: 79  QHYLELYTAQFGEPSTKTAASIFKTLCYENKDNLT---------AGIIVAGYDEKNKGEV 129

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTY 208
           Y+    G+    K    G+ ++        +YK+++  DE +     +LS+       + 
Sbjct: 130 YSIPLGGSVHKQKYAIAGSGSTFIYGYCDKNYKENMSKDETVSFMKNSLSQAIKWDGSSG 189

Query: 209 DRVEFATIKKGENDKIYQKIFKPEEIKQL 237
             +    + K   +++   IF PE+ + L
Sbjct: 190 GVIRMVVLTKDGAERL---IFYPEDYENL 215

>CAGL0G01804g Chr7 complement(166048..166908) [861 bp, 286 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103w PRE2
          Length = 286

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 74/173 (42%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 71  IAHGTTTLAFRFQGGIVVAVDSRATAGQWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 130

Query: 87  --LINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK   E I V    + L ++   Y   G      +  +  GY  + 
Sbjct: 131 TWLGSQCRLHE---LKE-KERISVAAASKILGNLVYQYKGAG----LSMGTMICGYTKKE 182

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK D+ V+EA+ L  +++
Sbjct: 183 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLSVEEALYLGKRSI 235

>Kwal_26.7273 s26 complement(291172..292035) [864 bp, 287 aa] {ON}
           YPR103W (PRE2) - proteasome subunit [contig 47] FULL
          Length = 287

 Score = 42.0 bits (97), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 74/173 (42%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEI-- 86
           ++H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  LAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGTQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK D+ V+EA+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYKWDLTVEEALYLGKRSI 236

>AAR119W Chr1 (557434..558213) [780 bp, 259 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR157C (PUP1)
          Length = 259

 Score = 41.6 bits (96), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 79/174 (45%), Gaps = 16/174 (9%)

Query: 20  YQVEYALESISH--------AGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLND 71
           YQ    L S SH          T +G+    G+V+AA+ + T   +  + + EK++R+  
Sbjct: 9   YQRNQHLASTSHKQPRATSTGTTIVGVKFEGGVVIAADTRSTQGPIVANKNCEKLHRIAP 68

Query: 72  KITVAVAGLTADAEILINTARVHAQ-EYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRP 130
           +I  A AG  AD E +  T  + +  E    Y    P   +V  L  +KQ   ++ G   
Sbjct: 69  RIWCAGAGTAADTEAV--TWLIGSNLELHSLYTGREPR--VVSALQKLKQHLFKYQG--H 122

Query: 131 FGVSFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDI 184
            G   I AG D   G  L++ +  G+    +  S+G+ + AA  +L+  +++ +
Sbjct: 123 IGAYLIVAGVDPT-GAHLFSVHAHGSTDVGQYQSLGSGSLAAMAVLEAQWREGM 175

>Kpol_1018.144 s1018 complement(382038..382904) [867 bp, 288 aa]
           {ON} complement(382038..382904) [867 nt, 289 aa]
          Length = 288

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 74/173 (42%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GI++A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK     I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LKE-KSRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK D+ VDEA+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVDEALYLGKRSI 236

>Skud_16.388 Chr16 (696682..697545) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 81/204 (39%), Gaps = 18/204 (8%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTLAGGAADCQFWE 131

Query: 87  --LINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H         E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHELRE----KERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ V++A+ L  +++       
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRD 243

Query: 205 ALT------YDRVEFATIKKGEND 222
           A +      Y   E   I  G +D
Sbjct: 244 AFSGGSVNLYHVTEDGWIYHGNHD 267

>Suva_16.429 Chr16 (739867..740730) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 45/204 (22%), Positives = 81/204 (39%), Gaps = 18/204 (8%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H         E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHELRE----KERISVAAASKILSNLVYQYKGAG----LSMGTMVCGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ V++A+ L  +++       
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRD 243

Query: 205 ALT------YDRVEFATIKKGEND 222
           A +      Y   E   I  G +D
Sbjct: 244 AFSGGSINLYHVTEDGWIYHGNHD 267

>NCAS0A11440 Chr1 (2263605..2264468) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 75/173 (43%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GI++A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LKE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK D+ V++A+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDTNYKWDLTVEDALYLGKRSI 236

>KAFR0C06350 Chr3 complement(1270967..1271552,1271634..1271698) [651
           bp, 216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 40.8 bits (94), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/207 (21%), Positives = 88/207 (42%), Gaps = 11/207 (5%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+K+ R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-QLYT 150
           + H + Y   Y     ++        I   Y     L       I AG+DD+    ++Y+
Sbjct: 79  QYHLELYESQYGAP-SIKTAASVFKSI--CYENKDNLSA---GIIVAGFDDKNEKGEVYS 132

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTYDR 210
               G+    K    G+ ++         +K+D+  DE +     +LS+       +   
Sbjct: 133 IPLGGSIHKQKYAIAGSGSTFIYGYCDKKFKEDMTKDETVNFIKHSLSQAIKWDGSSGGV 192

Query: 211 VEFATIKKGENDKIYQKIFKPEEIKQL 237
           +    + K   + + + IF P+E ++L
Sbjct: 193 IRMVILTK---EGVERLIFYPDEYEKL 216

>KNAG0A07520 Chr1 (1176893..1177756) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 37/177 (20%), Positives = 71/177 (40%), Gaps = 4/177 (2%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 89  NTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + Y     + I V    + L+++   Y   G      +  +  GY  + G  +
Sbjct: 132 TWLGSQCRLYELKEKQRITVAAASKILANLVYQYKGAG----LSMGTMICGYTKKEGPTV 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSA 205
           Y  +  G         VG+  + A  +L  +YK D+ V++A+ L  + +   T   A
Sbjct: 188 YYVDSDGTRLKGDVFCVGSGQTFAYGVLDTNYKWDLSVEDALYLGKRAILAATHRDA 244

>ZYRO0C17688g Chr3 (1375873..1376736) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 41.2 bits (95), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 39/198 (19%), Positives = 79/198 (39%), Gaps = 6/198 (3%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GI++A + + ++       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRASAGSWVASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 89  NTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    + L ++   Y  +G      +  +  GY  + G  +
Sbjct: 132 TWLGAQCRLHELKEKERISVAAASKILCNLVYEYKGYG----LSMGTMICGYTKKEGPTV 187

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTY 208
           Y  +  G         VG+  + A  +L  +YK D+ V+EA+ L  +++   T   A + 
Sbjct: 188 YYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEEALYLGKRSIIAATHRDAYSG 247

Query: 209 DRVEFATIKKGENDKIYQ 226
             V    +   EN  ++ 
Sbjct: 248 GSVNLYHVT--ENGWVFH 263

>NDAI0C02420 Chr3 complement(555130..555780) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 45/212 (21%), Positives = 90/212 (42%), Gaps = 21/212 (9%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+K+ +++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTKVHDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHAQEY---LKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-Q 147
           + H   Y     T + +    +      + K   T            I AG+DD     +
Sbjct: 79  QYHLDIYSTQFGTPSTKTAASVFKTLCYENKDNLT---------AGIIVAGFDDATNKGE 129

Query: 148 LYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALT 207
           +Y+    G+    K    G+ ++        ++KDD+  DE +     +LS+     A+ 
Sbjct: 130 VYSVPLGGSIHKQKYAIAGSGSTFIYGYCDKNFKDDMTKDETVHFIKHSLSQ-----AIK 184

Query: 208 YDRVEFATIKKG--ENDKIYQKIFKPEEIKQL 237
           +D      I+     ++ + + IF P+E + L
Sbjct: 185 WDGSSGGVIRMVVLTSEGVERLIFYPDEYENL 216

>KNAG0H02450 Chr8 complement(449110..449695,449971..450035) [651 bp,
           216 aa] {ON} Anc_5.216 YJL001W
          Length = 216

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/207 (20%), Positives = 89/207 (42%), Gaps = 11/207 (5%)

Query: 33  GTAIGIMASDG-IVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +  DG ++L A+ + T+     +  T+K+ R++DKI    +G  AD + + +  
Sbjct: 19  GTSIMAVTFDGGVILGADSRTTTGAYIANRVTDKLTRIDDKIWCCRSGSAADTQAVADIV 78

Query: 92  RVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-QLYT 150
           + H + Y   Y     +E        +   Y     L       I AGYDD+    ++Y+
Sbjct: 79  QYHLELYTSQYGTP-SIETAAAVFKTLT--YENKDALSA---GIIVAGYDDKKKKGEVYS 132

Query: 151 SNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTYDR 210
               G+    K    G+ ++        +Y++++  +E +E    +LS+       +   
Sbjct: 133 IPLGGSVHKQKYAIAGSGSAFIYGYCDKNYRENMNKEETVEFVKHSLSQAIKWDGSSGGV 192

Query: 211 VEFATIKKGENDKIYQKIFKPEEIKQL 237
           +    + +   +++   IF P+E + L
Sbjct: 193 IRLVILTESGVERL---IFYPDEYENL 216

>YPR103W Chr16 (732349..733212) [864 bp, 287 aa] {ON}  PRE2Beta 5
           subunit of the 20S proteasome, responsible for the
           chymotryptic activity of the proteasome
          Length = 287

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 49/217 (22%), Positives = 91/217 (41%), Gaps = 21/217 (9%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GI++A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    L+   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSS 204
           G  +Y  +  G         VG+  + A  +L  +YK D+ V++A+ L  +++       
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSVEDALYLGKRSILAAAHRD 243

Query: 205 ALT------YDRVEFATIKKGEND--KIYQKIFKPEE 233
           A +      Y   E   I  G +D  +++ K+ K EE
Sbjct: 244 AYSGGSVNLYHVTEDGWIYHGNHDVGELFWKV-KEEE 279

>CAGL0D03058g Chr4 complement(317022..317669) [648 bp, 215 aa] {ON}
           highly similar to uniprot|P38624 Saccharomyces
           cerevisiae YJL001w PRE3
          Length = 215

 Score = 40.0 bits (92), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/206 (20%), Positives = 88/206 (42%), Gaps = 10/206 (4%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+K+ R++D I    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRVHDNIWCCRSGSAADTQAVADI- 77

Query: 92  RVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQLYTS 151
               Q YL  Y  +          +  K    Q+      G+  I AGYD++   ++Y+ 
Sbjct: 78  ---VQYYLDMYEGQFGEPDTYTAANMFKTLCYQNKDALTAGI--IVAGYDEKNKGEVYSI 132

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTYDRV 211
              G+         G+ ++        ++++++  DE I+    +LS+       +   +
Sbjct: 133 PLGGSIHKQPYAIAGSGSTFIYGYCDKNFRENMSKDETIDFIKHSLSQAIKWDGSSGGVI 192

Query: 212 EFATIKKGENDKIYQKIFKPEEIKQL 237
               + K   +++   IF PEE + L
Sbjct: 193 RMVVLTKDGPERL---IFYPEEYENL 215

>Ecym_2614 Chr2 (1185603..1186460) [858 bp, 285 aa] {ON} similar to
           Ashbya gossypii AEL326C
          Length = 285

 Score = 40.4 bits (93), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 36/169 (21%), Positives = 69/169 (40%), Gaps = 4/169 (2%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILI 88
           I+H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 70  IAHGTTTLAFRFQGGIVVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQYWE 129

Query: 89  NTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGYQL 148
                  + +     E I V    + L ++   Y   G      +  +  GY  + G  +
Sbjct: 130 TWLGAQCRLHELKEKERISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKEGPTI 185

Query: 149 YTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTL 197
           Y  +  G         VG+  + A  +L  +YK D+ V+EA+ L  +++
Sbjct: 186 YYVDSDGMRLKGDLFCVGSGQTFAYGVLDTNYKWDLTVEEALYLGKRSI 234

>Smik_16.343 Chr16 (609756..610619) [864 bp, 287 aa] {ON} YPR103W
           (REAL)
          Length = 287

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 39/173 (22%), Positives = 75/173 (43%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GIV+A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIVVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    L+   E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LRE-KERISVAAASKILSNLVYQYKGAG----LSMGTMICGYTRKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK D+ +++A+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLKGDIFCVGSGQTFAYGVLDSNYKWDLSIEDALYLGKRSI 236

>KLLA0F08228g Chr6 complement(770578..771435) [858 bp, 285 aa] {ON}
           highly similar to uniprot|P30656 Saccharomyces
           cerevisiae YPR103W PRE2 20S proteasome beta-type subunit
          Length = 285

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 73/173 (42%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GI++A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 69  IAHGTTTLAFRFKGGIIVAVDSRATAGQWIASQTVKKVIEINPFLLGTMAGGAADCQFWE 128

Query: 87  --LINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H         E I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 129 TWLGSQCRLHELRE----KERISVAAASKILSNLVYEYKGAG----LSMGTMICGYTKKE 180

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +Y+ D+ V+EA+ +  +++
Sbjct: 181 GPTIYYVDSDGTRLQGDLFCVGSGQTFAYGVLDANYRWDLSVEEALYIGKRSI 233

>KAFR0D04210 Chr4 (829098..829961) [864 bp, 287 aa] {ON} Anc_3.417
           YPR103W
          Length = 287

 Score = 40.0 bits (92), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 40/173 (23%), Positives = 75/173 (43%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAE--- 85
           I+H  T +      GI++A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGNWVASQTVKKVIEINPFLLGTMAGGAADCQYWE 131

Query: 86  -ILINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L +  R+H    LK   + I V    + LS++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGSQCRLHE---LKE-KDRISVAAASKILSNLVYQYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK D+ V+EA+ L  +++
Sbjct: 184 GPTVYYVDSDGTRLKGDLFCVGSGQTFAYGVLDSNYKWDLTVEEALYLGKRSI 236

>SAKL0B09262g Chr2 (784068..784931) [864 bp, 287 aa] {ON} highly
           similar to uniprot|P30656 Saccharomyces cerevisiae
           YPR103W PRE2 20S proteasome beta-type subunit
          Length = 287

 Score = 37.7 bits (86), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 37/173 (21%), Positives = 73/173 (42%), Gaps = 12/173 (6%)

Query: 29  ISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEI-- 86
           I+H  T +      GI++A + + T+       + +K+  +N  +   +AG  AD +   
Sbjct: 72  IAHGTTTLAFRFQGGIIVAVDSRATAGSWVASQTVKKVIEINPFLLGTMAGGAADCQFWE 131

Query: 87  --LINTARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY 144
             L    R+H    LK   + I V    + L ++   Y   G      +  +  GY  + 
Sbjct: 132 TWLGTQCRLHE---LKE-KQRISVAAASKILGNLVYEYKGAG----LSMGTMICGYTKKE 183

Query: 145 GYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTL 197
           G  +Y  +  G         VG+  + A  +L  +YK D+ +++A+ L  +++
Sbjct: 184 GPTIYYVDSDGTRLKGDLFCVGSGQTFAYGVLDTNYKWDLTIEDALYLGKRSI 236

>NCAS0A01480 Chr1 complement(288201..288851) [651 bp, 216 aa] {ON}
           Anc_5.216 YJL001W
          Length = 216

 Score = 37.4 bits (85), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 48/210 (22%), Positives = 91/210 (43%), Gaps = 17/210 (8%)

Query: 33  GTAI-GIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTA 91
           GT+I  +   DG++L A+ + T+     +  T+K+ R++DK+    +G  AD + + +  
Sbjct: 19  GTSIMAVTFKDGVILGADSRTTTGAYIANRVTDKLTRIHDKVWCCRSGSAADTQAVADI- 77

Query: 92  RVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDD--RYGYQLY 149
               Q YL  Y  +          S  K    ++      G+  I AG+DD  + G ++Y
Sbjct: 78  ---VQYYLDLYTTQYGTPSTKTAASVFKTLCYENKDNLTAGI--IVAGFDDDTKKG-EVY 131

Query: 150 TSNPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTYD 209
           +    G+    K    G+ ++        ++K+D+  DE I     +LS+     A+ +D
Sbjct: 132 SVPLGGSIHKQKYAIAGSGSTFIYGYCDKNFKEDMTKDETIHFIKHSLSQ-----AIKWD 186

Query: 210 RVEFATIKKG--ENDKIYQKIFKPEEIKQL 237
                 I+        + + IF P+E + L
Sbjct: 187 GSSGGVIRMVILTESGVERLIFYPDEYENL 216

>Smik_7.173 Chr7 (308539..309588) [1050 bp, 349 aa] {ON} YGL100W
           (REAL)
          Length = 349

 Score = 33.9 bits (76), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 14/42 (33%), Positives = 25/42 (59%), Gaps = 3/42 (7%)

Query: 4   RRYDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIV 45
           RR++   T+  P+G LY V++A    +H G  +  + +DGI+
Sbjct: 96  RRWNKLCTLNDPKGSLYSVKFA---PAHLGLKLACLGNDGIL 134

>KLLA0B11660g Chr2 complement(1024265..1024852) [588 bp, 195 aa]
           {ON} highly similar to uniprot|P22141 Saccharomyces
           cerevisiae YER012W PRE1 20S proteasome beta-type subunit
           localizes to the nucleus throughout the cell cycle
          Length = 195

 Score = 32.3 bits (72), Expect = 0.84,   Method: Compositional matrix adjust.
 Identities = 38/161 (23%), Positives = 68/161 (42%), Gaps = 9/161 (5%)

Query: 36  IGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTARVHA 95
           +GI   D ++LA+ + VT  +     S +K  +L     ++ +G   D        + + 
Sbjct: 5   LGIRVKDSVILASSKAVTRGISILKDSDDKTRQLLPHTLMSFSGEAGDTVQFAEYIQANM 64

Query: 96  QEYLKTYNEEIPVEI---LVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRY-GYQLYTS 151
           Q YL   N E+        VR  +++ +        +PF V+ +  GYD +    +LY  
Sbjct: 65  QLYLIRENYELSPHAASSFVR--TELAKSLRSR---KPFQVNVLIGGYDTKNEKAELYQI 119

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIEL 192
           +  G        + G       +LL   Y++D+ VDEA+ L
Sbjct: 120 DYLGTKVELPYAAHGYAGFYTFSLLDRHYREDLTVDEALGL 160

>Kwal_55.21028 s55 (654604..655191) [588 bp, 195 aa] {ON} YER012W
           (PRE1) - 22.6 kDa proteasome subunit [contig 135] FULL
          Length = 195

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 34/160 (21%), Positives = 69/160 (43%), Gaps = 5/160 (3%)

Query: 35  AIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTARVH 94
            +GI   D ++LA  + VT  +    ++ +K  +L++   +A  G   D        + +
Sbjct: 4   VLGIRVQDTVILATSKAVTRGISILKSTDDKTRQLSEHTLMAYTGEAGDTVQFAEYVQAN 63

Query: 95  AQEYLKTYNEEIPVEILVRRLSDIKQGYTQH-GGLRPFGVSFIYAGYD-DRYGYQLYTSN 152
            Q Y    N E+  + +    S ++Q   +     +P+ V+ +  GYD  +   +LY  +
Sbjct: 64  MQLYTIRENYELSPQAVS---SFVRQELAKSIRSRKPYQVNVLIGGYDIHKEKPELYQID 120

Query: 153 PSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIEL 192
             G        + G +     +LL   Y+ D+ +DE ++L
Sbjct: 121 YLGTKVELPYAAHGYSGFYTFSLLDRHYRPDMTLDEGLKL 160

>AAR019W Chr1 (375421..376008) [588 bp, 195 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YER012W (PRE1)
          Length = 195

 Score = 30.8 bits (68), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 34/159 (21%), Positives = 67/159 (42%), Gaps = 5/159 (3%)

Query: 36  IGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTARVHA 95
           +GI   D ++LA  + VT  +       +K  +L+    ++ +G   DA       + + 
Sbjct: 5   LGIRVQDSVILATSKAVTRGISVLKADDDKTRQLSPHSLMSFSGEPGDAVQFSEYIQANM 64

Query: 96  QEYLKTYNEEIPVEILVRRL-SDIKQGYTQHGGLRPFGVSFIYAGYDDRY-GYQLYTSNP 153
           Q Y+   N E+  +     + S++ +        +PF V+ +  GYD R    +LY  + 
Sbjct: 65  QLYMIRENYELSPQAQASYVRSELAKSLRSR---KPFQVNVLIGGYDTRAEKPELYQIDY 121

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIEL 192
            G        + G +     +LL   Y+ D+  +E ++L
Sbjct: 122 LGTKVELPYAAHGYSGFYTFSLLDHHYRPDMTTEEGLKL 160

>TPHA0A00730 Chr1 (131951..134104) [2154 bp, 717 aa] {ON} Anc_3.106
           YOL091W
          Length = 717

 Score = 31.2 bits (69), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 49/104 (47%), Gaps = 18/104 (17%)

Query: 6   YDSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEK 65
           YDS TT+    G+L Q+EY  +SIS+    I            + +  + +LE +TS EK
Sbjct: 474 YDSITTVLDDYGKL-QIEY--DSISNKSQDI------------QNECKNLILELETSQEK 518

Query: 66  IYRLNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVE 109
           +  L  K++ +       AE     +  HA   L+  NE++ ++
Sbjct: 519 VLSLESKLSESTK---LQAETFRRHSHSHALPLLRRTNEKLQID 559

>KLTH0G00550g Chr7 (38715..39512) [798 bp, 265 aa] {ON} highly
           similar to uniprot|P30657 Saccharomyces cerevisiae
           YFR050C PRE4 20S proteasome beta-type subunit
          Length = 265

 Score = 30.4 bits (67), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 39/192 (20%), Positives = 84/192 (43%), Gaps = 18/192 (9%)

Query: 20  YQVEYALESISHAGTAIGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAG 79
           Y   +  + I    + I +   DG+++AA+R  +   L + +  E+++ +     V ++G
Sbjct: 29  YPSMHTQQPIVTGTSVISMKYKDGVIIAADRLGSYGSLLRFSDVERLFPVGRNTVVGISG 88

Query: 80  LTADAEILIN------TARVHAQEYLKTYNEEIPVEILVRRLSDIKQGYTQHGGLRPFGV 133
             +D + L N      T   +  EY +   E +    +   L+++   Y +   + P   
Sbjct: 89  DISDMQHLENLLDEMQTENNYDNEYAED-EEALKPSYVFEYLANVM--YNRRSKMNPLWN 145

Query: 134 SFIYAGYDDRYGYQLYTSNPSGNYTGWKAISVGANTSAAQTLLQ--MDYKDDIK------ 185
           + I AG +D   +  Y +     Y+   +++ G     A  LL+  +D + D+K      
Sbjct: 146 ALIVAGLEDGKPFLKYVNLLGVTYSA-PSLATGFGAHLALPLLRKIVDSESDVKKTSAED 204

Query: 186 VDEAIELALKTL 197
            +++I+ A+K L
Sbjct: 205 AEKSIKEAMKVL 216

>KLTH0F13750g Chr6 (1126220..1126807) [588 bp, 195 aa] {ON} highly
           similar to uniprot|P22141 Saccharomyces cerevisiae
           YER012W PRE1 20S proteasome beta-type subunit localizes
           to the nucleus throughout the cell cycle
          Length = 195

 Score = 30.4 bits (67), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 35/159 (22%), Positives = 70/159 (44%), Gaps = 5/159 (3%)

Query: 36  IGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTARVHA 95
           +GI   + ++LA  + VT  +       +K  +L++ + +A +G   DA       + + 
Sbjct: 5   LGIRVQNTVILATSKAVTRGISVLKADDDKTRQLSEHVLMAYSGEAGDAVQFSEYIQANI 64

Query: 96  QEYLKTYNEEIPVEILVRRLSDIKQGYTQH-GGLRPFGVSFIYAGYD-DRYGYQLYTSNP 153
           Q Y    N E+  + +    S ++Q   +     RP+ V+ +  GYD  +   +LY  + 
Sbjct: 65  QLYSIRENYELSPKAVS---SFVRQELAKSIRSRRPYQVNVLIGGYDAHQKKPELYQIDY 121

Query: 154 SGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIEL 192
            G        + G +     +LL   Y+ D+ V+E ++L
Sbjct: 122 LGTKVELPYAAHGYSGFYTFSLLDHHYRPDMTVEEGLKL 160

>KLTH0C07348g Chr3 (636295..637245) [951 bp, 316 aa] {ON} weakly
           similar to uniprot|P38236 YBR057C Saccharomyces
           cerevisiae MUM2 Cytoplasmic protein essential for
           meiotic DNA replication and sporulation
          Length = 316

 Score = 30.0 bits (66), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 33/127 (25%), Positives = 62/127 (48%), Gaps = 15/127 (11%)

Query: 7   DSRTTIFSPEGRLYQVEYALESISHAGTAIGIMASDGIVLAAERK----VTSTLLEQDTS 62
           DSR +  S +GR  ++  +LESI H  +++ I A D  +    R+    VT+  L    S
Sbjct: 188 DSRVSSASQKGRTVEMPVSLESIFHKMSSV-IAAKDKELEETSRRLESIVTAIALNPSNS 246

Query: 63  TEKIYR-----LNDKITVAVAGLTADAEILINTARVHAQEYLKTYNEEIPVEILVRRLSD 117
             K+ R     L  K+ V +  LT + +   + A++    Y ++  + I +E++ R   +
Sbjct: 247 VTKLGRYDEEALAHKMVVRLETLTKENQ---DMAKMLG--YGRSKEQHIELELIKRENQE 301

Query: 118 IKQGYTQ 124
           +K+  +Q
Sbjct: 302 LKRKLSQ 308

>TDEL0B07110 Chr2 complement(1254814..1257480) [2667 bp, 888 aa]
           {ON} Anc_2.618 YKL073W
          Length = 888

 Score = 30.4 bits (67), Expect = 6.0,   Method: Compositional matrix adjust.
 Identities = 29/106 (27%), Positives = 47/106 (44%), Gaps = 29/106 (27%)

Query: 111 LVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYGY-----QLYTSNPSGNYTGWK---- 161
           L++ L D K+    HGGL     +F  AGY+ +  +       Y SNP    +GW+    
Sbjct: 697 LIKELEDAKE--VTHGGLASINETFNQAGYNSQQEFAKINLPHYISNP---LSGWQDKLK 751

Query: 162 -----------AISVGA-NTSAAQTLLQMDYKDD---IKVDEAIEL 192
                       +SVG+ +  + + L ++    D   I+VDE I+L
Sbjct: 752 TLKGVVKSVDELVSVGSVDKRSREDLFELKLAFDEACIEVDEKIKL 797

>Skud_5.116 Chr5 (174986..175582) [597 bp, 198 aa] {ON} YER012W
           (REAL)
          Length = 198

 Score = 29.6 bits (65), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 69/168 (41%), Gaps = 23/168 (13%)

Query: 36  IGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTARVHA 95
           +GI   D ++LA+ + VT  +     S +K  +L+    ++ AG   D        + + 
Sbjct: 5   LGIRVQDSVILASSKAVTRGISVLKDSDDKTRQLSPHTLMSFAGEAGDTVQFAEYIQANI 64

Query: 96  QEYLKTYNEEI---PVEILVRRLSDIKQGYTQHGGLRPFGVSFIYAGYDDRYG----YQL 148
           Q Y    + E+    V   VR     K+        RP+ V+ +  GYD R      YQ+
Sbjct: 65  QLYSIREDYELSPQAVSSFVR-----KELAKSIRSRRPYQVNVLIGGYDKRRNKPELYQI 119

Query: 149 YTSNPSGNYTGWKA-ISVGANTSAA---QTLLQMDYKDDIKVDEAIEL 192
                  +Y G K  +  GA+  +     +LL   Y+ D+  +E + L
Sbjct: 120 -------DYLGTKVELPYGAHGYSGFYTFSLLDRHYRPDMTTEEGLNL 160

>Ecym_1264 Chr1 complement(543133..543720) [588 bp, 195 aa] {ON}
           similar to Ashbya gossypii AAR019W
          Length = 195

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 33/161 (20%), Positives = 69/161 (42%), Gaps = 9/161 (5%)

Query: 36  IGIMASDGIVLAAERKVTSTLLEQDTSTEKIYRLNDKITVAVAGLTADAEILINTARVHA 95
           +GI   D ++LA+ + VT  +     + +K  +L+    ++  G + D        + + 
Sbjct: 5   LGIRVQDSVILASSKAVTRGISVLKATDDKTRQLSPHSLISFTGESGDTVQFSEYIQANM 64

Query: 96  QEYLKTYNEEIPVEI---LVRRLSDIKQGYTQHGGLRPFGVSFIYAGYD-DRYGYQLYTS 151
           Q Y+   N E+  +     VR  +++ +        +PF V+ +  GYD  +   +LY  
Sbjct: 65  QLYMIRENYELSPQAQSSFVR--NELAKSLRSR---KPFQVNVLIGGYDVKKEKPELYQI 119

Query: 152 NPSGNYTGWKAISVGANTSAAQTLLQMDYKDDIKVDEAIEL 192
           +  G        + G +     +LL   Y+ D+  +E ++L
Sbjct: 120 DYLGTKVELPYAAHGYSGFYTFSLLDHHYRPDMSTEEGLKL 160

>TBLA0C01740 Chr3 (409315..410889) [1575 bp, 524 aa] {ON} Anc_8.651
           YPL139C
          Length = 524

 Score = 29.6 bits (65), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 23/82 (28%), Positives = 40/82 (48%), Gaps = 1/82 (1%)

Query: 159 GWKAISVGANTSAAQTLLQMDYKDDIKVDEAIELALKTLSKTTDSSALTYDRVEFATIKK 218
           G K I   +N +   T+ Q    D  ++D  + L +  + ++TD  +L   + E  T+K+
Sbjct: 74  GNKVIPDQSNGTLTTTIYQTQNSDIYEIDTILPLGVYNIDQSTDIRSLNDTQYEDVTLKR 133

Query: 219 GENDKIYQKI-FKPEEIKQLLL 239
             N  I  K  F+ E I +L+L
Sbjct: 134 MANTPIKPKWSFQGENITKLIL 155

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.359 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,525,481
Number of extensions: 994665
Number of successful extensions: 3101
Number of sequences better than 10.0: 252
Number of HSP's gapped: 2895
Number of HSP's successfully gapped: 252
Length of query: 259
Length of database: 53,481,399
Length adjustment: 107
Effective length of query: 152
Effective length of database: 41,212,137
Effective search space: 6264244824
Effective search space used: 6264244824
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 64 (29.3 bits)