Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_392.98.257ON59459431840.0
KLLA0F19041g8.257ON76352218470.0
KLTH0G13794g8.257ON72552318430.0
Kwal_56.236078.257ON72552318430.0
NCAS0B038708.257ON59658718300.0
SAKL0H17160g8.257ON73954218380.0
NDAI0J014008.257ON58858718210.0
KAFR0B055608.257ON60558618110.0
TDEL0F038408.257ON72652818120.0
TBLA0E044008.257ON58959017770.0
Ecym_43138.257ON59760817640.0
YDR109C8.257ON71551917760.0
Suva_2.2698.257ON72552017650.0
Skud_4.3708.257ON71452017630.0
Smik_4.3558.257ON70452017480.0
ZYRO0C01782g8.257ON73052717380.0
CAGL0B01727g8.257ON57758817160.0
KNAG0H032608.257ON58058716880.0
TPHA0B032408.257ON58558816730.0
AGR092W8.257ON59659516390.0
Suva_14.931.111ON5436035503e-62
Skud_14.891.111ON5696035382e-60
TDEL0C059001.111ON5436105199e-58
ZYRO0F16016g1.111ON5426055135e-57
YNL249C (MPA43)1.111ON5426005013e-55
Smik_14.861.111ON5436094917e-54
Kwal_33.135301.111ON5346034776e-52
KLTH0F03080g1.111ON5335954705e-51
SAKL0C03432g1.111ON5476054636e-50
KNAG0F006601.111ON5356164346e-46
KLLA0C02937g1.111ON5164983182e-30
NCAS0A007801.111ON5495231948e-15
Kpol_392.18.270ON42487770.87
TPHA0E017505.436ON459135751.4
Kpol_1033.248.295ON491585751.9
Kpol_1046.52.402ON99485716.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_392.9
         (594 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON} (24389..26...  1231   0.0  
KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]...   716   0.0  
KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} simi...   714   0.0  
Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {...   714   0.0  
NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257    709   0.0  
SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} simi...   712   0.0  
NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8....   706   0.0  
KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON} Anc_8...   702   0.0  
TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {O...   702   0.0  
TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa] ...   689   0.0  
Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar t...   684   0.0  
YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON} P...   688   0.0  
Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON...   684   0.0  
Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON...   683   0.0  
Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON...   677   0.0  
ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} simila...   674   0.0  
CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {...   665   0.0  
KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.2...   654   0.0  
TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.2...   649   0.0  
AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic ho...   635   0.0  
Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {O...   216   3e-62
Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {O...   211   2e-60
TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON} Anc_1...   204   9e-58
ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} simi...   202   5e-57
YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON} ...   197   3e-55
Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {O...   193   7e-54
Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {...   188   6e-52
KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {...   185   5e-51
SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {...   182   6e-50
KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {O...   171   6e-46
KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {...   127   2e-30
NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {O...    79   8e-15
Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON} compl...    34   0.87 
TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436     33   1.4  
Kpol_1033.24 s1033 complement(49973..58081,58083..64721) [14748 ...    33   1.9  
Kpol_1046.5 s1046 complement(6779..9763) [2985 bp, 994 aa] {ON} ...    32   6.2  

>Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON}
           (24389..26173) [1785 nt, 595 aa]
          Length = 594

 Score = 1231 bits (3184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 594/594 (100%), Positives = 594/594 (100%)

Query: 1   MNHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNY 60
           MNHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNY
Sbjct: 1   MNHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNY 60

Query: 61  VLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETD 120
           VLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETD
Sbjct: 61  VLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETD 120

Query: 121 EINATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVR 180
           EINATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVR
Sbjct: 121 EINATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVR 180

Query: 181 SFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSV 240
           SFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSV
Sbjct: 181 SFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSV 240

Query: 241 GEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSKLDS 300
           GEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSKLDS
Sbjct: 241 GEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSKLDS 300

Query: 301 SIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTT 360
           SIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTT
Sbjct: 301 SIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTT 360

Query: 361 HPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISD 420
           HPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISD
Sbjct: 361 HPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISD 420

Query: 421 ESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARN 480
           ESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARN
Sbjct: 421 ESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARN 480

Query: 481 QLLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKHLDGNKNWDHGKTLWNK 540
           QLLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKHLDGNKNWDHGKTLWNK
Sbjct: 481 QLLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKHLDGNKNWDHGKTLWNK 540

Query: 541 MCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEIEASFNE 594
           MCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEIEASFNE
Sbjct: 541 MCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEIEASFNE 594

>KLLA0F19041g Chr6 complement(1753543..1755834) [2292 bp, 763 aa]
           {ON} similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 763

 Score =  716 bits (1847), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/522 (63%), Positives = 414/522 (79%), Gaps = 6/522 (1%)

Query: 1   MNHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNY 60
           M +Y+GVDVGTGS RACVI++ G ILSL  + I + ELKPNYITQSS+EIW  IC CV  
Sbjct: 34  MVYYVGVDVGTGSARACVIDNLGNILSLAERPIQRHELKPNYITQSSQEIWNAICYCVKN 93

Query: 61  VLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETD 120
           V+++S + P ++ GIGFDATCSLVV+D    ++VGVGP+F D+ +NIILWMDHRA++ET+
Sbjct: 94  VVRDSGVDPRTIHGIGFDATCSLVVVDN-NNEDVGVGPDFTDNLQNIILWMDHRAIEETE 152

Query: 121 EINATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVR 180
           EINATGDKCLKYVGG+MSVEME+PKIKWLKNN+ +  F+ CKFFDL DYLT+KAT  ++R
Sbjct: 153 EINATGDKCLKYVGGQMSVEMEIPKIKWLKNNIPEKKFAQCKFFDLADYLTFKATGSEIR 212

Query: 181 SFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSV 240
           S+ STVCKQGLLPLGVEGS  GWSKEF  +I L+EL +D+F+ +GGS+     E    S 
Sbjct: 213 SYCSTVCKQGLLPLGVEGSKNGWSKEFLQEIGLEELIADDFAKLGGSV----TETTFLSA 268

Query: 241 GEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVE-EIGTINNDDDASSKLD 299
           GE +G L+E SA ELGL T C+VGSG+IDAYAGWVGTVAA+ + EI  +   D+    +D
Sbjct: 269 GECIGTLTEESAAELGLSTHCVVGSGVIDAYAGWVGTVAARTDVEIPALVKSDEVKHGID 328

Query: 300 SSIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILT 359
            + G LA +AGTSTCHI +S  PIFV G+WGPYRDV++  FW AEGGQSCTGALL H+LT
Sbjct: 329 RATGRLAAVAGTSTCHIAMSKDPIFVKGVWGPYRDVMAPGFWLAEGGQSCTGALLAHVLT 388

Query: 360 THPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPIS 419
           THPAY EL +  +  +V  F++LN+RL  L ++  A S+++L KH F YGDYHGNRSPI+
Sbjct: 389 THPAYAELSQLSDAANVSKFDYLNSRLELLAQQRKASSVVALAKHLFFYGDYHGNRSPIA 448

Query: 420 DESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQAR 479
           D SMRAAIIGQSMD SID L+IMYL ACEFI+QQ+RQI+ ++  +GH +  I+MSGGQ R
Sbjct: 449 DPSMRAAIIGQSMDNSIDDLSIMYLGACEFIAQQTRQIVEQMCNSGHELAAIFMSGGQCR 508

Query: 480 NQLLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYN 521
           N LLMRLLADCTGLP+VIPRYIDA+V+FGSA+LGAVA +++N
Sbjct: 509 NGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFN 550

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 30/53 (56%), Positives = 39/53 (73%)

Query: 537 LWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEIE 589
           LW  M  +T  G V+ P   + PDR+LLNAKYKIFLDMA TQ+KYR+ +DE++
Sbjct: 711 LWEVMYNMTGGGKVVWPTEEDAPDRLLLNAKYKIFLDMAATQQKYRKLVDEVK 763

>KLTH0G13794g Chr7 (1191104..1193281) [2178 bp, 725 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 725

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/523 (62%), Positives = 411/523 (78%), Gaps = 1/523 (0%)

Query: 1   MNHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNY 60
           M +Y+GVDVGTGS RAC+I+  G ILSL  + I +E+LK N+ITQSS+EIWQ +C CV  
Sbjct: 32  MLYYVGVDVGTGSARACIIDSMGNILSLAERPIQREQLKANFITQSSQEIWQAVCHCVKS 91

Query: 61  VLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETD 120
           V+++S +    + GIGFDATCSLVV++++T +EV VGP+F + ++NIILWMDHRA++ET 
Sbjct: 92  VVRDSGVPAEKIHGIGFDATCSLVVVEEQTNKEVAVGPDFSNTDQNIILWMDHRAIEETQ 151

Query: 121 EINATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVR 180
            INATGDKCLKYVGG+MSVEME+PKIKWLKN+L +  F+ CKFFDL DYLT+KA+ K+ R
Sbjct: 152 LINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPENKFNECKFFDLADYLTFKASGKETR 211

Query: 181 SFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSV 240
           SF STVCKQGLLP+GVEGS  GWS+EF T+I L+EL  D+F  IGGS+ +     N  S 
Sbjct: 212 SFCSTVCKQGLLPVGVEGSAEGWSREFLTEIGLEELIEDDFRRIGGSVKNSDKGKNFLSA 271

Query: 241 GEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVE-EIGTINNDDDASSKLD 299
           GE++G +    A+ELGL   C+VGSG+IDAYAGWVGTVAA+ +  I  +   D     +D
Sbjct: 272 GEFIGAIDATVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKTDQEKVGMD 331

Query: 300 SSIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILT 359
            + G LA +AGTSTCHI +S  PIFV+G+WGPYRD L+ NFWCAEGGQSCTGALL H+LT
Sbjct: 332 RATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVLT 391

Query: 360 THPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPIS 419
           THPAY EL +  +  SV  F++LN+RL  L ++  ARS++ L KH F YGDYHGNRSPI+
Sbjct: 392 THPAYTELSQLADAASVSKFDYLNSRLETLAQQQKARSVVHLAKHLFFYGDYHGNRSPIA 451

Query: 420 DESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQAR 479
           D SMRAAIIGQSMD SID LA+MYL ACEFI+QQ+RQI+ ++  +GH +  I+MSGGQ R
Sbjct: 452 DPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVDKMCTSGHDLSAIFMSGGQCR 511

Query: 480 NQLLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNI 522
           N LLMRLLADCTGLP+VIPRYIDA+V+FGSA+LGAVA +++++
Sbjct: 512 NGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDL 554

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 34/59 (57%), Positives = 43/59 (72%)

Query: 529 KNWDHGKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDE 587
           ++ D+G  +WN M  +T  G V+ P A  + DRVLLNAKYKIFLDMAETQRKYR  +D+
Sbjct: 663 RSSDNGDAMWNVMYNMTGGGKVVQPAAEENADRVLLNAKYKIFLDMAETQRKYRTIVDD 721

>Kwal_56.23607 s56 complement(618687..620864) [2178 bp, 725 aa] {ON}
           YDR109C - Hypothetical ORF [contig 176] FULL
          Length = 725

 Score =  714 bits (1843), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/523 (61%), Positives = 412/523 (78%), Gaps = 1/523 (0%)

Query: 1   MNHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNY 60
           M +YIGVDVGTGS RAC+I+  G ILSL  + I +E+LKPN+ITQSS+EIWQ +C CV  
Sbjct: 32  MLYYIGVDVGTGSARACIIDSMGNILSLAERPIQREQLKPNFITQSSQEIWQAVCHCVKS 91

Query: 61  VLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETD 120
           V+++S +    + GIGFDATCSLVV+++ + +EV VGP+F++ N+NIILWMDHRA++ET+
Sbjct: 92  VVRDSGVPSEKIHGIGFDATCSLVVVEEGSNKEVAVGPDFQNTNQNIILWMDHRAIEETE 151

Query: 121 EINATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVR 180
           +INATGDKCLKYVGG+MSVEME+PKIKWLKN+L +  F  CKFFDL DYLT+KA+ K+ R
Sbjct: 152 QINATGDKCLKYVGGQMSVEMEIPKIKWLKNHLPNNKFDECKFFDLADYLTFKASGKETR 211

Query: 181 SFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSV 240
           SF STVCKQGLLP+GVEGS  GWS+EF T+I L++   D+F  IGGS+ +     N  S 
Sbjct: 212 SFCSTVCKQGLLPVGVEGSKEGWSREFLTEIGLEDFIEDDFRKIGGSVKNSDKGKNFLSA 271

Query: 241 GEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVE-EIGTINNDDDASSKLD 299
           GE+VG +    A+ELGL   C+VGSG+IDAYAGWVGTVAA+ +  I  +   D     +D
Sbjct: 272 GEFVGAIDPAVAEELGLSNHCVVGSGVIDAYAGWVGTVAARTDVSIPALVKIDQEKVGMD 331

Query: 300 SSIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILT 359
            + G LA +AGTSTCHI +S  PIFV+G+WGPYRD L+ NFWCAEGGQSCTGALL H++T
Sbjct: 332 RATGRLAAVAGTSTCHIAMSRDPIFVDGVWGPYRDALATNFWCAEGGQSCTGALLAHVMT 391

Query: 360 THPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPIS 419
           THPAY EL +  +  SV  F++LN+RL  L ++  +RS++ L +H F YGDYHGNRSPI+
Sbjct: 392 THPAYTELSQLADAASVSKFDYLNSRLETLAQQQKSRSVVHLARHLFFYGDYHGNRSPIA 451

Query: 420 DESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQAR 479
           D SMRAAIIGQSMD SID LA+MYL ACEFI+QQ+RQI+ ++  +GH +  I+MSGGQ R
Sbjct: 452 DPSMRAAIIGQSMDNSIDDLALMYLGACEFIAQQTRQIVEKMTTSGHDMAAIFMSGGQCR 511

Query: 480 NQLLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNI 522
           N LLMRLLADCTGLP+VIPRYIDA+V+FGSA+LGAVA +++++
Sbjct: 512 NGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFDL 554

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 33/63 (52%), Positives = 45/63 (71%)

Query: 529 KNWDHGKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEI 588
           ++ D+G  +WN M  +T  G V+ P   ++PDR LL+ KYKIFLDMAETQRKYR  ++E+
Sbjct: 663 RSSDNGDAMWNVMYNMTGGGKVVQPCPEDNPDRKLLDVKYKIFLDMAETQRKYRNLVNEV 722

Query: 589 EAS 591
           E S
Sbjct: 723 EKS 725

>NCAS0B03870 Chr2 (689411..691201) [1791 bp, 596 aa] {ON} Anc_8.257
          Length = 596

 Score =  709 bits (1830), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/587 (56%), Positives = 441/587 (75%), Gaps = 7/587 (1%)

Query: 3   HYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNYVL 62
           +Y+G+DVGTGSVRACV++  G +LSL  K I +EELKPN+ITQS+REIWQ  C CV   +
Sbjct: 16  YYVGIDVGTGSVRACVVDSCGNMLSLVEKSINREELKPNFITQSTREIWQACCFCVKTAI 75

Query: 63  QESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETDEI 122
           ++ ++  S VLGIGFDATCSLV I+K T ++VGVGPNFE+ + N+ILWMDHRAVKE +EI
Sbjct: 76  EQCKVDKSLVLGIGFDATCSLVAIEKGTDKQVGVGPNFENRDMNVILWMDHRAVKEANEI 135

Query: 123 NATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVRSF 182
           NAT DKCLKYVGG MSVEM++PKIKWLKNN+   +F  C+FF+L DYLT+KAT K  RSF
Sbjct: 136 NATNDKCLKYVGGAMSVEMDIPKIKWLKNNMDPNMFKKCEFFELADYLTFKATGKRTRSF 195

Query: 183 SSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSVGE 242
            S VCKQG LP GVEGS  GWSKEF + I L++L+ +++ ++GG++ ++  ++N +S G+
Sbjct: 196 CSVVCKQGFLPNGVEGSSEGWSKEFLSSIGLEDLAGNSYDSLGGALKNDS-QDNFQSSGK 254

Query: 243 YVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSKLDSSI 302
            +G LS  +  ELGL   C+VG+GIIDAYAG +GT+AA  E    I N  D+S  L ++I
Sbjct: 255 CLGPLSNEAVIELGLSENCVVGAGIIDAYAGLIGTIAATSEGSHQIKN--DSSIGLQNAI 312

Query: 303 GNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTTHP 362
           G LA +AGTSTCH+ LS  P+FV G+WGPYRDV++  +WCAEGGQ+CTG LL ++L+ HP
Sbjct: 313 GRLASVAGTSTCHLLLSKDPVFVPGVWGPYRDVVADGYWCAEGGQTCTGELLSYVLSIHP 372

Query: 363 AYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISDES 422
           A+ EL        +  F++LNN L EL  ++   S + L KH F YGDY GNRSP +D  
Sbjct: 373 AFKELINASGVAKIDKFQYLNNMLDELTIKHKVNSKLQLAKHIFFYGDYRGNRSPYADPM 432

Query: 423 MRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARNQL 482
           M AAIIGQSM+ ++++LA+ YL+ACEFI+QQ+RQI+  + KAG  +  IYMSGGQ RN+L
Sbjct: 433 MSAAIIGQSMNHNLENLAVTYLAACEFIAQQTRQIVETIRKAGTHVSYIYMSGGQCRNKL 492

Query: 483 LMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKHLDGNKNWDHGKTLWNKMC 542
           LM+LL+DCTGLP+++P+Y+DA+V+FG+AILGA A  +     ++     D G  LW  M 
Sbjct: 493 LMKLLSDCTGLPIMLPKYVDAAVVFGAAILGATADASRKSVEIE----CDFGFMLWETMD 548

Query: 543 KLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEIE 589
           ++TP GT++ PN VNHPDR LL+ KY+IFLDMAETQRKYR+ +D+I+
Sbjct: 549 RMTPHGTLLEPNDVNHPDRKLLDVKYQIFLDMAETQRKYRQMVDDID 595

>SAKL0H17160g Chr8 (1516854..1519073) [2220 bp, 739 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein of unknown function and similar to
           uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 739

 Score =  712 bits (1838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/542 (61%), Positives = 417/542 (76%), Gaps = 2/542 (0%)

Query: 1   MNHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNY 60
           M +Y+GVDVGTGS RAC+I++ G ILSL  + I ++ELKP+YITQSS+EIW  IC CV  
Sbjct: 32  MTYYVGVDVGTGSARACIIDNMGNILSLAERPIQRQELKPSYITQSSQEIWLAICYCVKS 91

Query: 61  VLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETD 120
           V+++S ++P  + GIGFDATCSLVV++ ++ +EV VGP+F +  +NIILWMDHRA+ ET 
Sbjct: 92  VVKDSGVLPEKIHGIGFDATCSLVVVEDDSDKEVAVGPDFFNTEQNIILWMDHRAIDETK 151

Query: 121 EINATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVR 180
           EINAT DKCLKYVGG+MSVEME+PKIKWLKNNL    F  CKFFDL DYLT+KAT  + R
Sbjct: 152 EINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPREKFEKCKFFDLADYLTFKATGLETR 211

Query: 181 SFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSE-QLENNIRS 239
           S+ STVCKQGLLP+GVE S  GWSKEF T I L++L  D+F  +GGSI S+    +   S
Sbjct: 212 SYCSTVCKQGLLPVGVESSKQGWSKEFLTNIGLEDLCQDDFRKLGGSIKSDGSGGSTFLS 271

Query: 240 VGEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVE-EIGTINNDDDASSKL 298
            GE +G L   +A+ELGLP  C+VGSG+IDAYAGWVGTVAA+ + +I  +   D+  + +
Sbjct: 272 AGECIGSLDPSAAEELGLPAHCVVGSGVIDAYAGWVGTVAARTDVDIPELVEADNEKTGI 331

Query: 299 DSSIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHIL 358
           D + G LA +AGTSTCHI +S  PIFV+G+WGPYRDV++  FWCAEGGQSCTGALL H+L
Sbjct: 332 DHATGRLAAVAGTSTCHIAMSKDPIFVDGVWGPYRDVMAPGFWCAEGGQSCTGALLAHVL 391

Query: 359 TTHPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPI 418
           T HPAY EL    +  SV  F++LN+RL  L ++  ARS+++L KH F YGDYHGNRSPI
Sbjct: 392 TIHPAYTELSHLSDAASVSKFDYLNSRLEVLTQQRGARSVVALAKHLFFYGDYHGNRSPI 451

Query: 419 SDESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQA 478
           +D SMRAA+IGQSMD SID LAIMYL ACEFI+QQ+RQI+ ++  +GH I  I+MSGGQ 
Sbjct: 452 ADPSMRAAVIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMSVSGHRIAAIFMSGGQC 511

Query: 479 RNQLLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKHLDGNKNWDHGKTLW 538
           RN LLMRLLADCTGLP+VIPRYIDA+V+FGSA+LGAVA +++N+ H  G+ +     +L 
Sbjct: 512 RNGLLMRLLADCTGLPIVIPRYIDAAVVFGSALLGAVASESFNLNHKSGSLSRRRKSSLS 571

Query: 539 NK 540
            K
Sbjct: 572 GK 573

 Score = 79.7 bits (195), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 33/56 (58%), Positives = 44/56 (78%)

Query: 534 GKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEIE 589
           G  LW+ M  +T  G V+ P++ +HPDRVLL+AKYKIFLDMAETQR+YR  +D++E
Sbjct: 673 GDALWDVMYNMTGGGKVVQPSSDDHPDRVLLDAKYKIFLDMAETQRRYREAVDKVE 728

>NDAI0J01400 Chr10 (321913..323679) [1767 bp, 588 aa] {ON} Anc_8.257
          Length = 588

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/587 (56%), Positives = 435/587 (74%), Gaps = 6/587 (1%)

Query: 3   HYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNYVL 62
           +YIGVDVGTGSVRAC+I+D G I S     I ++ELK + ITQSS+EIW+ +C CV  V+
Sbjct: 7   YYIGVDVGTGSVRACIIDDLGTIKSQAELSIHRQELKTDCITQSSQEIWRAVCFCVKKVV 66

Query: 63  QESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETDEI 122
            E       V GIGFDATCSLVV+DK T + V VGP+F D N++IILWMDHRA+KET EI
Sbjct: 67  NELGCTRDQVKGIGFDATCSLVVVDKVTNRGVAVGPDFNDSNQDIILWMDHRALKETKEI 126

Query: 123 NATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVRSF 182
           N+T D+CLKYVGG+MS+EMELPKIKWLK +++  VF+ C+F+DL DYLT+KAT +  RSF
Sbjct: 127 NSTNDECLKYVGGQMSIEMELPKIKWLKRHMSKDVFARCEFYDLADYLTFKATGRKTRSF 186

Query: 183 SSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSVGE 242
            S VCKQG++P+GVEGS +GWSK+F   IDL+EL+ ++++ +GGS+       N  + GE
Sbjct: 187 CSVVCKQGMVPMGVEGSKLGWSKDFLRNIDLEELTYNDYAKLGGSVSGSH-GRNFLTAGE 245

Query: 243 YVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSKLDSSI 302
           Y+  L++ + +EL L   CIVGSGIIDAYAGW+GTV +     GT++ +      + ++I
Sbjct: 246 YIAPLNDQAIEELELSKECIVGSGIIDAYAGWLGTVGS-----GTVDLEQLFRVGMANAI 300

Query: 303 GNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTTHP 362
           G LA +AGTSTCHI LS  PIFV G+WGPY+D ++  +WC EGGQSCTGALL+H+L THP
Sbjct: 301 GRLAAVAGTSTCHIVLSKDPIFVPGVWGPYKDTITKGYWCTEGGQSCTGALLQHVLQTHP 360

Query: 363 AYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISDES 422
           +Y EL E  EK+ +  F++LN RLAE+ K ++ RS++ L KH F YGD HGNRSP++D S
Sbjct: 361 SYKELEEISEKNGMNKFDYLNTRLAEMAKRSNERSVLCLAKHIFFYGDLHGNRSPLADPS 420

Query: 423 MRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARNQL 482
           M+ AI+G SMDTS+D+LA  YL+ACEFI+QQ+RQII  +  AGH I  IYMSGGQ RN L
Sbjct: 421 MKGAIVGLSMDTSLDNLAKTYLAACEFIAQQNRQIIEAMCDAGHEISAIYMSGGQCRNSL 480

Query: 483 LMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKHLDGNKNWDHGKTLWNKMC 542
           LM+LLADC+GL V+IP YID++V+FG+AILGA A   Y +   + +   +    LW+ M 
Sbjct: 481 LMKLLADCSGLSVIIPEYIDSAVVFGAAILGASASKLYQLNGSESDTVINTENILWSTMN 540

Query: 543 KLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEIE 589
           K+T  G+ I P   +HPDR+LL+AKYKIFLDMA+ Q++YR  +D +E
Sbjct: 541 KMTKVGSYIMPVPKDHPDRILLDAKYKIFLDMADRQKRYRAIVDAVE 587

>KAFR0B05560 Chr2 (1138380..1140197) [1818 bp, 605 aa] {ON}
           Anc_8.257 YDR109C
          Length = 605

 Score =  702 bits (1811), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/586 (57%), Positives = 438/586 (74%), Gaps = 6/586 (1%)

Query: 3   HYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNYVL 62
           H+IGVDVGTGSVRACVI+ KG+IL+L  K I++EELKP +ITQSS EIW  IC CV  V+
Sbjct: 20  HFIGVDVGTGSVRACVIDRKGDILALVDKPISREELKPGFITQSSEEIWDSICFCVRKVI 79

Query: 63  QESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETDEI 122
            +++I  + V+GIGFDATCSL V+DK+T + + VGP F  +++NII+WMDHRA +ETDEI
Sbjct: 80  ADAKIPANKVIGIGFDATCSLAVVDKDTLEGLAVGPQFSKNDQNIIMWMDHRASQETDEI 139

Query: 123 NATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVRSF 182
           N+  D  LKYVGGKMS+EME+PKIKWLKN++    F    FFDL DYLT+KAT    RS 
Sbjct: 140 NSIYDAPLKYVGGKMSIEMEMPKIKWLKNHMPRETFRKAVFFDLPDYLTFKATGMQNRSL 199

Query: 183 SSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSVGE 242
            S VCKQGLLP+GVEGS  GWS+ F +   L EL  + F  IGG  ++ +   N  S GE
Sbjct: 200 CSAVCKQGLLPIGVEGSTEGWSRTFLSNTGLPELIENEFERIGGPGNNSR---NFLSAGE 256

Query: 243 YVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSK-LDSS 301
           YV  LS+ S ++LGL  +C+VGSG+IDAYAG +GT+AA+++E  +    DDA+ + L ++
Sbjct: 257 YVSTLSKSSGEQLGLTESCVVGSGLIDAYAGLIGTIAARIDE--SARTQDDANGQDLQNA 314

Query: 302 IGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTTH 361
           IG LA +AGTSTCHITLS KPIFVNG+WGPY+D+L+ ++WCAEGGQSCTG LL+H++TTH
Sbjct: 315 IGRLAAVAGTSTCHITLSDKPIFVNGVWGPYKDILAKDYWCAEGGQSCTGELLKHVITTH 374

Query: 362 PAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISDE 421
           PAY EL  +  K  +  FE LN  + +L ++    +I+ L K  FLYGDYHGNRSPI+D 
Sbjct: 375 PAYEELKIKAAKSKLDLFECLNEIIRDLAEQKGTCTILELTKGLFLYGDYHGNRSPIADP 434

Query: 422 SMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARNQ 481
            MRA+IIGQSMDT+++SLA++YL+ACEFI+ Q+R II+++ +AGH+I+ IYMSGGQ RN 
Sbjct: 435 RMRASIIGQSMDTTVESLALIYLAACEFIAHQTRHIITKMNEAGHSIRSIYMSGGQCRNN 494

Query: 482 LLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKHLDGNKNWDHGKTLWNKM 541
           +LM LLAD TGLPVVIP+YIDA+V+FG+A++GA A D +N    + ++      TLWN M
Sbjct: 495 ILMELLADFTGLPVVIPKYIDAAVVFGAALIGATAWDVFNQCETNDDRVPQVEHTLWNAM 554

Query: 542 CKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDE 587
            K+T  GT I P    H  + LLN KYKI++DMA+TQ+KYR  ID+
Sbjct: 555 VKMTGNGTTIAPKVNRHASQALLNTKYKIYMDMAKTQKKYRSLIDD 600

>TDEL0F03840 Chr6 complement(705363..707543) [2181 bp, 726 aa] {ON}
           Anc_8.257 YDR109C
          Length = 726

 Score =  702 bits (1812), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/528 (62%), Positives = 409/528 (77%), Gaps = 5/528 (0%)

Query: 1   MNHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNY 60
           M +Y+GVDVGTGS RAC+I++ G ILSL  K I +EELKPNYITQSS+EIWQ IC CV  
Sbjct: 32  MIYYVGVDVGTGSARACIIDNTGNILSLAEKPIQREELKPNYITQSSQEIWQSICHCVKS 91

Query: 61  VLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETD 120
           V+++S +    + GIGFDATCSLVV+D E  +EVGVGP F ++++NI+LWMDHRA+ ET+
Sbjct: 92  VVRDSGVPVERIHGIGFDATCSLVVVDDE-DKEVGVGPVFANNDQNIVLWMDHRAIAETN 150

Query: 121 EINATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVR 180
           EINAT DKCLKYVGG+MSVEME+PKIKWLKNNL    F  CKFFDL DYLT+KAT+KD R
Sbjct: 151 EINATNDKCLKYVGGQMSVEMEIPKIKWLKNNLPKEQFDKCKFFDLADYLTFKATNKDTR 210

Query: 181 SFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSA---IGGSIHSEQLENNI 237
           SF STVCKQGL+P+GVEGS  GWSK+F   I+L EL  + F        +  ++   ++ 
Sbjct: 211 SFCSTVCKQGLIPIGVEGSKEGWSKDFLNTINLPELVENVFCQDRWPATATAADGTTHSF 270

Query: 238 RSVGEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVE-EIGTINNDDDASS 296
            S GEYVG L E +A+ELGLP  C+VGSG+IDAYAGWVGTVAA+ + E+  +   D    
Sbjct: 271 LSAGEYVGALDEEAAEELGLPVHCVVGSGVIDAYAGWVGTVAAQTDVELPDLAEADRTKK 330

Query: 297 KLDSSIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEH 356
            +D + G LA +AGTSTCHI LS  P+FVNG+WGPYRDV++H FW AEGGQSCTGALL H
Sbjct: 331 GIDRATGRLAAVAGTSTCHIALSRDPVFVNGVWGPYRDVMAHGFWAAEGGQSCTGALLAH 390

Query: 357 ILTTHPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRS 416
           +++THPA+ EL    +  ++  F++LN+RL  L ++   RS+++L KH + YGDYHGNRS
Sbjct: 391 VMSTHPAFTELSHLSDAANISKFDYLNSRLETLVQQRGDRSVVALAKHLYFYGDYHGNRS 450

Query: 417 PISDESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGG 476
           PI+D SMRAAIIGQSMD SID LAIMYL ACEFI+QQ+RQI+ ++  AGH I  I+MSGG
Sbjct: 451 PIADPSMRAAIIGQSMDNSIDDLAIMYLGACEFIAQQTRQIVEKMCDAGHQISTIFMSGG 510

Query: 477 QARNQLLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKH 524
           Q RN LLMRLLADCTGLP++IPRYIDA+V+FGSA+LGAVA +++N  H
Sbjct: 511 QCRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESFNSHH 558

 Score = 75.9 bits (185), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 32/61 (52%), Positives = 46/61 (75%)

Query: 532 DHGKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEIEAS 591
           ++G  LW+ M ++T  G V+ P+  + PDRVLLNAKYKIFLDMA++QR+YR  ID++E +
Sbjct: 664 NNGDALWDVMYQMTGGGKVVRPSPEDDPDRVLLNAKYKIFLDMADSQRRYREAIDKVEKA 723

Query: 592 F 592
            
Sbjct: 724 I 724

>TBLA0E04400 Chr5 complement(1119643..1121412) [1770 bp, 589 aa]
           {ON} Anc_8.257 YDR109C
          Length = 589

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/590 (55%), Positives = 436/590 (73%), Gaps = 7/590 (1%)

Query: 1   MNHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNY 60
           M++YIGVDVGTGS RAC+I+  G+ILS++   I ++ELKP YITQS+ +IW  IC C+  
Sbjct: 1   MSYYIGVDVGTGSARACLIDLNGDILSIKELAIDRQELKPGYITQSTNQIWNNICICIRN 60

Query: 61  VLQESQI--IPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKE 118
           +LQES +  I S + GIGFDATCSLVV++ +T QEV VGPNFED+++N+ILWMDHRA+ E
Sbjct: 61  ILQESNVDDISSKIKGIGFDATCSLVVLNSKTDQEVAVGPNFEDNDQNVILWMDHRALIE 120

Query: 119 TDEINATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKD 178
           T EIN+T  KCLKYVGG+MSVEME+PKIKWLKNN+   V+ +CKF DL D+LTYKAT   
Sbjct: 121 TVEINSTDSKCLKYVGGQMSVEMEIPKIKWLKNNMNPAVYKDCKFLDLPDFLTYKATGNS 180

Query: 179 VRSFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSE-QLENNI 237
           +RSF S VCKQGLLPLGVEGS  GW++EF   I L++L  DNF  +GG +  + Q + + 
Sbjct: 181 IRSFCSAVCKQGLLPLGVEGSTKGWTEEFLLNIGLEDLMEDNFVKLGGPVKQDSQGKVSF 240

Query: 238 RSVGEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEE-IGTINNDDDASS 296
            + GE++G+LS+ S+K +G+ + C V SGIIDAYAGW+GT+AA  +E I  +NN  D  +
Sbjct: 241 STAGEFIGYLSDKSSKIMGISSKCAVSSGIIDAYAGWIGTIAASTKEPIEQLNNFQDNLN 300

Query: 297 KLDSSIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEH 356
            +  S G LAV+AGTSTCHI+L++KPIFV G+WGPYRDVL HNFWCAEGGQSCTGALL+H
Sbjct: 301 GMICSSGRLAVVAGTSTCHISLTNKPIFVPGVWGPYRDVLGHNFWCAEGGQSCTGALLQH 360

Query: 357 ILTTHPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRS 416
           +L THPAY EL    ++  +  FE LNN++ EL  +      + L K+ F YGD+HGNRS
Sbjct: 361 VLETHPAYKELCAISKQQDISVFEVLNNKIRELTHQRDLIDEVHLIKNLFFYGDFHGNRS 420

Query: 417 PISDESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGG 476
           P++DE+MR  IIG SMD+S++ L  MYL ACEFI+QQ+R I+  + K+G+ +  +YMSGG
Sbjct: 421 PVADEAMRGNIIGLSMDSSLNDLCRMYLGACEFIAQQTRHIVDIMTKSGYNLHSLYMSGG 480

Query: 477 QARNQLLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKHLDGNKNWDHGKT 536
           Q RN+LLM+L+++C GLPVVIP+ ID +V+FGSA++GA A +     H D  K  D  + 
Sbjct: 481 QCRNELLMQLISNCVGLPVVIPKNIDTAVVFGSALMGACASELSK-SHSDNTKKPD--QI 537

Query: 537 LWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQID 586
           LW+ MCK+T  G V++P   +     LL  KY+I+LDM  TQ++YR  ++
Sbjct: 538 LWDVMCKMTGQGIVVSPQDPSSQVCKLLTVKYQIYLDMIATQKRYRSMVN 587

>Ecym_4313 Chr4 (672950..674743) [1794 bp, 597 aa] {ON} similar to
           Ashbya gossypii AGR092W
          Length = 597

 Score =  684 bits (1764), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/608 (54%), Positives = 431/608 (70%), Gaps = 30/608 (4%)

Query: 1   MNHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNY 60
           + HYIGVDVGT SVRACV++  G ILSL SK I+++E++PNY+TQSS EIW+ IC C+  
Sbjct: 2   LQHYIGVDVGTESVRACVVDVHGTILSLASKPISRQEIQPNYLTQSSNEIWRAICFCIRK 61

Query: 61  VLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETD 120
           ++ +SQ++  S++GIGFDATCSLVV+++ T + V VGPNF+D  ++IILWMDHRA+ E +
Sbjct: 62  IICDSQVVKDSIIGIGFDATCSLVVLEEVTNKGVAVGPNFDDFEQDIILWMDHRAIDEVN 121

Query: 121 EINATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVR 180
           EIN+TG +CLKYVGGKMS+EM++PKIKWLKNNL  G F  C+F+DL D+LTY+AT    R
Sbjct: 122 EINSTGHRCLKYVGGKMSIEMQIPKIKWLKNNLPQGKFDKCEFYDLPDFLTYRATGNKCR 181

Query: 181 SFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSV 240
           SF STVCK GLLPLGV+GS  GW ++ F  I L EL    FS +GG + S    +N  S 
Sbjct: 182 SFCSTVCKMGLLPLGVDGSTKGWPQDLFEDIGLAELCRREFSKLGGVVSST--ASNFLSA 239

Query: 241 GEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSKLDS 300
           G+YVGHLS+ +A +LGL T CIV SG+IDAYAGWVGT+AA     G     D   S+L S
Sbjct: 240 GDYVGHLSDEAAADLGLTTKCIVASGLIDAYAGWVGTIAA-----GITLGSDGQESELAS 294

Query: 301 SIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTT 360
           S   LA +AGTSTCHIT+S  P F++G+WGPYRD L   +W  EGGQSCTGALL H+L +
Sbjct: 295 S--RLATVAGTSTCHITISKCPHFMDGVWGPYRDALMPGYWVTEGGQSCTGALLAHVLKS 352

Query: 361 HPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISD 420
           HPAY  L +  +   +  F+F+NNRL EL++E  A+S+ +LGKH F YGDYHGNRSPI+D
Sbjct: 353 HPAYDTLCKLAKNQGISKFDFINNRLEELKEERGAQSVAALGKHLFFYGDYHGNRSPIAD 412

Query: 421 ESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARN 480
            +MRA IIGQSMD S+D LAIM L ACEFI+QQ+RQI+  + ++GH I  IYMSGGQ RN
Sbjct: 413 PNMRATIIGQSMDVSVDDLAIMTLGACEFIAQQTRQIVEHIKQSGHEITSIYMSGGQCRN 472

Query: 481 QLLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKHLDGNKNWDHGKT---- 536
            +L++LLA+CT LP+V+P+YIDA+V+FGSA+LG  A +    K+L G  +     T    
Sbjct: 473 LVLIKLLANCTKLPIVLPKYIDAAVVFGSALLGVAASE----KYLHGCSDTASVSTIVDQ 528

Query: 537 -------------LWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRR 583
                        LW  M  LT  G +I P+ +   +  LL+ KY+IFLDM ETQ++YR 
Sbjct: 529 QRITSELKPKQSILWTVMANLTGIGQIIEPSNMLDSEIRLLDQKYEIFLDMIETQKRYRD 588

Query: 584 QIDEIEAS 591
            +   E S
Sbjct: 589 LVTRAENS 596

>YDR109C Chr4 complement(673520..675667) [2148 bp, 715 aa] {ON}
           Putative kinase
          Length = 715

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 321/519 (61%), Positives = 398/519 (76%), Gaps = 4/519 (0%)

Query: 4   YIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNYVLQ 63
           Y+GVDVGTGS RACVI+  G +LSL  K I +E+L  N+ITQSSREIW  +C CV  V++
Sbjct: 40  YVGVDVGTGSARACVIDQSGNMLSLAEKPIKREQLISNFITQSSREIWNAVCYCVRTVVE 99

Query: 64  ESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETDEIN 123
           ES + P  V GIGFDATCSLVV+     +E+ VGP+F ++++NIILWMDHRA+KET+EIN
Sbjct: 100 ESGVDPERVRGIGFDATCSLVVVSATNFEEIAVGPDFTNNDQNIILWMDHRAMKETEEIN 159

Query: 124 ATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVRSFS 183
           ++GDKCLKYVGG+MSVEME+PKIKWLKNNL  G+F +CKFFDL DYLT+KAT K+ RSF 
Sbjct: 160 SSGDKCLKYVGGQMSVEMEIPKIKWLKNNLEAGIFQDCKFFDLPDYLTFKATGKENRSFC 219

Query: 184 STVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSVGEY 243
           S VCKQG LP+GVEGSDIGWSKEF   I L EL+ ++F  +GGS+  ++   N  + GE 
Sbjct: 220 SAVCKQGFLPVGVEGSDIGWSKEFLNSIGLSELTKNDFERLGGSLREKK---NFLTAGEC 276

Query: 244 VGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEE-IGTINNDDDASSKLDSSI 302
           +  L + +A +LGL   C+V SGIIDAYAGWVGTVAAK E  +  +   ++     + +I
Sbjct: 277 ISPLDKKAACQLGLTEHCVVSSGIIDAYAGWVGTVAAKPESAVKGLAETENYKKDFNGAI 336

Query: 303 GNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTTHP 362
           G LA +AGTSTCHI LS  PIFV+G+WGPYRDVL+  FW AEGGQSCTG LL+H++TTHP
Sbjct: 337 GRLAAVAGTSTCHILLSKNPIFVHGVWGPYRDVLARGFWAAEGGQSCTGVLLDHLITTHP 396

Query: 363 AYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISDES 422
           A+ EL        V  FE+LN  L  L ++   RS+ISL KH F YGDYHGNRSPI+D +
Sbjct: 397 AFTELSHMANLAGVSKFEYLNKILETLVEKRKVRSVISLAKHLFFYGDYHGNRSPIADPN 456

Query: 423 MRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARNQL 482
           MRA IIGQSMD SI+ LA+MYLSACEFISQQ+RQII  ++K+GH I  I+MSGGQ RN L
Sbjct: 457 MRACIIGQSMDNSIEDLAVMYLSACEFISQQTRQIIEVMLKSGHEINAIFMSGGQCRNSL 516

Query: 483 LMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYN 521
           LMRLLADCTGLP+VIPRY+DA+V+FGSA+LGA A + ++
Sbjct: 517 LMRLLADCTGLPIVIPRYVDAAVVFGSALLGAAASEDFD 555

 Score = 80.9 bits (198), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 34/68 (50%), Positives = 46/68 (67%)

Query: 527 GNKNWDHGKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQID 586
           G   ++    LW  M +LT    ++NPN   HPDR+LL+ KY+IFLDM ETQRKYRR +D
Sbjct: 648 GEGRYNGTSFLWKVMQELTGNARIVNPNEKTHPDRILLDTKYQIFLDMIETQRKYRRMVD 707

Query: 587 EIEASFNE 594
           ++E SF+ 
Sbjct: 708 KVEGSFSR 715

>Suva_2.269 Chr2 complement(467973..470150) [2178 bp, 725 aa] {ON}
           YDR109C (REAL)
          Length = 725

 Score =  684 bits (1765), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/520 (61%), Positives = 406/520 (78%), Gaps = 4/520 (0%)

Query: 4   YIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNYVLQ 63
           ++GVDVGTGS RAC+I+  G+ILSL  K I +EE++ N+ITQSS+EIW  +C CV  VLQ
Sbjct: 44  HVGVDVGTGSTRACIIDQFGKILSLAEKPIKREEVRSNFITQSSKEIWDAVCHCVKAVLQ 103

Query: 64  ESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETDEIN 123
           ES++ P  V GIGFDATCSLVV+     + + VGP+F ++++NIILWMDHRA+KET+EIN
Sbjct: 104 ESEVDPKKVHGIGFDATCSLVVVSATDLKGIAVGPDFSNNDQNIILWMDHRAMKETEEIN 163

Query: 124 ATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVRSFS 183
           +TGDKCLKYVGG+MSVEM++PKIKWLKNNL   +F +CKFF+L DYLT+KAT K+ RSF+
Sbjct: 164 STGDKCLKYVGGQMSVEMDIPKIKWLKNNLEAEIFKDCKFFNLPDYLTFKATGKENRSFA 223

Query: 184 STVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSVGEY 243
           S VCKQG LP GVE S +GWS+EF   I L EL++++F  +GGS+  ++   N  S GE 
Sbjct: 224 SAVCKQGFLPAGVESSKLGWSEEFLNSIGLSELTTNDFERLGGSLRDKK---NFLSAGEC 280

Query: 244 VGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEE-IGTINNDDDASSKLDSSI 302
           VG L   SA ELGL   CIVGSGIIDAYAGWVGTVAAK    I  ++ ++   + ++S+I
Sbjct: 281 VGFLDVNSACELGLTQHCIVGSGIIDAYAGWVGTVAAKPSSAIPGLSENEHEKNDINSAI 340

Query: 303 GNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTTHP 362
           G LA +AGTSTCHI LS  PIFV+G+WGPYRDVL+ NFW AEGGQSCTGALL H++ THP
Sbjct: 341 GRLAAVAGTSTCHILLSKDPIFVHGVWGPYRDVLARNFWTAEGGQSCTGALLAHVIKTHP 400

Query: 363 AYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISDES 422
           A+ EL +  +  S+  FE+LN+ L  L ++ + RS++SL KHFF YGDYHGNRSPI+D +
Sbjct: 401 AFTELSQLADAASISIFEYLNSMLETLVQKRNERSVVSLAKHFFFYGDYHGNRSPIADPN 460

Query: 423 MRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARNQL 482
           MRA IIGQSMD S++ LA+ YL ACEFISQQ+RQII  +++ GH I  I+MSGGQ RN L
Sbjct: 461 MRACIIGQSMDNSVEDLAVTYLGACEFISQQTRQIIEAMLENGHRIDAIFMSGGQCRNGL 520

Query: 483 LMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNI 522
           LMRLLADCTGLP++IPRYIDA+V+FGSA+LGA A +A ++
Sbjct: 521 LMRLLADCTGLPIMIPRYIDAAVVFGSALLGAAASEASDL 560

 Score = 75.1 bits (183), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 40/58 (68%)

Query: 532 DHGKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEIE 589
           + G  LW  M +LT    V+NPN   HPDR+LL+ KY+IFLDMAE QRKYR  +D +E
Sbjct: 660 NSGDLLWKVMQELTGEAKVVNPNDKTHPDRILLDTKYQIFLDMAENQRKYRNMVDRVE 717

>Skud_4.370 Chr4 complement(645143..647287) [2145 bp, 714 aa] {ON}
           YDR109C (REAL)
          Length = 714

 Score =  683 bits (1763), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 318/520 (61%), Positives = 398/520 (76%), Gaps = 4/520 (0%)

Query: 4   YIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNYVLQ 63
           Y+GVDVGTGS RAC+I+  G +LSL  K I +EEL+PN+ITQSSREIW  +C CV  V+Q
Sbjct: 40  YVGVDVGTGSARACIIDQSGNMLSLAEKPIKREELRPNFITQSSREIWDAVCHCVKAVIQ 99

Query: 64  ESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETDEIN 123
           ES++ P  V G+GFDATCSLVV+     + V VGP+F  +++NIILWMDHRA+KET+EIN
Sbjct: 100 ESRVDPDRVHGMGFDATCSLVVVSATDAKGVAVGPDFTKNDQNIILWMDHRAMKETEEIN 159

Query: 124 ATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVRSFS 183
           ++ DKCLKYVGG+MSVEME+PKIKWLKNNL   +F +CKFFDL DYLT+KAT K+ RSFS
Sbjct: 160 SSEDKCLKYVGGQMSVEMEIPKIKWLKNNLRSELFQDCKFFDLPDYLTFKATGKENRSFS 219

Query: 184 STVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSVGEY 243
           S VCKQG LP GVEGS++GWS+EF   I L EL   +F  +GGS+  ++   N  S GE 
Sbjct: 220 SAVCKQGFLPAGVEGSNLGWSEEFLNTIGLSELIESDFEKLGGSLRHKK---NFLSAGEC 276

Query: 244 VGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEE-IGTINNDDDASSKLDSSI 302
           +G L   +A+ELGL   C+V SG+IDAYAGWVGTVAAK E  I  +  ++D +   + +I
Sbjct: 277 IGSLDWKAARELGLTENCVVSSGLIDAYAGWVGTVAAKPESPIRGLAENEDNTYNYNGAI 336

Query: 303 GNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTTHP 362
           G LA +AGTSTCHI LS  PIFV+GIWGPYRDVL+  FW AEGGQSCTG LL+H++  HP
Sbjct: 337 GRLAAVAGTSTCHILLSKDPIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVIKIHP 396

Query: 363 AYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISDES 422
           AY EL +      V  FE+LN+ L  + K+ + RS+ISL +H F YGDYHGNRSPI+D +
Sbjct: 397 AYTELSQLTNAAGVSKFEYLNSMLETMVKKRNERSVISLARHLFFYGDYHGNRSPIADSN 456

Query: 423 MRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARNQL 482
           MRA IIGQSMD S++ LAI YLSACEFISQQ+RQI+  ++K+GH I  I+MSGGQ RN L
Sbjct: 457 MRACIIGQSMDNSVEDLAITYLSACEFISQQTRQIVEVMLKSGHKIDAIFMSGGQCRNDL 516

Query: 483 LMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNI 522
           L RLLADC+GLP+VIPRYID +V+FGSA+LGA A +A+++
Sbjct: 517 LTRLLADCSGLPIVIPRYIDGAVVFGSALLGAAASEAFDL 556

 Score = 77.0 bits (188), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 31/58 (53%), Positives = 42/58 (72%)

Query: 537 LWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEIEASFNE 594
           LW  M +LT     +NPN   HPDR+LL+ KY+IFLDMAETQ++YR  +D +E SF++
Sbjct: 657 LWKVMQELTGDAKAVNPNKATHPDRILLDTKYQIFLDMAETQKRYRHMVDNLEESFSK 714

>Smik_4.355 Chr4 complement(634853..636967) [2115 bp, 704 aa] {ON}
           YDR109C (REAL)
          Length = 704

 Score =  677 bits (1748), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/520 (60%), Positives = 400/520 (76%), Gaps = 4/520 (0%)

Query: 4   YIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNYVLQ 63
           Y+GVDVGTGS RAC+I+  G ILSL  K I +EEL  N+ITQSSREIW  +C CV  V+Q
Sbjct: 31  YVGVDVGTGSTRACIIDKSGNILSLAEKPIKREELLSNFITQSSREIWNAVCYCVRKVIQ 90

Query: 64  ESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETDEIN 123
           E+ + P+ + GIGFDATCSLVV+     +E+ VGP+F ++++NIILWMDHRA+KET+EIN
Sbjct: 91  EAGVDPARIHGIGFDATCSLVVVSATDFKEIAVGPDFTNNDQNIILWMDHRAMKETEEIN 150

Query: 124 ATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVRSFS 183
            +G+ CLKYVGG+MSVEME+PKIKWLKNNL  G+F +CKFFDL DYLT++AT K+ RSFS
Sbjct: 151 FSGNTCLKYVGGQMSVEMEIPKIKWLKNNLESGIFQDCKFFDLPDYLTFRATGKENRSFS 210

Query: 184 STVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSVGEY 243
           S VCKQG LP GVEGS++GWSK+F   I L EL+ ++F  +GGS+ +++   N  S GE 
Sbjct: 211 SVVCKQGFLPEGVEGSNLGWSKQFLDSIGLSELTDNDFEKLGGSLRNQK---NFLSAGEC 267

Query: 244 VGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVE-EIGTINNDDDASSKLDSSI 302
           +G L   +A++LGL   C+V SGIIDAYAGWVGTVAAK E EI  +  ++D     + +I
Sbjct: 268 IGPLDGKAARQLGLTEYCVVSSGIIDAYAGWVGTVAAKPESEIKGLTENEDYKHDFNGAI 327

Query: 303 GNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTTHP 362
           G LA +AGTSTCHI LS   IFV+GIWGPYRDVL+  FW AEGGQSCTG LL+H++TTHP
Sbjct: 328 GRLAAVAGTSTCHILLSKSSIFVHGIWGPYRDVLARGFWAAEGGQSCTGVLLDHVITTHP 387

Query: 363 AYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISDES 422
           A+ +L +  +  +V  FE+LN+ L  L ++   RS+I L KH F YGDY GNRSPI+D +
Sbjct: 388 AFSKLSQLADAANVSKFEYLNSVLENLVEKRKERSVIFLAKHLFFYGDYRGNRSPIADPN 447

Query: 423 MRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARNQL 482
           MRA IIGQSMD SID LA++YL ACEFISQQ+RQII  ++K+GH I  ++MSGGQ RN L
Sbjct: 448 MRACIIGQSMDNSIDDLAVIYLGACEFISQQTRQIIEVMLKSGHAINAVFMSGGQCRNGL 507

Query: 483 LMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNI 522
           LMRLLADCTGLP+VIPRYID +V+FGSA+LGA A   +++
Sbjct: 508 LMRLLADCTGLPIVIPRYIDGAVVFGSALLGAAASKVFDL 547

 Score = 75.5 bits (184), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 32/58 (55%), Positives = 41/58 (70%)

Query: 537 LWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEIEASFNE 594
           LW  M +LT    VI PN   HPDR+LL+ KY+IFLDM ETQR YRR +D++E +F+ 
Sbjct: 647 LWKVMQELTGNAKVICPNTKTHPDRILLDTKYQIFLDMVETQRNYRRMVDKVEETFSR 704

>ZYRO0C01782g Chr3 (137232..139424) [2193 bp, 730 aa] {ON} similar
           to uniprot|Q04585 Saccharomyces cerevisiae YDR109C
           Hypothetical ORF
          Length = 730

 Score =  674 bits (1738), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/527 (59%), Positives = 398/527 (75%), Gaps = 3/527 (0%)

Query: 1   MNHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNY 60
           M +YIGVDVGTGS RAC+I+  G I+SL  K I +EELKP YITQSS+EIW  IC CV  
Sbjct: 31  MIYYIGVDVGTGSARACLIDSMGNIMSLAEKPIQREELKPTYITQSSKEIWSAICYCVKT 90

Query: 61  VLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETD 120
           V+++S +    + GIGFDATCSLV ++ +   +V VGP+FE+ ++NIILWMDHRAV+ET 
Sbjct: 91  VVRDSGVDIERIHGIGFDATCSLVAVNSKDGADVPVGPDFENPDQNIILWMDHRAVQETA 150

Query: 121 EINATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVR 180
           EIN+T    LKYVGG+MS+EME+PKIKWLKN++    F++  FFDL D+LTYKAT    R
Sbjct: 151 EINSTNHPVLKYVGGQMSIEMEIPKIKWLKNHMPREKFNDTVFFDLADFLTYKATGLGTR 210

Query: 181 SFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIH--SEQLENNIR 238
           SF+S+VCKQGLLPLGVEGS+ GWS EF   IDL EL +++F+ +GGS+    +   +N  
Sbjct: 211 SFNSSVCKQGLLPLGVEGSNNGWSGEFLNLIDLPELVANDFAKLGGSVKPKGDDHRSNFL 270

Query: 239 SVGEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKV-EEIGTINNDDDASSK 297
           S G+YVG LS  +A +LGL   C+VGSG+IDAYAGWVGTVAA+  EEI  +   +     
Sbjct: 271 SAGQYVGALSPEAAADLGLADHCVVGSGVIDAYAGWVGTVAAQTDEEIPELAKCEKGKLG 330

Query: 298 LDSSIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHI 357
           +D + G LA +AGTSTCH+ LS  PIFV G+WGPYRDV++  FWCAEGGQSCTGALL H+
Sbjct: 331 VDKATGRLAAVAGTSTCHVALSRDPIFVPGVWGPYRDVMAPGFWCAEGGQSCTGALLAHV 390

Query: 358 LTTHPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSP 417
           L+THPAY +L    E   +  F++LN+RL  L      RS+++L KH F YGDYHGNRSP
Sbjct: 391 LSTHPAYTDLEHLSESAGLSKFDYLNSRLEYLVNARKERSVVALAKHLFFYGDYHGNRSP 450

Query: 418 ISDESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQ 477
           I+D +MRAAIIGQSMD S+D LA+ YL ACEFI+QQ+RQI+  + K+GH I  I+MSGGQ
Sbjct: 451 IADNTMRAAIIGQSMDNSVDDLALQYLGACEFIAQQTRQIVEIMCKSGHNISSIFMSGGQ 510

Query: 478 ARNQLLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKH 524
            RN LLMRLLADCTGLP++IPRYIDA+V+FGSA+LGAVA ++YN  H
Sbjct: 511 CRNGLLMRLLADCTGLPIIIPRYIDAAVVFGSALLGAVASESYNAHH 557

 Score = 78.6 bits (192), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 38/67 (56%), Positives = 45/67 (67%), Gaps = 3/67 (4%)

Query: 526 DGNKNWDHGKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQI 585
           D N N   G+ LW  M  +T  G V+ PN   +PDRVLLNAKYKIFLDMA TQR+YR  I
Sbjct: 661 DTNSN---GEELWKVMYDMTGGGKVVRPNPDTNPDRVLLNAKYKIFLDMANTQRQYRSAI 717

Query: 586 DEIEASF 592
           D +EA+ 
Sbjct: 718 DRVEANL 724

>CAGL0B01727g Chr2 complement(159373..161106) [1734 bp, 577 aa] {ON}
           similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109c
          Length = 577

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 324/588 (55%), Positives = 421/588 (71%), Gaps = 17/588 (2%)

Query: 1   MNHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNY 60
           M +YIGVDVG+GSVRACV++D+G +LS+ ++DI+KEE  P ++TQSS EIW  +C CV  
Sbjct: 1   MGYYIGVDVGSGSVRACVVDDQGAMLSMATRDISKEEKLPGHVTQSSNEIWDAVCYCVKS 60

Query: 61  VLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETD 120
            +  S +    +LGIGFDATCSLVV++K++ + V  GPNF+++N+NII+WMDHRA++ET 
Sbjct: 61  AIGNSNVNNGDILGIGFDATCSLVVLNKDSFEPVAAGPNFDNNNQNIIMWMDHRAIEETK 120

Query: 121 EINATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVR 180
           EIN +GD CLKYVGG+MSVEME+PKIKWLKN++A   F    F DL DYLT+ A+  + R
Sbjct: 121 EINRSGDPCLKYVGGQMSVEMEIPKIKWLKNHMAPEEFKKLVFMDLPDYLTFMASGVNTR 180

Query: 181 SFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSV 240
           S+ S VCKQG LP GVEGS  GWS EF TKI L+E+S  NF+A+GG   S     N    
Sbjct: 181 SYCSAVCKQGFLPKGVEGSSKGWSTEFLTKIGLEEISQSNFNALGGPNES----GNFTYA 236

Query: 241 GEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSKLDS 300
           G  +  +SE   K   +   CIVGSGIIDAYAGW+GTVA+   E+   NN +     ++ 
Sbjct: 237 GNQLSTVSESFIKSTNINPGCIVGSGIIDAYAGWIGTVASSTIEVP--NNKEVVD--IEE 292

Query: 301 SIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTT 360
             G LA +AGTSTCHI LS   IFV G+WGPYRDVL  ++WCAEGGQS TGALL HIL+ 
Sbjct: 293 CAGRLAAVAGTSTCHIVLSKTSIFVPGVWGPYRDVLVPDYWCAEGGQSFTGALLAHILSI 352

Query: 361 HPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISD 420
           HP+  EL    ++ +V  F FLNN + EL ++N+  + + L K FFLYGDYHGNRSPI+D
Sbjct: 353 HPSANELSNLVKQRNVDKFSFLNNYILELSRKNNLETPLLLTKDFFLYGDYHGNRSPIAD 412

Query: 421 ESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARN 480
            +MRAAIIGQSMDTS+D LA  YL+ACEFI+ Q++ II  L+ AGHTIK IYMSGGQ RN
Sbjct: 413 PNMRAAIIGQSMDTSMDDLARTYLAACEFIAHQTKHIIDTLMNAGHTIKAIYMSGGQCRN 472

Query: 481 QLLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKHLDGNKNWDHGKT--LW 538
            +LM+L+A+CTGLP++IP+YID++V+FGSAILGA+A  +          N D G    LW
Sbjct: 473 NILMQLIANCTGLPLIIPKYIDSAVVFGSAILGAMAYSS-------SKNNSDKGGADLLW 525

Query: 539 NKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQID 586
           + M  +TP GT + P   +  +R L+N K+KIFLDMA+TQ+ YR+ ++
Sbjct: 526 STMSNMTPDGTTVFPATEDSIERKLINVKHKIFLDMAKTQQTYRQLVE 573

>KNAG0H03260 Chr8 (607908..609650) [1743 bp, 580 aa] {ON} Anc_8.257
           YDR109C
          Length = 580

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/587 (54%), Positives = 407/587 (69%), Gaps = 16/587 (2%)

Query: 2   NHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNYV 61
            +YIGVDVGTGS RA ++   G  L+L    I ++EL+ ++ITQSS EIW  +C CV  V
Sbjct: 5   GYYIGVDVGTGSARAVMLQHDGAALALEEHPIKRQELRVDFITQSSSEIWSAVCHCVRGV 64

Query: 62  LQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETDE 121
           + +S + P  V GIGFDATCSLV +D  T   V VGPNF+D  +NIILWMDHRA +ETD 
Sbjct: 65  VTKSGVNPRLVKGIGFDATCSLVAVDAVTGDAVPVGPNFDDSTQNIILWMDHRATRETDA 124

Query: 122 INATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVRS 181
           INATGD+CLKYVGG+MSVEMELPKIKWLK ++  G F+ CKFFDL DYLT+ AT KD RS
Sbjct: 125 INATGDRCLKYVGGQMSVEMELPKIKWLKGHMPRGQFTKCKFFDLPDYLTFMATAKDRRS 184

Query: 182 FSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSVG 241
           F S VCKQGLLP GV+GS+  WS EF   + L EL   NF  +GG+  S+       + G
Sbjct: 185 FCSAVCKQGLLPPGVDGSEGHWSPEFLEAVGLSELIDTNFVQLGGTSESKP---KFLTAG 241

Query: 242 EYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSKLDSS 301
           + VG L+  ++++ GL T+CIV SG+IDAYAGW+G+V AK ++          SS LD +
Sbjct: 242 QPVGQLTLEASEQFGLSTSCIVASGVIDAYAGWIGSVGAKFDQ-------SHKSSGLDVA 294

Query: 302 IGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTTH 361
           I  LA+IAGTSTCHI LS  P FV G+WGPYRDVL   +WCAEGGQSCTGALL HIL TH
Sbjct: 295 ITRLALIAGTSTCHIMLSKGPQFVPGVWGPYRDVLIPGYWCAEGGQSCTGALLAHILETH 354

Query: 362 PAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISDE 421
           PA+ EL     K  V  FE+L   L  L  +   R+++ L + FFLYGD+HGNRSP++D 
Sbjct: 355 PAHEELVRLAAKQQVSHFEYLGLMLDTLMMKRQVRNVLELSRSFFLYGDFHGNRSPLADP 414

Query: 422 SMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARNQ 481
           SMRA +IGQSMD SI+SLA+ YL+ACEFI+ Q+RQI+  +V+ GH ++ +YMSGGQ RN 
Sbjct: 415 SMRATVIGQSMDVSIESLAVEYLAACEFIALQTRQIVETMVRNGHVVECVYMSGGQCRNS 474

Query: 482 LLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKHLDGNKNWDHGKTLWNKM 541
           LLM+L+AD  G+PVV+P+Y D  V+FG+A+L   A      K  DG +  D    LW+ M
Sbjct: 475 LLMQLIADSVGVPVVLPKYTDCCVVFGAALLACCAS-----KGCDGIEA-DQSTRLWDIM 528

Query: 542 CKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEI 588
             +TP GT + PN  +  +R  ++AKY IFLDM E Q+ YR Q+D++
Sbjct: 529 TAMTPMGTRVLPNDDSSFERKYMDAKYGIFLDMIERQKLYRSQMDQV 575

>TPHA0B03240 Chr2 (743153..744910) [1758 bp, 585 aa] {ON} Anc_8.257
           YDR109C
          Length = 585

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/588 (53%), Positives = 421/588 (71%), Gaps = 5/588 (0%)

Query: 1   MNHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNY 60
           M++YIGVDVGTGS RAC+ N  GEIL++  KDI+K+EL+  +ITQSS EIW  I + +  
Sbjct: 1   MSNYIGVDVGTGSARACITNKNGEILAVEVKDISKQELQLGFITQSSNEIWDAILDIIKR 60

Query: 61  VLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETD 120
           V+  S + PSS+ GI FDATCSLVV DK + + + VGPNF+D N+NIILWMDHRA  ETD
Sbjct: 61  VIDISNVDPSSIDGIAFDATCSLVVFDKNSLEPIAVGPNFDDSNQNIILWMDHRAASETD 120

Query: 121 EINATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVR 180
            IN+T DK LKYVGGKMSVE ELPKIKWLK++L+   F  C F DL D+LTYKAT K V 
Sbjct: 121 LINSTNDKRLKYVGGKMSVEFELPKIKWLKDHLSPETFHRCVFLDLADFLTYKATGKIVH 180

Query: 181 SFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSV 240
           SFSS VCKQGLLP GVEGS +GWSKEF  KI L+ELS++NF  +GGSI+ +  E N    
Sbjct: 181 SFSSAVCKQGLLPTGVEGSKLGWSKEFLEKIGLEELSTNNFEKLGGSINLK--EGNFLIP 238

Query: 241 GEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSKLDS 300
           G+ VGH+ +  A    LP  C+VG+G+IDAY+GWVGTVA+ V +    ++     +K++ 
Sbjct: 239 GDLVGHVDKKFAGLANLPNHCVVGTGVIDAYSGWVGTVASDVSD-RVCSDSPQELNKIEG 297

Query: 301 SIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTT 360
           S+G +AV++GTSTCHI LS +P+F++G+WGPYRDVL+ N W  EGGQS TGALL++I+ T
Sbjct: 298 SLGRIAVVSGTSTCHIVLSKQPLFISGVWGPYRDVLAENMWATEGGQSFTGALLDNIIET 357

Query: 361 HPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISD 420
           HPAY EL     + +   F +L+ +L EL+      S+  L K+ F+YGDY+GNRSP++D
Sbjct: 358 HPAYQELERITSRQNKNIFVYLDEKLEELRVNRKLDSVFYLTKNMFIYGDYYGNRSPLAD 417

Query: 421 ESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARN 480
             M   IIGQ+MD+SI+ LAI YL+ACEFI+ Q+R II  LV  GH I  IYMSGG  +N
Sbjct: 418 PLMSGMIIGQTMDSSINDLAIKYLAACEFIALQTRHIIDTLVTHGHGITAIYMSGGHCKN 477

Query: 481 QLLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKHLDGNKNWDHGKTLWNK 540
           +LLM L+++C  LP+V+ +YID+SV+FG+AILG+VA    ++K  +    +     LW++
Sbjct: 478 KLLMELISNCCVLPLVLSKYIDSSVVFGAAILGSVAAKINSMK--ENKLEYSLNDVLWSQ 535

Query: 541 MCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEI 588
           M  +TP GT++ P +     R  L AKY+++LDM +T  KYR++++E+
Sbjct: 536 MKLMTPKGTLMMPKSEKSVLRKYLQAKYEVYLDMIDTNIKYRKKMEEV 583

>AGR092W Chr7 (908750..910540) [1791 bp, 596 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR109C and
           Non-syntenic homolog of Saccharomyces cerevisiae YNL249C
           (MPA43)
          Length = 596

 Score =  635 bits (1639), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/595 (51%), Positives = 405/595 (68%), Gaps = 16/595 (2%)

Query: 2   NHYIGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNYV 61
            +Y+GVDVGT   RAC+I+  G IL+     I++ + K ++ITQSS EIW  +C+ V   
Sbjct: 8   QYYVGVDVGTEFARACIIDKSGAILATTQNPISRSQPKHDHITQSSSEIWGAVCKSVRAA 67

Query: 62  LQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKETDE 121
           + ESQ+    V GI FDATCSLVV+D+++  EV VGP+F D+ +N+ILWMDHRAV E  E
Sbjct: 68  VAESQVAVDEVAGINFDATCSLVVLDEDSDGEVAVGPDFSDNRQNVILWMDHRAVAEASE 127

Query: 122 INATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKDVRS 181
           IN+TG   L+YVGGKMSVEM++PKIKWL+ ++  G F+ CKF+DL D+LTY+AT  + RS
Sbjct: 128 INSTGHSVLRYVGGKMSVEMQMPKIKWLQRHMPRGEFAKCKFYDLPDFLTYQATGIESRS 187

Query: 182 FSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSVG 241
           F STVCK GL+P GV+ S  GWS+EF  +I L+EL  D F  +GG++  ++  +  RS G
Sbjct: 188 FCSTVCKMGLVPNGVDSSTSGWSREFLEQIGLEELCEDGFRRLGGAL--DEPGSEFRSAG 245

Query: 242 EYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSKLDSS 301
           E VG LSE +A  LGL   C+VGSG+IDAYAGWVGTV       G   +    S  ++  
Sbjct: 246 EPVGLLSEAAAASLGLTPRCVVGSGVIDAYAGWVGTV-------GASPDGARESGGVEEL 298

Query: 302 IGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVLSHNFWCAEGGQSCTGALLEHILTTH 361
            G LA +AGTSTC I LS  P FV G+WGPYRDVL+  +WC EGGQSCTGALL H L TH
Sbjct: 299 AGRLAAVAGTSTCLIMLSQTPHFVEGVWGPYRDVLARGYWCTEGGQSCTGALLAHTLHTH 358

Query: 362 PAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNRSPISDE 421
           PAY ELH+  ++  +  F+++N RL +L+ E  ARSI +L KH FLYGDYHGNRSP++D 
Sbjct: 359 PAYTELHQAAQQRGLTDFDYINWRLDKLRAETGARSIRALAKHRFLYGDYHGNRSPLADP 418

Query: 422 SMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGGQARNQ 481
           SMRAA++G SMD S D LA+  L+A EFI+ Q+R I+  +  AG  +  +Y+SGGQARN 
Sbjct: 419 SMRAAMVGLSMDVSQDDLALAVLTAFEFIALQARHILDHMAAAGLHVDTVYLSGGQARNP 478

Query: 482 LLMRLLADCTGLPVVIPRYIDASVIFGSAILGAVAVDAYNIKH-------LDGNKNWDHG 534
           LL +LLAD    PVV PR++ A+V+FGSA+L A AV+ Y           L  + +    
Sbjct: 479 LLTQLLADAVRRPVVTPRHVGAAVVFGSALLAAAAVENYLANTNATASSILPSSASRAPM 538

Query: 535 KTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEIE 589
             LW  M +LT PG V++P+    PD  LL AKYK+FL+MAE Q+ YR+ +D++E
Sbjct: 539 HRLWQIMSRLTVPGNVVSPSPDADPDIRLLEAKYKVFLEMAEAQKLYRKLVDDVE 593

>Suva_14.93 Chr14 complement(174204..175835) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  216 bits (550), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 179/603 (29%), Positives = 283/603 (46%), Gaps = 94/603 (15%)

Query: 5   IGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSR--EIWQCICECVNYV- 61
           IG+D+G+ S R  + +   ++L   +     +E  P Y   S +  + WQ   E +  + 
Sbjct: 9   IGIDIGSSSARVGIYDYYNDVLLAMA-----QEPVPYYHDSSKKSWKFWQKSTEIIKALQ 63

Query: 62  --LQESQIIPSSVLGIGFDATCSLVVIDKE-TQQEVGVGPNFEDDNRNIILWMDHRAVKE 118
              QE +I   +V   G  ATCSL +  K+ T   +   PN ED   N+I WMD  AV E
Sbjct: 64  NCFQELKITQYNVRSCGVSATCSLAIFQKDLTNGNLIPYPN-ED---NVIFWMDSSAVDE 119

Query: 119 TDEINAT-GDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDK 177
            + +N     + L Y+GGK   EM +PK+K+  N  +         FDL  Y+ Y+    
Sbjct: 120 CEWLNEKCSQQLLDYLGGKFIPEMGIPKLKYFLNEHSHNQEKQFHIFDLHQYIAYELGRL 179

Query: 178 DVRSFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNI 237
              +      ++ +  +G +G   GWS  F+   D+ +L S+    + G           
Sbjct: 180 YRWNTDELSARENINGIGNDGEASGWSSSFYN--DIMKLPSNVTIGLTG----------- 226

Query: 238 RSVGEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSK 297
                    L+  ++       +CI      D+YA W    +  +E              
Sbjct: 227 ---------LNSNNSSSTTTVCSCI------DSYASWFAVSSPNLE-------------- 257

Query: 298 LDSSIGNLAVIAGTSTCHITLSSKPIF---VNGIWGPYRDVL--SHNFWCAEGGQSCTGA 352
                 +L +IAGTSTC++  S  P+    + G+WGP+  +L  + N+     GQSCTG 
Sbjct: 258 -----ASLFMIAGTSTCYMYGS--PVTTTKIPGVWGPFDTILETNGNYSVYTAGQSCTGK 310

Query: 353 LLEHILTTHPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYH 412
           L+EH+  +HPA  ++    E      +E L N + +++K+N  +SI  L KH F YGDY 
Sbjct: 311 LIEHLFKSHPAARKIQRSGED----IYEVLENSIQDIEKKNR-KSIHILAKHMFFYGDYE 365

Query: 413 GNRSPISDESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISEL--VKAGHTIKK 470
           GNR+P +D  MR + IG+S DTSI +L   Y+S  EF+S Q++ II       +G  I++
Sbjct: 366 GNRTPFADSQMRGSFIGESTDTSILNLTYKYVSMLEFLSFQTKLIIDTFQGQNSGARIEE 425

Query: 471 IYMSGGQARNQLLMRLLADCT-GLPVVIP-RYIDASVIFGSAILGAVAVDAYN----IKH 524
           + +SG QA+N  L+ L++    G+ +  P   ID   + G+ +LG  A +       I+ 
Sbjct: 426 LRVSGSQAKNGRLLSLISLVNDGIKIKRPNENIDLMGVMGAYMLGKSANEKKQIIDIIRE 485

Query: 525 LDGNKNWDHGKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQ 584
            D N + +          +  P GT    N      R LL+ KY+I LDMA+ Q++Y R 
Sbjct: 486 RDANADSE----------EFEPFGTYQLGNDCILLKR-LLSVKYRIHLDMAKQQQQYHRL 534

Query: 585 IDE 587
           +DE
Sbjct: 535 VDE 537

>Skud_14.89 Chr14 complement(168159..169868) [1710 bp, 569 aa] {ON}
           YNL249C (REAL)
          Length = 569

 Score =  211 bits (538), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 171/603 (28%), Positives = 285/603 (47%), Gaps = 82/603 (13%)

Query: 5   IGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQC------ICECV 58
           IG+DVG+ S R  + N + + L   +++         Y   SSR  W+       I + +
Sbjct: 34  IGIDVGSSSARVGIYNYENDALLGMAQEPVP------YYQDSSRTSWKFWQRSTEIIKAL 87

Query: 59  NYVLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKE 118
              LQ+ +I   +V   G  ATCSL + +K+ +    +    ED   N+I WMD  A+ E
Sbjct: 88  QKCLQKLKITEYNVKSCGVSATCSLAIFEKDKRNGSLIPYPNED---NVIFWMDSSAIDE 144

Query: 119 TDEINAT-GDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDK 177
             ++NA    + L ++GG    EM +PK+K+  N  +         FDL  Y+ Y+ +  
Sbjct: 145 CKQLNAECSQQLLDFLGGSFVPEMGIPKLKYFLNEYSHNQDKQFHIFDLHQYIAYELSHL 204

Query: 178 DVRSFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNI 237
              +    + ++    +GV+G   GWS  F+  I                     L +N+
Sbjct: 205 YQWNNEVLLKRENNKMVGVDGEASGWSPSFYENI-------------------MHLPSNV 245

Query: 238 RSVGEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSK 297
                 +G       K   + ++ IV S  ID+YA W    +  +E              
Sbjct: 246 -----IIGSNGATCKK---IASSAIVRS-CIDSYASWFAVSSPHLET------------- 283

Query: 298 LDSSIGNLAVIAGTSTCHITLSS-KPIFVNGIWGPYRDVLSHN--FWCAEGGQSCTGALL 354
                 +L +IAGTSTC++  +    I + G+WGP+  +L  N  F     GQSCTG L+
Sbjct: 284 ------SLFMIAGTSTCYMYGTPITDIKIPGVWGPFDSILDSNSHFSVYAAGQSCTGKLI 337

Query: 355 EHILTTHPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGN 414
           EH+  THP   E+     K     ++ L   + +++K+N  +S+    K  F YGDY GN
Sbjct: 338 EHLFVTHPCAKEI----LKRGADIYQVLERTIHDIEKQN-GQSVHVFTKDIFFYGDYEGN 392

Query: 415 RSPISDESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKA--GHTIKKIY 472
           R+P +D  M+ + IG++ DTSI +L   Y+   EF+S Q+R II    +   G  I+++ 
Sbjct: 393 RTPFADPRMKGSFIGETTDTSILNLIHKYICILEFLSFQTRLIIDTFKRQNIGMCIQELR 452

Query: 473 MSGGQARNQLLMRLLADC-TGLPVVIPR-YIDASVIFGSAILGAVAVDAYNIKHLDGNKN 530
           +SG QA+N+ L+ L++    G+ +  P+  +D   + G+ +L   A +   I  +D  + 
Sbjct: 453 ISGSQAKNKRLLSLISLVNNGITINKPKDNVDLMGVRGAYLLAKSANEGKQI--IDVIRE 510

Query: 531 WDHGKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEIEA 590
            D      N+  +  P   ++N +++    R LL AKY+I LDMA+ Q++Y + IDE+ +
Sbjct: 511 RDTSDD--NEKFEPLPEYQLLNDSSLL---RRLLWAKYRIHLDMAKQQQRYHKLIDEVFS 565

Query: 591 SFN 593
             N
Sbjct: 566 GTN 568

>TDEL0C05900 Chr3 (1062033..1063664) [1632 bp, 543 aa] {ON}
           Anc_1.111 YNL249C
          Length = 543

 Score =  204 bits (519), Expect = 9e-58,   Method: Compositional matrix adjust.
 Identities = 175/610 (28%), Positives = 283/610 (46%), Gaps = 104/610 (17%)

Query: 5   IGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNY--------ITQSSREIWQCICE 56
           IG+D+G+ SVR  +   + +++        K+++   Y         TQS+ EI + I  
Sbjct: 6   IGIDLGSSSVRVGLFTLEDDLMV----QCVKQKISYYYHGDSALWEYTQSTDEIMKVIER 61

Query: 57  CVNYVLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAV 116
           C    L + +I   ++   G  ATCS+ +  KE               +N+I WMD+ + 
Sbjct: 62  C----LHDLKIDEYNIKSCGVSATCSMALFIKEHNHLEPFNTISGSHRQNVIFWMDNSSK 117

Query: 117 KETDEINATGDKCLK-YVGGKMSVEMELPKIKWLKNNLA---DGVFSNCKFFDLVDYLTY 172
            E   +N   +K L+ ++GGK   EM +PKI  L N L    D    +    DL  YL Y
Sbjct: 118 TECKLLNNLCEKRLRDFMGGKFIPEMGIPKINRLINYLKSSDDLQNLSVVAMDLHRYLAY 177

Query: 173 KATDKDVRSFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQ 232
           +   +   +F   +       +G +G   GWS +F+    +D L   +   IG       
Sbjct: 178 EIAKRFKWNFDRLLNTTNFNEIGHDGELSGWSSKFY----IDTLKIPSNITIGP---EPP 230

Query: 233 LENNIRSVGEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDD 292
           LE++     EY            G+  +C      ID Y+ W+   +   EE        
Sbjct: 231 LEDDF----EYCK----------GIVASC------IDCYSSWLSLCSPTPEE-------- 262

Query: 293 DASSKLDSSIGNLAVIAGTSTCHITLSSKPIFVNGIWGPYRDVL--SHNFWCAEGGQSCT 350
                      +L ++ GTSTC++  +++   + G+WGP+ D+L  S+ +   EGGQSCT
Sbjct: 263 -----------SLFIVGGTSTCYLYATTRMKTIPGVWGPFTDILDNSNTYAVYEGGQSCT 311

Query: 351 GALLEHILTTHPA--------YPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLG 402
           G L+EH+L THPA        +P L E+ E+  + + E           E + RSI    
Sbjct: 312 GKLIEHLLQTHPASSSIAKDDWPLLLEKIEQE-ISAIE-----------EQTGRSIHFKT 359

Query: 403 KHFFLYGDYHGNRSPISDESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELV 462
           KH F YGD+ GNR+P +D  M    IG++ D S ++L + Y+   EF++ Q + +IS   
Sbjct: 360 KHMFFYGDFQGNRTPYADPEMSGMTIGETTDVSFNNLILRYICILEFLAFQIKYMISIFN 419

Query: 463 KA--GHTIKKIYMSGGQARNQLLMRLLADC-TGLPVVIPRY-IDASVIFGSAILGAVAVD 518
           KA     I +I + G QA+N+ L+ L++    G  + +P+  ++ S + G+ +LG  A+ 
Sbjct: 420 KAQGQDKITEIRICGSQAKNKRLLSLISLLHEGGTIKLPKTDVELSGVSGAFLLGKSAL- 478

Query: 519 AYNIKHLDGNKNWDHGKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQ 578
             N   LD  +  D  K +               P+++N P  +LL AKY+I LDMA+ Q
Sbjct: 479 -LNKSPLDLIQEKDDQKQV----------DIFETPSSINQPLSMLLEAKYEIHLDMAKQQ 527

Query: 579 RKYRRQIDEI 588
             YR  I++I
Sbjct: 528 LIYREMINKI 537

>ZYRO0F16016g Chr6 (1313995..1315623) [1629 bp, 542 aa] {ON} similar
           to uniprot|P53583 Saccharomyces cerevisiae YNL249C MPA43
           Mitochondrial protein
          Length = 542

 Score =  202 bits (513), Expect = 5e-57,   Method: Compositional matrix adjust.
 Identities = 168/605 (27%), Positives = 275/605 (45%), Gaps = 103/605 (17%)

Query: 5   IGVDVGTGSVRACVIN-DKGEILSLRSKDI----TKEELKPNYITQSSREIWQCICECVN 59
           IG+D+G+ SVR  + N    +I++ + K +    T E     Y TQSSREI   I +C  
Sbjct: 10  IGIDLGSSSVRVSLFNFQNDQIIAYKIKTVPYYFTPESTNWKY-TQSSREILTAIDQC-- 66

Query: 60  YVLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKET 119
              QE  I    +   G  ATCSL +   +T+    +  N +D ++N++ WMD  A+KET
Sbjct: 67  --FQELNIDKHEIKSCGVGATCSLAIF--QTKDNALIPWNLDDPDKNVVFWMDSIAIKET 122

Query: 120 DEINATGDKCLK-YVGGKMSVEMELPKIKW----LKNNLADGVFSNCKFFDLVDYLTYKA 174
            E+N      ++ ++GG    EM +PK++     LKN   +  F   +  DL  Y+    
Sbjct: 123 QEVNKLATPEVQAHMGGSFVPEMAVPKLRHFIDILKNTDNNSTF---EIIDLHRYIAMSL 179

Query: 175 TDKDVRSFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLE 234
             ++   +++      L  +G +G   GWS  F+  +    L       IG + HS+   
Sbjct: 180 AQQNGWDYTNVCNFPNLNEIGHDGELAGWSSAFYENV----LQLPPNIVIGPTKHSQH-- 233

Query: 235 NNIRSVGEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDA 294
                           S+K+ GL       S  ID Y+ W   + + ++           
Sbjct: 234 ----------------SSKQ-GLKV-----SSCIDCYSNWFALLPSNLQ----------- 260

Query: 295 SSKLDSSIGNLAVIAGTSTCHITLSSK-PIFVNGIWGPYRDVL--SHNFWCAEGGQSCTG 351
                    +L ++ GTSTC++  SS+    + G+WGP+ ++   S  F   E GQSCTG
Sbjct: 261 --------NSLFIVGGTSTCYLYASSEFSHHIPGVWGPFSNIFDRSDQFSIYEAGQSCTG 312

Query: 352 ALLEHILTTHPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDY 411
            L+EH+  THPA   +  +   H         N   E  ++N+  SI    KH F YGD 
Sbjct: 313 KLIEHLFKTHPASSHIDTRDWPHLFSQI----NDFIEKVEQNTQDSIHMQTKHMFFYGDL 368

Query: 412 HGNRSPISDESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIIS--ELVKAGHTIK 469
            GNR+P +D SM    IG++ DTS  +L   Y+S  EFI+ Q + +++    +     I 
Sbjct: 369 DGNRTPYADPSMSGMFIGETTDTSFRNLVYKYVSILEFIAFQIKHMLAIFNTLNGDEDIS 428

Query: 470 KIYMSGGQARNQLLMRLLADCTGLPVVIPRYIDASVI--FGSAILGAVAVDAYNIKHLDG 527
            +   G  A+N+ L+ LLA       +    +D +++  +GS ++G  +    +I  +  
Sbjct: 429 NLQFCGSLAKNKRLLNLLALLNPRLRIAMPEMDVALMGAYGSYLMGKASTSDKSIVEVAH 488

Query: 528 NKNWDHGKTLWNKMCKLTPP----GTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRR 583
           N+ + +            PP    G ++           LL  KY+I+ +MAE QRKYR+
Sbjct: 489 NQTYSY-----------RPPEKTDGLLVE----------LLEVKYQIYFNMAEQQRKYRK 527

Query: 584 QIDEI 588
           Q++ +
Sbjct: 528 QVNNV 532

>YNL249C Chr14 complement(179394..181022) [1629 bp, 542 aa] {ON}
           MPA43Putative protein of unknown function; the
           authentic, non-tagged protein is detected in highly
           purified mitochondria in high-throughput studies
          Length = 542

 Score =  197 bits (501), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 167/600 (27%), Positives = 280/600 (46%), Gaps = 86/600 (14%)

Query: 5   IGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQC------ICECV 58
           IG+DVG+ S R  V N   + L     ++ +E +   Y   SS++ W+       I + +
Sbjct: 9   IGIDVGSSSARIGVYNYYNDAL----LEMAQEPVP--YYQDSSKKSWKFWQKSTEIIKAL 62

Query: 59  NYVLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDHRAVKE 118
              LQ+  I    V   G  ATCSL + +++    + +    ED   N+I WMD  AV E
Sbjct: 63  QKCLQKLNIREYEVKSCGVSATCSLAIFERDRTSNMLIPYPNED---NVIFWMDSSAVNE 119

Query: 119 TDEINAT-GDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDK 177
              +N     + L Y+GGK   EM +PK+K+  +  +     +   FDL  Y+ Y+ +  
Sbjct: 120 CQWLNMQCPQQLLDYLGGKFVPEMGVPKLKYFLDEYSHLRDKHFHIFDLHQYIAYELSRL 179

Query: 178 DVRSFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNI 237
              +    + ++ L  +G +G   GWS  F+  I                     L +N+
Sbjct: 180 YEWNIEGLLGRENLNGIGNDGEVSGWSSSFYKNII-------------------NLPSNV 220

Query: 238 RSVGEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSK 297
                 +G  S ++ K +   +T +V S  ID+YA W                   AS  
Sbjct: 221 S-----IGTTSLVANKHI---STTVVRS-CIDSYASWFAV----------------ASPH 255

Query: 298 LDSSIGNLAVIAGTSTCHI---TLSSKPIFVNGIWGPYRDVLSH--NFWCAEGGQSCTGA 352
           L++S   L +IAGTS+C++   T+S   I   G+WGP+  +L +  +F     GQSCTG 
Sbjct: 256 LETS---LFMIAGTSSCYMYGTTISDTRI--PGVWGPFDTILDNRGDFSVYAAGQSCTGK 310

Query: 353 LLEHILTTHPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYH 412
           L+EH+  +HP       +  K     ++ L   + +++K N+  SI  L K  F YGDY 
Sbjct: 311 LIEHLFESHPC----ARKILKDGADIYQVLEQTIRDIEK-NNGLSIHILTKDMFFYGDYE 365

Query: 413 GNRSPISDESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHT--IKK 470
           GNR+P +D  ++ + IG+S DTS+ +L   Y+   EF+S Q++ II           IK+
Sbjct: 366 GNRTPFADPRIKGSFIGESTDTSMLNLTYKYICILEFLSFQTKLIIDTFQNENSNIHIKE 425

Query: 471 IYMSGGQARNQLLMRLLADC-TGLPVVIPRY-IDASVIFGSAILGAVAVDAYNIKHLDGN 528
           + +SG QA+N+ L+ L++    G+ ++ P+  +D   I G+ +L   A +   +  +   
Sbjct: 426 LRISGSQAKNERLLSLISLVNNGVAIIKPKENVDMMGIKGAYVLAKSAKEKKQLADVITE 485

Query: 529 KNWDHGKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEI 588
           ++  +    +  + +       I         R LL  KY I LDMA+ Q++Y + +DE+
Sbjct: 486 RDISNDSEKFESLAEYRLGNDSILL-------RKLLCVKYHIHLDMAKQQKRYHKLVDEV 538

>Smik_14.86 Chr14 complement(158487..160118) [1632 bp, 543 aa] {ON}
           YNL249C (REAL)
          Length = 543

 Score =  193 bits (491), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 171/609 (28%), Positives = 282/609 (46%), Gaps = 94/609 (15%)

Query: 5   IGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNY--ITQSSREIWQC---ICECVN 59
           IG+D+G+ S R  + +   + L   +     +E  P Y   T+ S + WQ    I E + 
Sbjct: 9   IGIDLGSSSARVGIYSYYNDALLGMA-----QEPVPYYQDFTKKSWKFWQKSTEIIEALQ 63

Query: 60  YVLQESQIIPSSVLGIGFDATCSLVVIDK-ETQQEVGVGPNFEDDNRNIILWMDHRAVKE 118
              Q+ +I   +V   G  ATCSL + ++  T + +   PN      N+I WMD  A  E
Sbjct: 64  KCFQKLKITEYNVKSCGVSATCSLAIFERVHTSEALIPYPN----ENNVIFWMDSSATDE 119

Query: 119 TDEINATGDK-CLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDK 177
            + +NA   K  L Y+GG+   EM +PK+K+  N  +         FDL  Y+ Y+    
Sbjct: 120 CEWLNAECSKQLLDYLGGRFVPEMGIPKLKYFLNEYSHRQDKRFHIFDLHQYIAYELGRL 179

Query: 178 DVRSFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNI 237
              +    +  + +  +G +G   GWS  F+  I                     + +N+
Sbjct: 180 YQWNIDGLLRGENINGIGNDGEASGWSSSFYKNI-------------------MNIPSNV 220

Query: 238 RSVGEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSK 297
                 +G +  +S K +   +T +V S  ID+YA W       +E              
Sbjct: 221 -----IIGPVGLVSKKVI---STTVVRS-CIDSYASWFAVSPPFLER------------- 258

Query: 298 LDSSIGNLAVIAGTSTCHITLSSKPIF---VNGIWGPYRDVLSH--NFWCAEGGQSCTGA 352
                 +L +IAGTS+C+  +   P+    + G+WGP+ ++L    +F     GQSCTG 
Sbjct: 259 ------SLFMIAGTSSCY--MYGTPVSNTKIPGVWGPFNNILDDKGDFSVYAAGQSCTGK 310

Query: 353 LLEHILTTHPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYH 412
           L+EH+  +HP       +  K     ++ L   +  ++K+    SI  L K  F YGDY 
Sbjct: 311 LIEHLFESHPC----ARKILKSGADIYQVLEQTIHGIEKKKGL-SIHILAKDMFFYGDYE 365

Query: 413 GNRSPISDESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISEL--VKAGHTIKK 470
           GNR+P +D  M+ + IG++ DTSI +L   Y+S  EF+S Q++ II      KA   I++
Sbjct: 366 GNRTPFADPRMKGSFIGETTDTSILNLTYKYISILEFLSFQTKLIIDTFQSQKACIRIQE 425

Query: 471 IYMSGGQARNQLLMRLLADC-TGLPVVIPR-YIDASVIFGSAILGAVAVDAYN----IKH 524
           + +SG QARN+ L+ L++    G+ +  PR  +D   I G+ IL   A +       I+ 
Sbjct: 426 LRISGSQARNERLLSLISLVNNGMSINRPRDNVDMMGIKGAYILAKSANEKKQLVDVIRE 485

Query: 525 LDGNKNWDHGKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQ 584
            D   + +  + L ++ C L    T++         + LL  KY+I LDMA+ Q+ Y + 
Sbjct: 486 RDVGDDNEKFQPL-SEYC-LGNDSTLL---------KNLLCVKYRIHLDMAKQQKYYYKL 534

Query: 585 IDEIEASFN 593
           +DE+ + F+
Sbjct: 535 VDEVISPFS 543

>Kwal_33.13530 s33 complement(268296..269900) [1605 bp, 534 aa] {ON}
           YNL249C (MPA43) - Overexpression leads to increased
           levels of the lyase PDC1 [contig 116] FULL
          Length = 534

 Score =  188 bits (477), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 172/603 (28%), Positives = 264/603 (43%), Gaps = 101/603 (16%)

Query: 5   IGVDVGTGSVRACVIN-DKGEILSLRSKDITKEELKPNYITQSSREIWQCICECVNYVLQ 63
           +G+D+G+  VR    N +  E +++ S+ +   E +    TQSS EI + I EC     +
Sbjct: 8   LGIDLGSTGVRVGAYNLETDEPIAVVSRTVNYYEQEKGRYTQSSAEIMRAIVEC----FE 63

Query: 64  ESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFED----DNRNIILWMDHRAVKET 119
              I   +V   G  ATCSL V  + + + +     +ED    +++N++ WMD  A++E 
Sbjct: 64  SLNIDIWAVQSCGVAATCSLAVFIRNSTKGLQPFGVYEDLRPLNDQNVVFWMDSNAIEEC 123

Query: 120 DEINATGDKCLKYVGGKMSVEMELPKIKWL-----KNNLADGVFSNCKFFDLVDYLTYKA 174
             IN        Y GG    EM +PK+        KNN      S+ + FDL  Y+ Y  
Sbjct: 124 SNINDLAINEKAYFGGSFIPEMGVPKLASFLKSCSKNN------SDFEVFDLHTYVAYDL 177

Query: 175 TDKDVRSFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLE 234
            ++     S  + +     +G +G   GW  EF+ K                   + +L 
Sbjct: 178 ANRYGWDASFLINRPNHNGIGHDGEIKGWKDEFYEK-------------------TLKLP 218

Query: 235 NNIRSVGEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDA 294
            N+R     +G L       +    + +  +  ID Y+ W    ++  E           
Sbjct: 219 PNVR-----IGPLC------INRRFSPVKVASCIDCYSSWFSMFSSTPER---------- 257

Query: 295 SSKLDSSIGNLAVIAGTSTCHITLSSKPI-FVNGIWGPYRDVLSHN---FWCA-EGGQSC 349
                    +L + AGTSTC++  ++KP   + GIWGP+ D+L       W   E GQS 
Sbjct: 258 ---------SLFMAAGTSTCYLYANNKPSECLPGIWGPFTDILDSKDPPSWSVYEAGQST 308

Query: 350 TGALLEHILTTHPAY-PELHEQCEKHSVGSFEFLNNRLA---ELQKENSARSIISLGKHF 405
           TG L+EH+  +HPA  P L ++           L NRL     L ++ SA S+    KH 
Sbjct: 309 TGKLIEHLFESHPAAKPYLEDR---------NVLFNRLETEINLIEQQSAESVHFKTKHM 359

Query: 406 FLYGDYHGNRSPISDESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAG 465
           F YG+  GNR+P  D  M    IG+S DTS   L + Y++  EF++ Q R I   L   G
Sbjct: 360 FNYGELQGNRTPYCDPEMSGMFIGESADTSFRDLTLKYVTVLEFLAFQVRHIKECL---G 416

Query: 466 HTIKKIYMSGGQARNQLLMRLLADCT-GLPVVIP-RYIDASVIFGSAILGAVAVDAYNIK 523
             I  I ++G QA+N  L+ L++    G  V IP    D   + G+ +LG       N+ 
Sbjct: 417 APINDIRVAGSQAKNNRLLSLISFVNHGSRVRIPATRADYVGVQGAYLLGKAKHLGLNVV 476

Query: 524 HLDGNKNWDHGKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRR 583
            L   +N             +      I  N  N   R L   KYKI+L+MA+TQR+YR 
Sbjct: 477 ELITQENGGES--------PMKDIEVRIEKNEENKL-RALFEIKYKIYLNMAQTQRQYRE 527

Query: 584 QID 586
            ++
Sbjct: 528 MVN 530

>KLTH0F03080g Chr6 complement(268621..270222) [1602 bp, 533 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43
          Length = 533

 Score =  185 bits (470), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 168/595 (28%), Positives = 275/595 (46%), Gaps = 83/595 (13%)

Query: 5   IGVDVGTGSVRACVINDKGE-ILSLRSKDITKEELKPNYITQSSREIWQCICECVNYVLQ 63
           +G+D+G+ +VR  + + K + ++ + +K +       N +TQSS +I   I  C+    Q
Sbjct: 11  LGIDLGSTAVRVGIYDLKTDKLIDIVAKPVPYTNHGGNRVTQSSTDIMSAIHGCI----Q 66

Query: 64  ESQIIPSSVLGIGFDATCSLVVI--DKETQQEVGVGPNFEDDNRNIILWMDHRAVKETDE 121
           +      SVL  G  ATCSL V   D E  + + +    ++   N++ WMD  A  E + 
Sbjct: 67  DLNPDLKSVLSCGVAATCSLAVFTQDIEDLKPLDIHGVKQEPCHNVVFWMDSSATLECEI 126

Query: 122 INATGDKCLKYVGGKMSVEMELPKIKWL-KNNLADGVFSNCKFFDLVDYLTYKATDKDVR 180
           +N T  +  +++GG    EM +PK+  + K   A+G     + FDL  Y+ Y+   K   
Sbjct: 127 VNKTAGRLKEFMGGSFVPEMGIPKLASIFKKPEAEG--HKLEVFDLHSYIAYELAIKYGW 184

Query: 181 SFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIRSV 240
             S  + K     +G +G   GW   F+   D+ +L ++      G IH+   E+ +R  
Sbjct: 185 DTSRIINKPNENRIGHDGELKGWDAGFYN--DVLKLPAN---VKIGPIHALNTESPVRVA 239

Query: 241 GEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSKLDS 300
                              +CI      D Y+ W    ++      + NN          
Sbjct: 240 -------------------SCI------DCYSNWFSMCSS------SPNN---------- 258

Query: 301 SIGNLAVIAGTSTCHITLSSK-PIFVNGIWGPYRDVL----SHNFWCAEGGQSCTGALLE 355
              +L + AGTSTC++  +++    + G+WGP+ ++L    +  +   E GQS TG L+E
Sbjct: 259 ---SLFMAAGTSTCYLYANTENKGCIPGVWGPFTNILDGSEAKEWSVYEAGQSTTGKLIE 315

Query: 356 HILTTHPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYGDYHGNR 415
           H+  THPA         K     F  + + + +L+ ++   S+    KH F YG+  GNR
Sbjct: 316 HLFETHPAARAYSMDKSK----LFSAIESAIEKLE-QDFGESVHFRSKHMFTYGELQGNR 370

Query: 416 SPISDESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSG 475
           +P  D SM    IG++ DTS   L + Y++  EF++ Q +  I E  KA   IK I ++G
Sbjct: 371 TPYCDSSMSGMFIGETTDTSFQDLVLKYVTILEFLAFQVKH-IKECFKA--EIKDIRIAG 427

Query: 476 GQARNQLLMRLLADCTG-LPVVIP-RYIDASVIFGSAILGAVAVDAYNIKHLDGNKNWDH 533
            QA+N  L+ L +     + V IP +  D   + G+ +LG  A    NI  L      D 
Sbjct: 428 SQAKNTRLLTLFSLVNDQITVKIPAQRTDYMGVEGAYLLGKAAHKNINIIDL-----IDK 482

Query: 534 GKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQIDEI 588
              L + + +L P    +     N   + LL AKYKI+LDMA+TQ +YR  +D +
Sbjct: 483 RDRLQSHILELGP----MKLGNHNTKLKQLLEAKYKIYLDMAQTQMRYRAMVDSV 533

>SAKL0C03432g Chr3 complement(325502..327145) [1644 bp, 547 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
          Length = 547

 Score =  182 bits (463), Expect = 6e-50,   Method: Compositional matrix adjust.
 Identities = 165/605 (27%), Positives = 275/605 (45%), Gaps = 90/605 (14%)

Query: 5   IGVDVGTGSVRACVIN-DKGEILSLRSKDITKEEL-KPNYITQSSREIWQCICECVNYVL 62
           +GVD+G+ SVR  + + +   +L +  + +           TQS+ EI   + EC    L
Sbjct: 13  VGVDLGSSSVRVGIYSLENDSLLHVVERPVRYYSCGSSGRFTQSTGEIMAALQEC----L 68

Query: 63  QESQIIPS--SVLGIGFDATCSLVVIDKETQQEVGVGPNFE----DDNRNIILWMDHRAV 116
            E  + P   S++  G  ATCS+ V   E         +        ++N++ WMD  A 
Sbjct: 69  DELGLRPGGRSIVSCGVAATCSMAVFTVEAGDGSLAPLDMSGLDGSSDKNVVFWMDSVAS 128

Query: 117 KETDEINATGDKCLKY-VGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKAT 175
           +  D ++      +K  + G    EM +PK+  L          + + FDL  Y+ Y   
Sbjct: 129 EACDALDKRVSTHVKAALCGGFIPEMGVPKLLHLVGQFPG---RSLEVFDLHKYIAYDLA 185

Query: 176 DK---DVRSFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQ 232
            +   D+ + ++     G+   G +G   GW +EF+  +                    +
Sbjct: 186 RRYGWDMAALANRPNSNGI---GHDGEVGGWPQEFYRNV-------------------LK 223

Query: 233 LENNIRSVGEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDD 292
           L   +      VG  S    + +G+  +CI      D YA W G  + + E+        
Sbjct: 224 LPATVA-----VGPASTFKGQRVGV-ASCI------DCYASWFGVCSTQPEQ-------- 263

Query: 293 DASSKLDSSIGNLAVIAGTSTCHITLSS-KPIFVNGIWGPYRDVL--SHNFWCA-EGGQS 348
                      +L ++AGTSTC++  S+     + G+WGP+ ++L      W   E GQS
Sbjct: 264 -----------SLFLVAGTSTCYLYASAASKTVLPGMWGPFTNLLDGEEARWSVYEAGQS 312

Query: 349 CTGALLEHILTTHPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLY 408
            TG LLEH+  THPA  +      +     F+ L +R+A+++  +S  SI  L +H FLY
Sbjct: 313 TTGRLLEHLFETHPAARDYAGDTGRL----FKDLEDRIADMEA-DSGCSIHHLARHMFLY 367

Query: 409 GDYHGNRSPISDESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISEL-VKAGHT 467
           G+  GNR+P +D  M    +G++ DTS  +LA+ Y+   EF++ Q+RQI+      A   
Sbjct: 368 GELQGNRTPYADPRMCGMFVGETTDTSFANLALKYVVVLEFLAFQTRQIVEGFRTGAAAA 427

Query: 468 IKKIYMSGGQARNQLLMRLLADCTG-LPVVIP-RYIDASVIFGSAILGAVAVDAYNIKHL 525
           I ++ ++G QARN+ L+ L++   G +PV +P R    + + G+ +LG       ++  L
Sbjct: 428 IGELRVAGSQARNRRLLSLMSLVNGNMPVRVPARAAPLAGVRGAYLLGKARY--LDVSLL 485

Query: 526 DGNKNWDHGKTLWNKMCKLTPPGTVINPNAVNHPDRVLLNAKYKIFLDMAETQRKYRRQI 585
           D  +    G T+     ++T         A     R LL AKY I LDMA+ Q++YR +I
Sbjct: 486 DVVRK--PGATI--PTVEVTESSNYPACGATKENLRRLLEAKYAIHLDMAQVQQRYRSEI 541

Query: 586 DEIEA 590
           D + A
Sbjct: 542 DAVIA 546

>KNAG0F00660 Chr6 complement(114441..116048) [1608 bp, 535 aa] {ON}
           Anc_1.111 YNL249C
          Length = 535

 Score =  171 bits (434), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 165/616 (26%), Positives = 275/616 (44%), Gaps = 124/616 (20%)

Query: 5   IGVDVGTGSVRACVIN-DKGEILSLRSKDITKEELKPNYI----------TQSSREIWQC 53
           IG+D+G+ SVR  + +     +L + SK +      P Y           TQ S EI   
Sbjct: 8   IGIDLGSSSVRVGIYSLHDDSLLGVFSKPV------PYYYESNRTSLWEYTQDSAEILTA 61

Query: 54  ICECVNYVLQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNRNIILWMDH 113
           I EC +     + +    V   G  ATCSLV+ ++          + E D+RN++ WMD 
Sbjct: 62  IKECFDM----ADLQKYDVKSCGVAATCSLVLCERSGDDTF---QHCEGDSRNVVFWMDS 114

Query: 114 RAVKETDEINATGDK-CLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKF--FDLVDYL 170
            A +ET+ +NA   +  L ++GG    EM +PK+     +++D    N ++  FDL  Y+
Sbjct: 115 MAKEETNSLNARCPQDILGHMGGGFIPEMGIPKLSRFLKSISDEPKGNIQWEVFDLHKYV 174

Query: 171 TYKATDK---DVRSFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGS 227
            YK   +   +    S+     G+   G +G   GWSK F+ KI                
Sbjct: 175 AYKLAQEYCWNTERLSNHPNSNGI---GHDGELAGWSKSFYDKI---------------- 215

Query: 228 IHSEQLENNIRSVGEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGT 287
               +L  N+      +G    I  ++     + ++    ID Y+ W   + +       
Sbjct: 216 ---VRLPPNVT-----IGCPKTIENED-----SLVIVDSCIDCYSSWFSPLQS------- 255

Query: 288 INNDDDASSKLDSSIGNLAVIAGTSTCHI----TLSSKPIFVNGIWGPYRDVLSHNFWCA 343
           +N +             L ++AGTSTC+I    T+ ++   V GIWGP+ D+L  N    
Sbjct: 256 LNKN------------TLFLVAGTSTCYIYSPGTMKTE-TSVKGIWGPFTDILGANKVVY 302

Query: 344 EGGQSCTGALLEHILTTHPAYPELHEQCEKHSVGSFEFLNNRLAE---LQKENSARSIIS 400
           E G SC+G L+EH+ T+HP+   L+      S G    L ++L E   + +  +A SI  
Sbjct: 303 ESGSSCSGKLIEHLFTSHPSAISLN-----LSTGQ---LISKLEEEINIWETQNATSIHF 354

Query: 401 LGKHFFLYGDYHGNRSPISDESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISE 460
              + FLYGD  GNR+P  D  MR   IG+S DTS   L + Y+   E ++ Q++ ++  
Sbjct: 355 EACNNFLYGDLDGNRTPFGDPYMRGMFIGESPDTSFRDLLVKYVCILECLAFQTKLMVDN 414

Query: 461 LVKAGHTIKKIYMSGGQARNQLLMRL--LADCTGLPVVIPRYIDASVIFGSAILGAVAVD 518
             K  ++I ++++ G QA+N  L++L  L +   L +V     D   + G+ +LG     
Sbjct: 415 FEKL-NSINELFICGSQAKNTRLLKLISLINDNALILVPKEKEDLMGVEGAYLLGKAGYL 473

Query: 519 AYNIKHLDGNKNWDHGKTLWNKMCKLTPPGTVINPNAVNHPDRV-------LLNAKYKIF 571
             ++                  +  ++ P   I+    N  D++       LL  KY I 
Sbjct: 474 GTSV-----------------DLVPVSEPREYISVKYTNDSDKIQQTKLYKLLLTKYIIH 516

Query: 572 LDMAETQRKYRRQIDE 587
           L+MAE Q+++R+ + +
Sbjct: 517 LEMAEQQQRFRKMVSK 532

>KLLA0C02937g Chr3 complement(265205..266755) [1551 bp, 516 aa] {ON}
           similar to uniprot|P53583 Saccharomyces cerevisiae
           YNL249C MPA43 Mitochondrial protein of unknown function
           and similar to uniprot|Q04585 Saccharomyces cerevisiae
           YDR109C Hypothetical ORF
          Length = 516

 Score =  127 bits (318), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 125/498 (25%), Positives = 216/498 (43%), Gaps = 83/498 (16%)

Query: 5   IGVDVGTGSVRACVINDKGEILSLRSKDITKEELKPNYITQSSREIWQC---ICECVNYV 61
           IGVD+G+   R  + +   + L   +K+      K  Y    +  I QC   I   V   
Sbjct: 6   IGVDLGSTEFRIGIFDYYTDSLVKETKE------KVPYFRHGNGIITQCTSDILTAVEKA 59

Query: 62  LQESQIIPSSVLGIGFDATCSLVVIDKETQQEVGVGPNFEDDNR--NIILWMDHRAVKET 119
                I   ++  +G  ATCS+VV  ++ +  +      + + R  +II WM   A++ET
Sbjct: 60  FNTLYIQEYNICSLGVGATCSMVVGKQKDENLIPFNLIHDKNGRYHDIIFWMHSAAIEET 119

Query: 120 DEIN-ATGDKCLKYVGGKMSVEMELPKIKWLKNNLADGVFSNCKFFDLVDYLTYKATDKD 178
           + +N  T +  L + GGK   EM +PK+  L     D         DL  +L +K + K 
Sbjct: 120 EYLNNITDESILCHFGGKFFPEMAIPKLLHLNKLYKD---DGLTVLDLHIWLLWKISLKL 176

Query: 179 VRSFSSTVCKQGLLPLGVEGSDIGWSKEFFTKIDLDELSSDNFSAIGGSIHSEQLENNIR 238
                  V +     +G +G   GWSKEF+  + L+++                      
Sbjct: 177 GHKELMPVQEPNSNGIGHDGELFGWSKEFYEHLQLNKI---------------------- 214

Query: 239 SVGEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGTVAAKVEEIGTINNDDDASSKL 298
               ++G+ + I   E         G   ID YA W    +               ++ L
Sbjct: 215 ----FIGNNAVIKKNEQ-------FGDSCIDCYASWFQCWS---------------TAML 248

Query: 299 DSSIGNLAVIAGTSTCHITLSS-KPIFVNGIWGPYRDVLSH--------NFWCAEGGQSC 349
           + +   L V+AGTSTC +  S     F+ GIWGP++D+L +        N+   E G S 
Sbjct: 249 NRT---LFVVAGTSTCFLYASDCFESFIPGIWGPFKDILVNRKHISKHDNYSVYEAGISR 305

Query: 350 TGALLEHILTTHPAYPELHEQCEKHSVGSFEFLNNRLAELQKENSARSIISLGKHFFLYG 409
           TG LLE +L+THPA        +   V   E + +++ +L +++  +SI  + K+ F + 
Sbjct: 306 TGVLLEKLLSTHPA-------VKDSDVNFLETVEHKI-DLIEQSDTQSIHLMIKNTFFHE 357

Query: 410 DYHGNRSPISDESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIK 469
           DY    S    +    +I+ +  + ++  LA+ Y+   E ++ Q   +I+   +   TI 
Sbjct: 358 DYEEFESSFVQKDTSGSILKEGYNPTLKDLALKYVVIIETLAFQIVDVINAFEEGHITIS 417

Query: 470 KIYMSGGQARNQLLMRLL 487
           K+ ++G QA+N  L+++L
Sbjct: 418 KLLITGSQAKNSRLLQIL 435

>NCAS0A00780 Chr1 complement(152317..153966) [1650 bp, 549 aa] {ON}
           Anc_1.111 YNL249C
          Length = 549

 Score = 79.3 bits (194), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 121/523 (23%), Positives = 205/523 (39%), Gaps = 104/523 (19%)

Query: 5   IGVDVGTGSVRACVIN-DKGEILSLRSKDITKEELKPNYITQSSREIWQ------CICEC 57
           IG+DVG+ SVR  + N + G  +    K I KE L   Y  +   ++W        + + 
Sbjct: 5   IGIDVGSTSVRIGIFNYEDGTTI----KTIVKEML---YKHEPDSKLWHYTQNAFVMRDS 57

Query: 58  VNYVLQESQIIPSSVLGIGFDATCSLVVIDKETQ----QEVGVGPNFEDDNRNIILWMDH 113
           +   L+E  +    V   G  ATCS+V + +++     + + +     ++  +II W DH
Sbjct: 58  IFTALEELHVNSYIVKICGVSATCSMVFLQRDSPADHLRPLTIIHEETNNTDSIIFWKDH 117

Query: 114 RAVKETDEIN-----------ATGDKCLKYVGGKMSV--EMELPKIKWLKNNLADGVFSN 160
            A  E   +N              +K L  +G +     EM +PK+  L N + +G +  
Sbjct: 118 TAQPEAQRLNNKLRTANEGLSGKENKILSTLGSRSGFIGEMAIPKLSRLINLIKEGFYET 177

Query: 161 CKFFDLVDYLTYKATDKDVRSFSSTV---CKQGLLPLGVEGSDIGWSKEFFTKIDLDELS 217
               ++ D   Y A     +   +TV    K  +  +G++G   GW   F+       L 
Sbjct: 178 PHILEVYDLHVYIAQTLAQKYDWNTVHLQNKPNVNGIGIDGELQGWDLSFYVW----ALP 233

Query: 218 SDNFSAIGGSIHSEQLENNIRSVGEYVGHLSEISAKELGLPTTCIVGSGIIDAYAGWVGT 277
             +F                      +G    I+   +  P +C      ID YA W  T
Sbjct: 234 ETSFPIC-------------------IGPSKVINETSIVRPKSC------IDCYASWFST 268

Query: 278 VAAKVEEIGTINNDDDASSKLDSSIGNLAVIAGTSTCHITLSSKPIF---------VNGI 328
                          DA +K D+    L + AGTSTC +    +            ++  
Sbjct: 269 ---------------DACTKDDT----LFMAAGTSTCCLYAMPRSALEYFGEQQQPLSLF 309

Query: 329 WGPYRDVLSHNFWCA-EGGQSCTGALLEHILTTHPAYPELHEQCEKHSVG-SFEFLNNRL 386
           WGP+ +VL  +   + E G S TG LLE +          H+     SV  S  ++ N++
Sbjct: 310 WGPFTNVLDKDKKSSFEIGFSETGILLEKLFNK-------HQITASWSVAESINYVENQI 362

Query: 387 AELQKENSARSIISLGKHFFLYGDYHG-NRSPISDESMRAAIIGQSMDT-SIDSLAIMYL 444
           A  +++ S    I L    +L+  Y   N+    D      + G    T S   L   Y+
Sbjct: 363 AIYERKKSHS--IYLEPEIYLFLKYLTLNKPSGRDTPDTPDLFGNDGVTDSTLGLIFKYI 420

Query: 445 SACEFISQQSRQIISELVKAGHTIKKIYMSGGQARNQLLMRLL 487
           +  E+++ Q   +I +  K    I  + +SG QA+N+ L+ L+
Sbjct: 421 AILEYLAYQVSNLILQFQKEKIIINHLVLSGSQAQNKRLLDLI 463

>Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON}
           complement(1..1272) [1272 nt, 424 aa]
          Length = 424

 Score = 34.3 bits (77), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 45/87 (51%), Gaps = 8/87 (9%)

Query: 208 FTKIDLDELSSDNFSAIGGSIHSEQLENNIRSVGEYVGHLSEISAKELGLPTTCIVGSGI 267
           + KI+ + L S N   +   + S  LE  IR++  YV    ++  +EL +P +  V    
Sbjct: 224 YRKINFNNLLSCN---VSNGLLSNILE--IRNLNRYVNDHLDLIKRELIIPYSDFVKKIC 278

Query: 268 IDAYAGWVGTVAAKVEEI---GTINND 291
           IDAYAG +  +  ++E +   G INN+
Sbjct: 279 IDAYAGGMTKLNDELESLLLTGEINNE 305

>TPHA0E01750 Chr5 (353257..354636) [1380 bp, 459 aa] {ON} Anc_5.436
          Length = 459

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 32/135 (23%), Positives = 59/135 (43%), Gaps = 17/135 (12%)

Query: 417 PISDESMRAAIIGQSMDTSIDSLAIMYLSACEFISQQSRQIISELVKAGHTIKKIYMSGG 476
           P+SDE     IIG   D  I+SL++      E+I+  SR   S+    GH  K ++    
Sbjct: 241 PLSDEESETEIIGNISDEVINSLSL----KSEYIT-DSRFYTSKFPSGGHLFKLVHQHVL 295

Query: 477 QARNQLLMRLLADCTGLPVVIPRYID-------ASVIFGSAILGAVAVDAYN-IKHLDGN 528
              N +   +  + + + +   ++I        +S IF     G V V   +   +L+  
Sbjct: 296 NETNSISNEIKKNISNINMSFEKHISTLNDQITSSFIFD----GHVGVPLQSTFANLNSG 351

Query: 529 KNWDHGKTLWNKMCK 543
           + WD+ K ++  +C+
Sbjct: 352 EFWDNEKEIFKTLCQ 366

>Kpol_1033.24 s1033 complement(49973..58081,58083..64721) [14748 bp,
           4915 aa] {ON} complement(49973..58081,58083..64721)
           [14748 nt, 4916 aa]
          Length = 4915

 Score = 33.5 bits (75), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 25/85 (29%), Positives = 40/85 (47%), Gaps = 15/85 (17%)

Query: 520 YNIKHLDGNKN-WDHGKTLWNKMCKLT-----------PPGTVINPNAVNHPDRVLLNAK 567
           Y + H   NKN W +   LWN+  KL+             GT      +N+ +++LL+AK
Sbjct: 723 YKMLHKCFNKNQWKNVVRLWNEAYKLSQQILKIDDEVAEEGTKTKKRKLNNNEKILLSAK 782

Query: 568 YKIFLDMAETQRKYRRQIDEIEASF 592
           +  F DM    +K+  Q + +  SF
Sbjct: 783 WDEFQDMV---KKFEAQSNTLNNSF 804

>Kpol_1046.5 s1046 complement(6779..9763) [2985 bp, 994 aa] {ON}
           complement(6779..9763) [2985 nt, 995 aa]
          Length = 994

 Score = 32.0 bits (71), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 24/85 (28%), Positives = 40/85 (47%), Gaps = 10/85 (11%)

Query: 387 AELQKENSARSIISLGKHFFLYGDYHGNRSPIS--DESMRAAIIGQSMDTS--------I 436
           +EL K N  + II + KH F+  + +GN + I+  D   R A       T          
Sbjct: 266 SELVKVNDGKKIIVVSKHLFVISETNGNETIINEIDIVKRHAFAKDLKSTEKLISSFQYK 325

Query: 437 DSLAIMYLSACEFISQQSRQIISEL 461
           D+L ++  +  EF   +S ++I+EL
Sbjct: 326 DTLTLVKENKIEFYKPKSSELITEL 350

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.135    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 64,952,296
Number of extensions: 2891373
Number of successful extensions: 7492
Number of sequences better than 10.0: 41
Number of HSP's gapped: 7557
Number of HSP's successfully gapped: 59
Length of query: 594
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 479
Effective length of database: 40,294,809
Effective search space: 19301213511
Effective search space used: 19301213511
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)