Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_392.88.259ON1427142765730.0
Suva_10.1708.259ON1416143835510.0
YLR086W (SMC4)8.259ON1418143135290.0
TDEL0F038608.259ON1399143835020.0
Skud_12.1548.259ON1417144034990.0
KAFR0B027108.259ON1416144434700.0
Smik_12.1458.259ON1418143434650.0
NCAS0B050008.259ON1409142834550.0
TPHA0J007208.259ON1393139134390.0
SAKL0H17094g8.259ON1422141133850.0
ZYRO0C01716g8.259ON1413139033040.0
NDAI0B019708.259ON1415143633020.0
Kwal_56.238258.259ON1396138532850.0
KNAG0G020208.259ON1444138732730.0
AGR089C8.259ON1370138431920.0
KLTH0G13750g8.259ON1399138431740.0
TBLA0E044108.259ON1422145031580.0
Ecym_43118.259ON1376138331570.0
KLLA0F19085g8.259ON1372140629810.0
CAGL0L12188g8.259ON1398138728880.0
NDAI0G033208.68ON12317844494e-44
Kwal_23.50438.68ON12252183752e-35
KNAG0G009108.68ON12262733601e-33
TPHA0P003408.68ON12192133601e-33
Smik_6.718.68ON12282343583e-33
Skud_6.648.68ON12301723564e-33
KLTH0A02706g8.68ON12282193556e-33
KAFR0C032008.68ON12231643521e-32
SAKL0B02288g8.68ON12281693512e-32
Kpol_1011.58.68ON12211843432e-31
KLLA0D07502g8.68ON12432023379e-31
TBLA0G035308.68ON12321763352e-30
Ecym_73038.68ON12222223332e-30
CAGL0F02079g8.68ON12232123261e-29
TDEL0C009608.68ON12221753262e-29
ZYRO0F03828g8.68ON12171643233e-29
KAFR0G029307.186ON11701592545e-21
TDEL0H026107.186ON11701602501e-20
NDAI0G020707.186ON11711602492e-20
ZYRO0D15642g7.186ON11701592473e-20
AGR236W7.186ON11701592456e-20
CAGL0D05258g7.186ON11701592431e-19
NCAS0E019207.186ON11701592411e-19
YFR031C (SMC2)7.186ON11701592402e-19
Suva_6.1047.186ON11701592393e-19
KNAG0L011607.186ON11701592393e-19
Skud_6.1197.186ON11701612384e-19
TBLA0D046107.186ON11741582357e-19
Suva_6.528.68ON12641762367e-19
Smik_7.3467.186ON11701592357e-19
Ecym_43907.186ON11701612359e-19
SAKL0F07282g7.186ON11701592341e-18
KLTH0E04774g7.186ON11701592332e-18
Kwal_55.204217.186ON11701592322e-18
Kpol_1063.207.186ON11711592303e-18
KLTH0H09966g1.295ON12242542294e-18
TPHA0C044407.186ON11701622285e-18
KLLA0D16005g7.186ON11701602268e-18
Kwal_14.24351.295ON12472352214e-17
AGL023W8.68ON12221602205e-17
KAFR0A016101.295ON12272272162e-16
NCAS0C040008.68ON12231632124e-16
Kpol_1018.21.295ON12112242099e-16
SAKL0D06116g1.295ON12291142072e-15
ZYRO0G21296g1.295ON12271062072e-15
AAL182W1.295ON12312622018e-15
Ecym_63221.295ON12322472018e-15
TDEL0D016201.295ON12232531991e-14
NCAS0A093301.295ON12271251982e-14
KNAG0B052301.295ON12252301982e-14
TPHA0I010901.295ON12161891921e-13
NDAI0G056301.295ON12291051911e-13
Suva_6.1491.295ON12302291901e-13
TBLA0C027401.295ON11191551902e-13
Smik_10.1671.295ON12291041892e-13
YJL074C (SMC3)1.295ON1230991856e-13
Skud_10.1701.295ON1230991776e-12
KLLA0A00286g1.295ON1224971695e-11
CAGL0H02805g1.295ON12191641543e-09
YFL008W (SMC1)8.68ON12251331321e-06
KNAG0L006307.101ON11081591302e-06
KLTH0D02816g7.101ON10941631202e-05
SAKL0B09526g7.101ON10991611177e-05
KLLA0F07997g7.101ON11191691132e-04
Skud_15.1217.101ON10931631122e-04
Kwal_26.72047.101ON11171661123e-04
TDEL0E013404.237ON1106851104e-04
TBLA0E021907.101ON10891911087e-04
ZYRO0G01584g7.101ON10881611088e-04
KAFR0D013307.101ON10801591030.002
ZYRO0B12122g4.237ON1109781020.003
YOL034W (SMC5)7.101ON10931631020.004
NDAI0J021804.237ON1108160990.008
CAGL0F01155g7.101ON1105173990.009
Suva_15.1337.101ON1092160990.009
CAGL0H05071g4.237ON111065970.013
TPHA0L006007.101ON1117163970.014
NCAS0I005707.101ON1095173970.014
NCAS0J013904.237ON109668970.015
TPHA0B008404.237ON111968960.016
NDAI0A084507.101ON111962960.020
Skud_12.4684.237ON112068960.020
Smik_12.4704.237ON111468960.020
YLR383W (SMC6)4.237ON111468950.021
Suva_10.5004.237ON111568950.021
Smik_15.1317.101ON1093157950.023
Kpol_1044.137.101ON110362950.026
KNAG0B060104.237ON111768940.028
TDEL0H034907.101ON110364930.040
TBLA0A053001.67ON70763930.042
KLLA0E05303g4.237ON109892920.048
Ecym_26257.101ON1097120910.078
KLTH0D14080g4.237ON1102312900.083
TBLA0I028904.237ON109871900.094
Kpol_483.104.237ON111883890.13
AEL337C7.101ON1097165860.25
SAKL0H03322g4.237ON111152860.28
Kwal_26.93804.237ON110285850.34
TDEL0G028102.351ON109471850.37
Ecym_53444.237ON110274850.38
NCAS0B087001.67ON71572840.40
KAFR0A060404.237ON110268820.69
AER044W4.237ON110352782.1
AFR683C1.67ON677110772.5
NCAS0E019307.185ON104748763.7
Ecym_10721.67ON68397764.2
AER045C4.238ON1292119755.6
YNL250W (RAD50)1.110ON131292755.8
ZYRO0G14674g8.191ON42461745.8
Ecym_10761.71ON22774735.8
ACR068W5.267ON1805112755.9
TPHA0A015508.325ON41187736.4
ZYRO0F17050g1.67ON71470737.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_392.8
         (1427 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}...  2536   0.0  
Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR08...  1372   0.0  
YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subu...  1363   0.0  
TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8....  1353   0.0  
Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR08...  1352   0.0  
KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8....  1341   0.0  
Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR08...  1339   0.0  
NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8....  1335   0.0  
TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8...  1329   0.0  
SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa...  1308   0.0  
ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] ...  1277   0.0  
NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8....  1276   0.0  
Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] ...  1269   0.0  
KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8....  1265   0.0  
AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON} ...  1234   0.0  
KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa...  1227   0.0  
TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_...  1221   0.0  
Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON...  1220   0.0  
KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} sim...  1152   0.0  
CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} si...  1117   0.0  
NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON}             177   4e-44
Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008...   149   2e-35
KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8....   143   1e-33
TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.6...   143   1e-33
Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W ...   142   3e-33
Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W ...   141   4e-33
KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] ...   141   6e-33
KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8....   140   1e-32
SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} simil...   139   2e-32
Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {O...   136   2e-31
KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] ...   134   9e-31
TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {...   133   2e-30
Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar ...   132   2e-30
CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} simil...   130   1e-29
TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8....   130   2e-29
ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} simil...   129   3e-29
KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {...   102   5e-21
TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7....   100   1e-20
NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7....   100   2e-20
ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa...   100   3e-20
AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic...    99   6e-20
CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} simil...    98   1e-19
NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7....    97   1e-19
YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON} ...    97   2e-19
Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {O...    97   3e-19
KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa] ...    97   3e-19
Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {O...    96   4e-19
TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]...    95   7e-19
Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W (R...    96   7e-19
Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {O...    95   7e-19
Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar ...    95   9e-19
SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa] ...    95   1e-18
KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} simil...    94   2e-18
Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR03...    94   2e-18
Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON} (46233...    93   3e-18
KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] ...    93   4e-18
TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {...    92   5e-18
KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa...    92   8e-18
Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {...    90   4e-17
AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic h...    89   5e-17
KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {...    88   2e-16
NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8....    86   4e-16
Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}...    85   9e-16
SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] ...    84   2e-15
ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} sim...    84   2e-15
AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic hom...    82   8e-15
Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar ...    82   8e-15
TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {...    81   1e-14
NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_...    81   2e-14
KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa]...    81   2e-14
TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {...    79   1e-13
NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa]...    78   1e-13
Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C...    78   1e-13
TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1....    78   2e-13
Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] ...    77   2e-13
YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}...    76   6e-13
Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL07...    73   6e-12
KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {O...    70   5e-11
CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa] ...    64   3e-09
YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subun...    55   1e-06
KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {O...    55   2e-06
KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa] ...    51   2e-05
SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} simil...    50   7e-05
KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa] ...    48   2e-04
Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL03...    48   2e-04
Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {...    48   3e-04
TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {...    47   4e-04
TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {...    46   7e-04
ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} simil...    46   8e-04
KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {...    44   0.002
ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} simil...    44   0.003
YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}  SMC5Comp...    44   0.004
NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4...    43   0.008
CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa] ...    43   0.009
Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL03...    43   0.009
CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} simil...    42   0.013
TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa] ...    42   0.014
NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON...    42   0.014
NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4...    42   0.015
TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {...    42   0.016
NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_...    42   0.020
Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR38...    42   0.020
Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR38...    42   0.020
YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Comp...    41   0.021
Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR38...    41   0.021
Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL03...    41   0.023
Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {...    41   0.026
KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_...    41   0.028
TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7....    40   0.040
TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1...    40   0.042
KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] ...    40   0.048
Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} simila...    40   0.078
KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} sim...    39   0.083
TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4....    39   0.094
Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON} (21646.....    39   0.13 
AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON} Sy...    38   0.25 
SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] ...    38   0.28 
Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR3...    37   0.34 
TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2....    37   0.37 
Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar ...    37   0.38 
NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1...    37   0.40 
KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa]...    36   0.69 
AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic h...    35   2.1  
AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}...    34   2.5  
NCAS0E01930 Chr5 complement(372023..375166) [3144 bp, 1047 aa] {...    34   3.7  
Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar t...    34   4.2  
AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON} ...    33   5.6  
YNL250W Chr14 (175410..179348) [3939 bp, 1312 aa] {ON}  RAD50Sub...    33   5.8  
ZYRO0G14674g Chr7 (1176171..1177445) [1275 bp, 424 aa] {ON} simi...    33   5.8  
Ecym_1076 Chr1 (147216..147420,147509..147987) [684 bp, 227 aa] ...    33   5.8  
ACR068W Chr3 (480141..485558) [5418 bp, 1805 aa] {ON} Syntenic h...    33   5.9  
TPHA0A01550 Chr1 (310086..311321) [1236 bp, 411 aa] {ON} Anc_8.3...    33   6.4  
ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa]...    33   7.4  

>Kpol_392.8 s392 complement(19392..23675) [4284 bp, 1427 aa] {ON}
            complement(19392..23675) [4284 nt, 1428 aa]
          Length = 1427

 Score = 2536 bits (6573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1287/1427 (90%), Positives = 1287/1427 (90%)

Query: 1    MPKTPLSKRPKLVEANLNANELDHNDDDQRYNRQEIKVSPTTQDAAAVSHLNFKSQTPKK 60
            MPKTPLSKRPKLVEANLNANELDHNDDDQRYNRQEIKVSPTTQDAAAVSHLNFKSQTPKK
Sbjct: 1    MPKTPLSKRPKLVEANLNANELDHNDDDQRYNRQEIKVSPTTQDAAAVSHLNFKSQTPKK 60

Query: 61   LILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESSSRGRTARTYXXXXXXXXXXXXXXXX 120
            LILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESSSRGRTARTY                
Sbjct: 61   LILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESSSRGRTARTYSQSPPRSPARSPARSP 120

Query: 121  TRKLELIQLSPVKNSRIALQKIYESKNEKQIERLCIDKLVLHDFKSYAGTQVVGPFHSSF 180
            TRKLELIQLSPVKNSRIALQKIYESKNEKQIERLCIDKLVLHDFKSYAGTQVVGPFHSSF
Sbjct: 121  TRKLELIQLSPVKNSRIALQKIYESKNEKQIERLCIDKLVLHDFKSYAGTQVVGPFHSSF 180

Query: 181  SAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKSCSVEVHFEYVI 240
            SAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKSCSVEVHFEYVI
Sbjct: 181  SAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKSCSVEVHFEYVI 240

Query: 241  DKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDHNRFLI 300
            DKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDHNRFLI
Sbjct: 241  DKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDHNRFLI 300

Query: 301  LQGEVENIAQMKPKAENXXXXXXXXXXXXIIGTAKYKPLIEKKFEEIEALNEICIEKENR 360
            LQGEVENIAQMKPKAEN            IIGTAKYKPLIEKKFEEIEALNEICIEKENR
Sbjct: 301  LQGEVENIAQMKPKAENDGDDGLLEYLEDIIGTAKYKPLIEKKFEEIEALNEICIEKENR 360

Query: 361  FEIVDREKASLESGXXXXXXXXXXXXXXXXXXXXXYQYKLWQDNKKLSTTLEKLSNIKEE 420
            FEIVDREKASLESG                     YQYKLWQDNKKLSTTLEKLSNIKEE
Sbjct: 361  FEIVDREKASLESGKDEALEFLEKEKELTLVKSKLYQYKLWQDNKKLSTTLEKLSNIKEE 420

Query: 421  FEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTERVSLEEQRKNI 480
            FEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTERVSLEEQRKNI
Sbjct: 421  FEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTERVSLEEQRKNI 480

Query: 481  XXXXXXXXXXLEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIERGLLEEIKISL 540
                      LEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIERGLLEEIKISL
Sbjct: 481  MKKKKKMEKELEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIERGLLEEIKISL 540

Query: 541  KDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLENDIENLNSLX 600
            KDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLENDIENLNSL 
Sbjct: 541  KDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLENDIENLNSLI 600

Query: 601  XXXXXXXXXXXXXXXXLRNELNRITKEVSIGDTEYTNAKEKLREMKAVLNQHRQKAIDAR 660
                            LRNELNRITKEVSIGDTEYTNAKEKLREMKAVLNQHRQKAIDAR
Sbjct: 601  SVKIEEKISREKEIGSLRNELNRITKEVSIGDTEYTNAKEKLREMKAVLNQHRQKAIDAR 660

Query: 661  TSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTACPRLNDLVVET 720
            TSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTACPRLNDLVVET
Sbjct: 661  TSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTACPRLNDLVVET 720

Query: 721  VECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVISSDPKFLPAFY 780
            VECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVISSDPKFLPAFY
Sbjct: 721  VECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVISSDPKFLPAFY 780

Query: 781  SVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVXXXXXXXXXXXXXXLMKLTKSGN 840
            SVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDV              LMKLTKSGN
Sbjct: 781  SVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVSGTMSGGGTQTSRGLMKLTKSGN 840

Query: 841  SGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPDVELEISKFELEI 900
            SGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPDVELEISKFELEI
Sbjct: 841  SGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPDVELEISKFELEI 900

Query: 901  TSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSLQLETKSKKDRIK 960
            TSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSLQLETKSKKDRIK
Sbjct: 901  TSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSLQLETKSKKDRIK 960

Query: 961  FLKDEIMKVGGIKLQVQSSKVDSIIQKKDIXXXXXXXXXXXXXXAETELKRLSKKQSECS 1020
            FLKDEIMKVGGIKLQVQSSKVDSIIQKKDI              AETELKRLSKKQSECS
Sbjct: 961  FLKDEIMKVGGIKLQVQSSKVDSIIQKKDILNGKHKKDKNDLKKAETELKRLSKKQSECS 1020

Query: 1021 TDLLTSTDKLENTDGQLSKIXXXXXXXXXXXXXXXXXREESLQNSENLKDQLKEFEENLN 1080
            TDLLTSTDKLENTDGQLSKI                 REESLQNSENLKDQLKEFEENLN
Sbjct: 1021 TDLLTSTDKLENTDGQLSKISKSLSETETLLHELEFSREESLQNSENLKDQLKEFEENLN 1080

Query: 1081 SFKVFQXXXXXXXXXXXXXXXXXXXDIRSTDSELQSLKIRDITHTLQELDNGNIDQDEED 1140
            SFKVFQ                   DIRSTDSELQSLKIRDITHTLQELDNGNIDQDEED
Sbjct: 1081 SFKVFQLEHQNKEEKLNNLLNFIKKDIRSTDSELQSLKIRDITHTLQELDNGNIDQDEED 1140

Query: 1141 VSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSPDANNDLEMEIDEDNNEISKGIPRI 1200
            VSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSPDANNDLEMEIDEDNNEISKGIPRI
Sbjct: 1141 VSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSPDANNDLEMEIDEDNNEISKGIPRI 1200

Query: 1201 SEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVAEYKRRKLDLNNAVDEREK 1260
            SEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVAEYKRRKLDLNNAVDEREK
Sbjct: 1201 SEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVAEYKRRKLDLNNAVDEREK 1260

Query: 1261 VRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVM 1320
            VRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVM
Sbjct: 1261 VRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVM 1320

Query: 1321 PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKE 1380
            PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKE
Sbjct: 1321 PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKE 1380

Query: 1381 RTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDIINRD 1427
            RTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDIINRD
Sbjct: 1381 RTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDIINRD 1427

>Suva_10.170 Chr10 (307316..311566) [4251 bp, 1416 aa] {ON} YLR086W
            (REAL)
          Length = 1416

 Score = 1372 bits (3551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 740/1438 (51%), Positives = 971/1438 (67%), Gaps = 33/1438 (2%)

Query: 1    MPKTPLSKRPKLVEANLNANELDHNDDDQ--RYNRQEIKVSPTTQ-DAAAVSHLNFKSQT 57
            M  +PLSKR K   A      ++H + +Q  +  +Q  +   T   D+ ++     KS T
Sbjct: 1    MYDSPLSKRQKRKTAEEPELSINHGNGEQEPKAEKQNDRTEKTPDPDSLSLESSYAKSHT 60

Query: 58   PKKLILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESSSRGRTARTYXXXXXXXXXXXXX 117
            P+KL+L   ++           +SSL  P+L PP E+ SRGR  + Y             
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSATSSLHVPNLQPP-EAPSRGRDYKAYSQSPPRSPGRSP- 118

Query: 118  XXXTRKLELIQLSPVKNSRIALQKIYESK--NEKQIERLCIDKLVLHDFKSYAGTQVVGP 175
               TR+LEL+QLSPVKNSRI LQK+Y+S   + +Q  RL IDKLVL +FKSYAG QVVGP
Sbjct: 119  ---TRRLELLQLSPVKNSRIELQKLYDSHQPSGEQQGRLFIDKLVLENFKSYAGKQVVGP 175

Query: 176  FHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKSCSVEVH 235
            FH+SFSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQDRLSDLIHKSE FP+L+SCSV VH
Sbjct: 176  FHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEEFPNLQSCSVAVH 235

Query: 236  FEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDH 295
            FEYV+D+P GT+ I+  K  LVITRKAF+NN+SKYYINGKESNYT VTKLLK+EGIDLDH
Sbjct: 236  FEYVVDEPSGTSRIDEEKPGLVITRKAFRNNSSKYYINGKESNYTQVTKLLKNEGIDLDH 295

Query: 296  NRFLILQGEVENIAQMKPKAENXXXXXXXXXXXXIIGTAKYKPLIEKKFEEIEALNEICI 355
             RFLILQGEVENIAQMK KAE             IIGTA YKPLIE +  +IE LNEIC+
Sbjct: 296  KRFLILQGEVENIAQMKSKAEKESDDGLLEYLEDIIGTANYKPLIEDRLSQIETLNEICL 355

Query: 356  EKENRFEIVDREKASLESGXXXXXXXXXXXXXXXXXXXXXYQYKLWQDNKKLSTTLEKLS 415
            EKENRFEIV+REK SLESG                     +Q+KL Q N KL++TLEK S
Sbjct: 356  EKENRFEIVNREKNSLESGKETALEFLEKEKQLTLLKSKLFQFKLLQSNSKLASTLEKTS 415

Query: 416  NIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTERVSLEE 475
            ++ ++FE  KKK   +  +++E+     E+   + +   QEK L ++KR  ++ RVSLEE
Sbjct: 416  SLNKDFESEKKKFQESLKEVDEVESQRKEIKDRMSSCASQEKTLALEKRELESTRVSLEE 475

Query: 476  QRKNIXXXXXXXXXXLEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIERGLLEE 535
            + KN+          L+  N +IS  +  +E+L   ++E+E+++ +LN  L+ ER +L++
Sbjct: 476  RTKNLVNKMGKAEKILKSTNHSISEAEHLLEELHGEQTEHETEVKDLNQSLEEERRILDD 535

Query: 536  IKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLENDIEN 595
            IK+SLKDKT + S EI QHEK+LEPW+LQLQ KKSQIQ+ ESE+SL++E +VKL+ + E 
Sbjct: 536  IKLSLKDKTKDISAEIIQHEKDLEPWDLQLQEKKSQIQLAESELSLLEETQVKLKKNAEA 595

Query: 596  LNSLXXXXXXXXXXXXXXXXXLRNELNRITKEVSIGDTEYTNAKEKLREMKAVLNQHRQK 655
            L                    L+  L  +    S G+ +++ A  KL+EM+ +LN HRQ+
Sbjct: 596  LEENIAAKKARKQELQGFILDLKKNLKSLIDGRSQGEKDFSTAHLKLKEMQTILNAHRQR 655

Query: 656  AIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTACPRLND 715
            A++AR+SLS  ENK++VL +L RLQKSGRI+GF+GRLGDLG IDD +D+AISTACPRL+D
Sbjct: 656  AMEARSSLSKAENKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDNFDVAISTACPRLDD 715

Query: 716  LVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVISSDPKF 775
            +VV+TVEC Q CI+YLRKNKLGYARFILL++LR F++  + TP NVPRLFDLV   DPKF
Sbjct: 716  VVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPVDTPENVPRLFDLVKPKDPKF 775

Query: 776  LPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVXXXXXXXXXXXXXXLMKL 835
              AFYSVLRDTLV  +LK AN VAYG +RFRVVT+ G+LID+              LM++
Sbjct: 776  SNAFYSVLRDTLVARDLKQANNVAYGKRRFRVVTIDGKLIDISGTMSGGGNHVVKGLMRI 835

Query: 836  TKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPDVELEISK 895
             K+ +     YT E+V KIE EL+ REKNF +AN+T  EME EL++++D++PD+E +I +
Sbjct: 836  GKNQSDRMDDYTPEEVNKIENELSEREKNFRVANDTVHEMEQELKKVRDQEPDMESQILR 895

Query: 896  FELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSLQLETKSK 955
             E+E  S  +E  L ++Q+ E + + D+ +++  +L+ +   L  L+ +Y  LQ ETK+K
Sbjct: 896  AEMEADSLASELALAEEQVKEAKMAYDKSVNDTAQLNKIMKILEHLRGEYDDLQAETKTK 955

Query: 956  KDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDIXXXXXXXXXXXXXXAETELKRLSKK 1015
            K+RIK L+D+IMK+GG  LQ+Q+SKV+S+ Q+ DI              +  ++ +  K+
Sbjct: 956  KERIKALQDQIMKIGGTNLQIQNSKVESLSQRIDILVAKLKKVKSGIKKSVGDVTKFQKQ 1015

Query: 1016 QSECSTDLLTSTDKLENTDGQLSKIXXXXXXXXXXXXXXXXXREESLQNSENLKDQLKEF 1075
                  D+  S+++L+  + +  +I                 + +  + SE LK+++ E 
Sbjct: 1016 LKNVERDIELSSNELKVIEEKSEQIKLDLIKNDTDVTGILNLKSDLEEQSEQLKEKVAEM 1075

Query: 1076 EENLNSFKVFQXXXXXXXXXXXXXXXXXXXDIRSTDSELQSLKIRDITHTLQELDNGNID 1135
            E  ++ FK  +                   DI+  + EL  L IRD+THTL  LDN  +D
Sbjct: 1076 EGKIDEFKSLEMEMKNKLEKLNSLLTYIKSDIKQQEKELNELSIRDVTHTLLILDNNQMD 1135

Query: 1136 ------QDEEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSPDANNDLEMEIDED 1189
                  +D ++ + +D  +S  A    G ++  EG            D ++   M IDE 
Sbjct: 1136 ILDKEGEDRQETNQED--ISGEAK---GETQGEEG------------DNDDRHCMNIDET 1178

Query: 1190 NNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVAEYKRRKL 1249
            ++E+S+GIPR+SEDE K +++E LE    +L  YID  NV+I VLEEYARR+AE+KRRKL
Sbjct: 1179 SDEVSRGIPRLSEDELKELNIELLEGDIGELTCYIDATNVDIGVLEEYARRLAEFKRRKL 1238

Query: 1250 DLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLD 1309
            DLN AV +R++V+E L+ LKK RF+EFM GF +IS+TLKEMYQMITMGGNAELELVDSLD
Sbjct: 1239 DLNQAVQKRDEVKEQLEILKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLD 1298

Query: 1310 PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1369
            PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR
Sbjct: 1299 PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1358

Query: 1370 NVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDIINRD 1427
            NVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVG+YK +N+TKS T++N DI+NR+
Sbjct: 1359 NVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTVKNIDILNRN 1416

>YLR086W Chr12 (302243..306499) [4257 bp, 1418 aa] {ON}  SMC4Subunit
            of the condensin complex; reorganizes chromosomes during
            cell division; forms a complex with Smc2p that has
            ATP-hydrolyzing and DNA-binding activity; required for
            tRNA gene clustering at the nucleolus; potential Cdc28p
            substrate
          Length = 1418

 Score = 1363 bits (3529), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 747/1431 (52%), Positives = 970/1431 (67%), Gaps = 19/1431 (1%)

Query: 1    MPKTPLSKRPK---LVEANLNANELDHNDDDQRYNRQEIKVSPTTQDAAAVSHLNFKSQT 57
            M  +PLSKR K     E  L+ ++ D  +D Q  NR  +  +    D  A+     KS T
Sbjct: 1    MSDSPLSKRQKRKSAQEPELSLDQGDAEEDSQVENRVNLSENTPEPDLPALEASYSKSYT 60

Query: 58   PKKLILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESSSRGRTARTYXXXXXXXXXXXXX 117
            P+KL+L   ++           ++SL  P+L PP ++SSRGR  ++Y             
Sbjct: 61   PRKLVLSSGENRYAFSQPTNSTTTSLHVPNLQPP-KTSSRGRDHKSYSQSPPRSPGRSP- 118

Query: 118  XXXTRKLELIQLSPVKNSRIALQKIYE--SKNEKQIERLCIDKLVLHDFKSYAGTQVVGP 175
               TR+LEL+QLSPVKNSR+ LQKIY+    + KQ  RL I++LVL +FKSYAG QVVGP
Sbjct: 119  ---TRRLELLQLSPVKNSRVELQKIYDRHQSSSKQQSRLFINELVLENFKSYAGKQVVGP 175

Query: 176  FHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKSCSVEVH 235
            FH+SFSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQDRLSDLIHKSE FP L+SCSV VH
Sbjct: 176  FHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPSLQSCSVAVH 235

Query: 236  FEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDH 295
            F+YVID+  GT+ I+  K  L+ITRKAFKNN+SKYYIN KES+YT VTKLLK+EGIDLDH
Sbjct: 236  FQYVIDESSGTSRIDEEKPGLIITRKAFKNNSSKYYINEKESSYTEVTKLLKNEGIDLDH 295

Query: 296  NRFLILQGEVENIAQMKPKAENXXXXXXXXXXXXIIGTAKYKPLIEKKFEEIEALNEICI 355
             RFLILQGEVENIAQMKPKAE             IIGTA YKPLIE++  +IE LNE+C+
Sbjct: 296  KRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERMGQIENLNEVCL 355

Query: 356  EKENRFEIVDREKASLESGXXXXXXXXXXXXXXXXXXXXXYQYKLWQDNKKLSTTLEKLS 415
            EKENRFEIVDREK SLESG                     +Q+KL Q N KL++TLEK+S
Sbjct: 356  EKENRFEIVDREKNSLESGKETALEFLEKEKQLTLLRSKLFQFKLLQSNSKLASTLEKIS 415

Query: 416  NIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTERVSLEE 475
            +  ++ E+ K K   +  +++EI     E+   I +   +EK L +++R  +  RVSLEE
Sbjct: 416  SSNKDLEDEKMKFQESLKKVDEIKAQRKEIKDRISSCSSKEKTLVLERRELEGTRVSLEE 475

Query: 476  QRKNIXXXXXXXXXXLEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIERGLLEE 535
            + KN+          L+    +IS  +  +E+L   ++E+E+++ +L   L+ ER +L++
Sbjct: 476  RTKNLVSKMEKAEKTLKSTKHSISEAENMLEELRGQQTEHETEIKDLTQLLEKERSILDD 535

Query: 536  IKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLENDIEN 595
            IK+SLKDKT   S EI +HEKELEPW+LQLQ K+SQIQ+ ESE+SL++E + KL+ ++E 
Sbjct: 536  IKLSLKDKTKNISAEIIRHEKELEPWDLQLQEKESQIQLAESELSLLEETQAKLKKNVET 595

Query: 596  LNSLXXXXXXXXXXXXXXXXXLRNELNRITKEVSIGDTEYTNAKEKLREMKAVLNQHRQK 655
            L                    L+ +LN +  E S G+  +T+A  KL+EM+ VLN HRQ+
Sbjct: 596  LEEKILAKKTHKQELQDLILDLKKKLNSLKDERSQGEKNFTSAHLKLKEMQKVLNAHRQR 655

Query: 656  AIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTACPRLND 715
            A++AR+SLS  +NK++VL +L RLQKSGRI+GF+GRLGDLG IDD +D+AISTACPRL+D
Sbjct: 656  AMEARSSLSKAQNKSKVLTALSRLQKSGRINGFHGRLGDLGVIDDSFDVAISTACPRLDD 715

Query: 716  LVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVISSDPKF 775
            +VV+TVEC Q CI+YLRKNKLGYARFILL++LR F++  ISTP NVPRLFDLV   +PKF
Sbjct: 716  VVVDTVECAQHCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKNPKF 775

Query: 776  LPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVXXXXXXXXXXXXXXLMKL 835
              AFYSVLRDTLV  NLK AN VAYG KRFRVVT+ G+LID+              LMKL
Sbjct: 776  SNAFYSVLRDTLVAQNLKQANNVAYGKKRFRVVTVDGKLIDISGTMSGGGNHVAKGLMKL 835

Query: 836  TKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPDVELEISK 895
              + +     YT E+V+KIE+EL+ RE NF +A++T  EME EL++L+D +PD+E +ISK
Sbjct: 836  GTNQSDKVDDYTPEEVDKIERELSERENNFRVASDTVHEMEEELKKLRDHEPDLESQISK 895

Query: 896  FELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSLQLETKSK 955
             E+E  S  +E  L +QQ+ E + +  + +S+  +L+ +   L  L+ +Y  LQ ETK+K
Sbjct: 896  AEMEADSLASELTLAEQQVKEAEMAYVKAVSDKAQLNVVMKNLERLRGEYNDLQSETKTK 955

Query: 956  KDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDIXXXXXXXXXXXXXXAETELKRLSKK 1015
            K++IK L+DEIMK+GGIKLQ+Q+SKV+S+ QK DI              +  ++ +  K 
Sbjct: 956  KEKIKGLQDEIMKIGGIKLQMQNSKVESVCQKLDILVAKLKKVKSASKKSGGDVVKFQKL 1015

Query: 1016 QSECSTDLLTSTDKLENTDGQLSKIXXXXXXXXXXXXXXXXXREESLQNSENLKDQLKEF 1075
                  D+  S+D+L+  + QL                    + E  + SE LK+Q+++ 
Sbjct: 1016 LQNSERDVELSSDELKVIEEQLKHTKLALAENDTNMNETLNLKVELKEQSEQLKEQMEDM 1075

Query: 1076 EENLNSFKVFQXXXXXXXXXXXXXXXXXXXDIRSTDSELQSLKIRDITHTLQELDNGNID 1135
            EE++N FK  +                   +I   +  L  L IRD+THTL  LD+  +D
Sbjct: 1076 EESINEFKSIEIEMKNKLEKLNSLLTYIKSEITQQEKGLNELSIRDVTHTLGMLDDNKMD 1135

Query: 1136 QDEEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSPDANNDLEMEIDEDNNEISK 1195
              +EDV  K+N      +    + E  +  EI+    D     +N   M IDE ++E+S+
Sbjct: 1136 SVKEDV--KNNQ---ELDQEYRSCETQDESEIK----DAETSCDNYHPMNIDETSDEVSR 1186

Query: 1196 GIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVAEYKRRKLDLNNAV 1255
            GIPR+SEDE + +DVE +E++  +L  Y++  NV+I VLEEYARR+AE+KRRKLDLNNAV
Sbjct: 1187 GIPRLSEDELRELDVELIESKINELSYYVEETNVDIGVLEEYARRLAEFKRRKLDLNNAV 1246

Query: 1256 DEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGV 1315
             +R++V+E L  LKK RF+EFM GF +IS+TLKEMYQMITMGGNAELELVDSLDPFSEGV
Sbjct: 1247 QKRDEVKEQLGILKKKRFDEFMAGFNIISMTLKEMYQMITMGGNAELELVDSLDPFSEGV 1306

Query: 1316 TFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1375
            TFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA
Sbjct: 1307 TFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA 1366

Query: 1376 NYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDIINR 1426
            NYIKERTKNAQFIVISLRNNMFELA+QLVG+YK +N+TKS T++N DI+NR
Sbjct: 1367 NYIKERTKNAQFIVISLRNNMFELAQQLVGVYKRDNRTKSTTIKNIDILNR 1417

>TDEL0F03860 Chr6 (709579..713778) [4200 bp, 1399 aa] {ON} Anc_8.259
            YLR086W
          Length = 1399

 Score = 1353 bits (3502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 729/1438 (50%), Positives = 962/1438 (66%), Gaps = 52/1438 (3%)

Query: 1    MPKTPLSKRPKLVEANLNANELDHNDDDQRYNRQEIKVSPTTQDAAAVSHLNFKSQTPKK 60
            MP TPL+KR ++     N NE          +R+   V+ +T+     +  +  S TPKK
Sbjct: 1    MPDTPLTKRQRV-----NDNE----------SREFEAVNGSTKSPLTSNSNSTISHTPKK 45

Query: 61   LILRDYDSIAITPTAAMP--PSSSLQAPSLHPPTESSSRGRTARTYXXXXXXXXXXXXXX 118
            L++   D    T + + P   SSSLQAPSL  P  SSSRGR  RTY              
Sbjct: 46   LVIGTNDD---TTSQSQPIVSSSSLQAPSLQHPN-SSSRGREQRTYSQSPPRSPGRSP-- 99

Query: 119  XXTRKLELIQLSPVKNSRIALQKIYES-KNEKQIERLCIDKLVLHDFKSYAGTQVVGPFH 177
              TRKLELI++SPVK +R+ LQ++Y++ ++++   RLCI+KLVL DFKSYAG QVVGPFH
Sbjct: 100  --TRKLELIKISPVKKNRLELQRLYDAEQSQRNAARLCINKLVLQDFKSYAGRQVVGPFH 157

Query: 178  SSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKSCSVEVHFE 237
            SSFSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQDRLSDLIH SE  P+LKSCSVEVHF+
Sbjct: 158  SSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHNSEVHPNLKSCSVEVHFQ 217

Query: 238  YVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDHNR 297
            YV+D+PDGTT I+  K  LV+TRKAFKNN+SKYY+N KESNYT VT+LLK EGIDLDH R
Sbjct: 218  YVVDEPDGTTRIDEEKPTLVVTRKAFKNNSSKYYVNDKESNYTEVTQLLKKEGIDLDHKR 277

Query: 298  FLILQGEVENIAQMKPKAENXXXXXXXXXXXXIIGTAKYKPLIEKKFEEIEALNEICIEK 357
            FLILQGEVENIAQM+PKAE             I GTAKYKP IE   +EIE LNE CIEK
Sbjct: 278  FLILQGEVENIAQMRPKAEKEGEDGLLEYLEDITGTAKYKPQIETILQEIEVLNESCIEK 337

Query: 358  ENRFEIVDREKASLESGXXXXXXXXXXXXXXXXXXXXXYQYKLWQDNKKLSTTLEKLSNI 417
            ENRF IVD+EK+SLE+G                      QYK+WQ++ KL++TL+K S +
Sbjct: 338  ENRFHIVDQEKSSLETGKDEALEFLEKEKTLTLLRSKMIQYKIWQNDIKLTSTLDKSSKL 397

Query: 418  KEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTERVSLEEQR 477
            K + ++  +K+S T  +++ +     ++ K I+    +EK L  QKR  D +RV++EE+ 
Sbjct: 398  KGQLDQENEKYSETLKEVDSLKDESKQVAKRIETLAIEEKALLAQKRGLDQQRVAIEEKI 457

Query: 478  KNIXXXXXXXXXXLEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIERGLLEEIK 537
            K++          L+    +++ T+  + +L +++ +YE +L +LN +L  ER  LE++K
Sbjct: 458  KSVNQKTNKAEKLLKSNQHSLNATEANLRELRQSQLDYEKELQDLNQELITERAKLEDVK 517

Query: 538  ISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLENDIENLN 597
            ISLK+KT+  S  I+Q+EK+LEPW+ QLQ K+++IQ+ ESE+SL+K+   ++  DIE L 
Sbjct: 518  ISLKEKTVNISAGIAQYEKDLEPWDGQLQQKRAEIQLAESELSLLKDTNARINKDIEQLK 577

Query: 598  SLXXXXXXXXXXXXXXXXXLRNELNRITKEVSIGDTEYTNAKEKLREMKAVLNQHRQKAI 657
            +                  L+ E + +T EV     E ++A  +L++M  +L   RQ+ +
Sbjct: 578  NEIARGGEEKLAKEKVIRELKQEESDVTAEVHTAGAECSSASARLKKMHEILIAQRQRTL 637

Query: 658  DARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTACPRLNDLV 717
            DAR + S+ +NK+ VL +L +LQKSGRISGF+GRLGDLG ID++YD+AISTACPRL D+V
Sbjct: 638  DARAAFSSAQNKSTVLTALTKLQKSGRISGFHGRLGDLGVIDEKYDVAISTACPRLEDIV 697

Query: 718  VETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVISSDPKFLP 777
            VE+VECGQQCIEYLRKNKLGYARFILL+KLR F   KI TP NVPRLFDLV   D KF+P
Sbjct: 698  VESVECGQQCIEYLRKNKLGYARFILLDKLRKFHTGKIQTPENVPRLFDLVKPKDDKFIP 757

Query: 778  AFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVXXXXXXXXXXXXXXLMKLTK 837
            AFYSVLRDTL   +L  ANRVAYG KRFRVV+L G+LID+              LM+L++
Sbjct: 758  AFYSVLRDTLAAQSLAQANRVAYGKKRFRVVSLDGKLIDISGTMSGGGSHVVRGLMRLSQ 817

Query: 838  SGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPDVELEISKFE 897
            + +     ++ E+V ++E EL  +EK+F+IA++TF EME +L++LKDR P+++L++SK  
Sbjct: 818  NNSYSPDIFSPEEVAQLENELTEKEKSFQIASDTFREMEDQLKKLKDRVPEIQLKVSKLV 877

Query: 898  LEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSLQLETKSKKD 957
            +E  SW++E +L ++ L E+ ++  +    NEE    E  + TL+++ ++L  +T + + 
Sbjct: 878  METESWMSELKLKEKLLLERLEAQKKATGKNEEYQLAEARVKTLKDEQRALSDQTTTTRQ 937

Query: 958  RIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDIXXXXXXXXXXXXXXAETELKRLSKKQS 1017
            +I  LKD+IM++GG +LQ+Q+SKV S IQ+ +I              AE ELK+ +K   
Sbjct: 938  KIAVLKDKIMEIGGSELQIQNSKVTSTIQRMEILTSKQKKGKASIKKAENELKKSAKIVG 997

Query: 1018 ECSTDLLTSTDKLENTDGQLSKIXXXXXXXXXXXXXXXXXREESLQNSENLKDQLKEFEE 1077
                DL   + ++ +       +                   E  +  + LK +L + E 
Sbjct: 998  NTQKDLDLYSQEIASLKENADNVQQTLESVEKSVDEQQDLSHEMNEKLDQLKQRLAQMEA 1057

Query: 1078 NLNSFKVFQXXXXXXXXXXXXXXXXXXXDIRSTDSELQSLKIRDITHTLQELDNGNIDQD 1137
                FK  +                   ++R  +S+L +LKIRD+T TLQ LD G     
Sbjct: 1058 GFTEFKSLKIEINDKLEKLNALLGHITKEVRQLESDLNNLKIRDVTRTLQLLDEGE---- 1113

Query: 1138 EEDVSMKDNAVSVSANNS-LGN------SENMEGVEIETNESDVS--PDANNDLEMEIDE 1188
                         S NNS + N      +E  +    E  ESDVS   + +ND  ME+DE
Sbjct: 1114 -------------STNNSKMPNELQEKRTEGADATRQEGEESDVSMEEEKSNDEVMEVDE 1160

Query: 1189 DNNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVAEYKRRK 1248
              +E+  G+PR+SE E K++DVE+L AQ   LQ+Y+D+VNV++++LEEYA+R+AE+KRRK
Sbjct: 1161 KPHELENGLPRVSEAELKSLDVEDLGAQIEDLQNYVDSVNVDVEILEEYAKRLAEHKRRK 1220

Query: 1249 LDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSL 1308
            +DLN AV ER+ +RE L +LKK RF+EFMQGFG+IS+TLKEMYQMITMGGNAELELVDSL
Sbjct: 1221 VDLNEAVGERDAMREKLGELKKRRFDEFMQGFGIISMTLKEMYQMITMGGNAELELVDSL 1280

Query: 1309 DPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1368
            DPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF
Sbjct: 1281 DPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1340

Query: 1369 RNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDIINR 1426
            RNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK+ N TKSA+L+NNDI+NR
Sbjct: 1341 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKTQNMTKSASLKNNDILNR 1398

>Skud_12.154 Chr12 (285613..289866) [4254 bp, 1417 aa] {ON} YLR086W
            (REAL)
          Length = 1417

 Score = 1352 bits (3499), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 734/1440 (50%), Positives = 966/1440 (67%), Gaps = 36/1440 (2%)

Query: 1    MPKTPLSKRPKLVEANLNANELDHNDDD-QRYNRQEIKV----------SPTTQDAAAVS 49
            M  +PLSK+ K         EL  ND D +R +R E +V          SP+ + + A S
Sbjct: 1    MCDSPLSKKQK--RKATEEPELSLNDTDAERESRVENRVNRTEKTPDPNSPSLESSYARS 58

Query: 50   HLNFKSQTPKKLILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESSSRGRTARTYXXXXX 109
            H      TP+KL+L   ++           ++SL  P+L PP + SSRGR  + Y     
Sbjct: 59   H------TPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPP-KVSSRGRDYKAYSQSPP 111

Query: 110  XXXXXXXXXXXTRKLELIQLSPVKNSRIALQKIYESKNE--KQIERLCIDKLVLHDFKSY 167
                        R+LEL+QLSPVKNSRI LQK+Y+S     KQ  RL I+KLVL +FKSY
Sbjct: 112  RSPGRSP----ARRLELLQLSPVKNSRIELQKLYDSHKSSGKQQGRLFINKLVLDNFKSY 167

Query: 168  AGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDL 227
            AG QVVGPFH+SFSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQDRLSDLIHKSE FPDL
Sbjct: 168  AGRQVVGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPDL 227

Query: 228  KSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLK 287
            ++CSV VHFEY+ID+P GT+ I+  K  LVITR+AFKNN+SKYYIN KES+YT VTKLLK
Sbjct: 228  QACSVAVHFEYIIDEPSGTSRIDEEKPGLVITRRAFKNNSSKYYINEKESSYTEVTKLLK 287

Query: 288  DEGIDLDHNRFLILQGEVENIAQMKPKAENXXXXXXXXXXXXIIGTAKYKPLIEKKFEEI 347
             EGIDLDH RFLILQGEVENIAQMKPKAE             IIGTA YKPLIE++  +I
Sbjct: 288  KEGIDLDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEERLSQI 347

Query: 348  EALNEICIEKENRFEIVDREKASLESGXXXXXXXXXXXXXXXXXXXXXYQYKLWQDNKKL 407
            E+LNEIC+EK NRFEIVDREK SLESG                      Q+K+ Q N KL
Sbjct: 348  ESLNEICLEKANRFEIVDREKNSLESGKETALEFLKKEKQLTLLKSKLLQFKMLQSNSKL 407

Query: 408  STTLEKLSNIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYD 467
            ++TLEK+S++  EFE  KKK   +  +++E+   + ++   I +S  +EK L+++KR  +
Sbjct: 408  ASTLEKISSLNREFESEKKKFQESLREVDEVKAQHKDIKDRISSSTSREKTLSLEKRELE 467

Query: 468  TERVSLEEQRKNIXXXXXXXXXXLEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQ 527
              RVSLEE+ KN+          L+    +IS ++   ++L + ++E+E ++ +LN  L+
Sbjct: 468  GSRVSLEERTKNLVNKMGKAEKALKSTKHSISESEHMFQELQRQQTEHEKEIKDLNQSLE 527

Query: 528  IERGLLEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRV 587
             ER +L++IK+SLKDKT + S +I +HEKE EPW+LQLQ KKSQIQ+ ESE+SL++E R 
Sbjct: 528  EERIILDDIKLSLKDKTKDISAKIIRHEKESEPWDLQLQEKKSQIQLAESELSLLEETRA 587

Query: 588  KLENDIENLNSLXXXXXXXXXXXXXXXXXLRNELNRITKEVSIGDTEYTNAKEKLREMKA 647
            KL+ + E L                    L   L  +    S G+ ++ +A  KL+EM+ 
Sbjct: 588  KLKKNAEALEEKIISKKQRKQELQGLVLDLSQRLKSLIDGRSQGERDFRSAHLKLKEMQR 647

Query: 648  VLNQHRQKAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAIS 707
            +LN HRQ+A++AR+SLS  +NKN VL +L +LQKSGRI+GF+GRLGDLG ID+ +D+AIS
Sbjct: 648  ILNAHRQRAMEARSSLSKAQNKNMVLTALSKLQKSGRINGFHGRLGDLGVIDNSFDVAIS 707

Query: 708  TACPRLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDL 767
            TACPRL+D+VV+TVEC Q CI+YLRKNKLGYARFILL++LR F++  ISTP NVPRLFD+
Sbjct: 708  TACPRLDDVVVDTVECAQHCIDYLRKNKLGYARFILLDRLRKFNLQPISTPENVPRLFDV 767

Query: 768  VISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVXXXXXXXXXX 827
            V   DPKF  AFYSVL+DTLV  +LK AN+VAYG +RFRVVT+ G+LID+          
Sbjct: 768  VKPKDPKFSNAFYSVLKDTLVARDLKQANKVAYGKRRFRVVTVDGKLIDISGTMSGGGNH 827

Query: 828  XXXXLMKLTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKP 887
                LM+L  + +   + YT E+V KIE ELA REKNF +AN+T  EME EL++++D++P
Sbjct: 828  VMKGLMRLGTNQSDEIEDYTPEEVIKIEHELAEREKNFRVANDTVHEMEEELKKVRDQEP 887

Query: 888  DVELEISKFELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKS 947
            D+E +IS+ E+E  S  +E  L +QQ  E + + D+ ++   +++ +   L  L+ +Y+ 
Sbjct: 888  DLESQISRAEMEADSLTSELMLAEQQAKEAKMAYDKAVNEKTQVNEVMKNLEHLRGEYED 947

Query: 948  LQLETKSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDIXXXXXXXXXXXXXXAET 1007
            LQ ET++KK++IK L+D+IMK+GG KL  Q+SKV S+ Q+ DI              +E 
Sbjct: 948  LQSETRTKKEQIKILQDQIMKIGGTKLHTQNSKVGSLCQRIDILVIKLKKVKSGIKKSEG 1007

Query: 1008 ELKRLSKKQSECSTDLLTSTDKLENTDGQLSKIXXXXXXXXXXXXXXXXXREESLQNSEN 1067
            ++ +  K+      D   S+++L+  + +L +                  + E     E 
Sbjct: 1008 DVLKYQKQLKNFEQDEELSSNELKVIEEKLKQTKLALTENDTNMTEISNLKSELKDQGEQ 1067

Query: 1068 LKDQLKEFEENLNSFKVFQXXXXXXXXXXXXXXXXXXXDIRSTDSELQSLKIRDITHTLQ 1127
            LK++L E EEN++ FK  +                   +I+  D EL  L IRD+THTLQ
Sbjct: 1068 LKERLTEMEENIDEFKSLEIEMKNKLEKLNSLLIHIKNEIKQQDKELNDLSIRDVTHTLQ 1127

Query: 1128 ELDNGNIDQDEEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSPDANNDLEMEID 1187
             LDN  +D  E+ +  + +A      + + + E ++    E +++D     NN   M ID
Sbjct: 1128 MLDNNQMDVVEDGIKDEQDA-DQDKPSGIPDDEKIQ----EKDDAD-----NNHHSMNID 1177

Query: 1188 EDNNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVAEYKRR 1247
            E ++EIS+GIP++ E+E K++D+E LE+    L  YI+  +V+I VLEEY RR+ E+KRR
Sbjct: 1178 EMSSEISRGIPKLCEEELKDLDIELLESDISGLTCYINETSVDIGVLEEYVRRLIEFKRR 1237

Query: 1248 KLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDS 1307
            KLDLN AV +R++V+E L+ LKK RF+EFM GF +IS+TLKEMYQMITMGGNAELELVDS
Sbjct: 1238 KLDLNQAVQKRDEVKEQLEILKKNRFDEFMNGFNIISMTLKEMYQMITMGGNAELELVDS 1297

Query: 1308 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1367
            LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKY+PTPLYVMDEIDAALD
Sbjct: 1298 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYRPTPLYVMDEIDAALD 1357

Query: 1368 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDIINRD 1427
            FRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QL+GIYK +N+TKS T++N DI+ RD
Sbjct: 1358 FRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNRTKSTTVKNIDILKRD 1417

>KAFR0B02710 Chr2 (545337..549587) [4251 bp, 1416 aa] {ON} Anc_8.259
            YLR086W
          Length = 1416

 Score = 1341 bits (3470), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 731/1444 (50%), Positives = 968/1444 (67%), Gaps = 48/1444 (3%)

Query: 1    MPKTPLSKRPKLV--EANLNANELDHNDDDQRYNRQEIKVSPTTQDAAAVSHLNFKSQTP 58
            M  TPLSK+ K+V  E  +  N+ + ++D         K  P   +  A S L  KS TP
Sbjct: 1    MSHTPLSKKQKVVSDEERITPNQNEQDND---------KTHP---EVTASSFL--KSHTP 46

Query: 59   KKLILRDYDSIAITPTAAMPPSSS----LQAPSLHPPTESSSRGRTARTYXXXXXXXXXX 114
            +KL+L   D+  +     +  SS     LQ P+L PP    SRGR  + Y          
Sbjct: 47   RKLLLGSADNKYVLSQPIISSSSHGSSSLQVPNLQPPLSQPSRGRDKKAYSQSPPRSPGR 106

Query: 115  XXXXXXTRKLELIQLSPVKNSRIALQKIYESKNEKQIERLCIDKLVLHDFKSYAGTQVVG 174
                   RKLELIQLSP+KN+RI LQK+Y SKN+ ++ RL IDKLVL DFKSYAGTQ+VG
Sbjct: 107  SP----VRKLELIQLSPIKNNRIELQKLYNSKNQNKV-RLYIDKLVLQDFKSYAGTQIVG 161

Query: 175  PFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKSCSVEV 234
            PF++SFSA+VGPNGSGKSNVIDSMLFVFGFRA+KMRQDRL DLIHKSE FP+++SCSVEV
Sbjct: 162  PFNTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLGDLIHKSEAFPNIQSCSVEV 221

Query: 235  HFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLD 294
            HF+YVID+ DGT+ I   ++ LV+ RKAFKNN+SKYYINGKESNYT VT+LLK+EGIDLD
Sbjct: 222  HFQYVIDENDGTSKIIEDRKPLVVMRKAFKNNSSKYYINGKESNYTEVTRLLKEEGIDLD 281

Query: 295  HNRFLILQGEVENIAQMKPKAENXXXXXXXXXXXXIIGTAKYKPLIEKKFEEIEALNEIC 354
            H RFLILQGEVENIAQMK KAE             IIGT+KYK LIE K  EIEALNEIC
Sbjct: 282  HKRFLILQGEVENIAQMKAKAEKEGDDGLLEYLEDIIGTSKYKTLIEDKMVEIEALNEIC 341

Query: 355  IEKENRFEIVDREKASLESGXXXXXXXXXXXXXXXXXXXXXYQYKLWQDNKKLSTTLEKL 414
            +EKE RFEIV+ EK SLES                       QYKL+Q N KL+TTL+K+
Sbjct: 342  VEKEKRFEIVETEKNSLESDKDAALEFIAKEKQLTLLRSKLTQYKLYQTNTKLATTLDKI 401

Query: 415  SNIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTERVSLE 474
            SN K   +E + K+   + ++++ ++   E  + I AS  QE++L  +KR YD + VS+E
Sbjct: 402  SNFKNALQEERSKYEKIQSEIDQSTRELREANEKINASVAQERELVQKKREYDGQCVSME 461

Query: 475  EQRKNIXXXXXXXXXXLEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIERGLLE 534
            E+ KN+          L D    I   +  ++DL   +  Y+S+   L  +L  ER  L+
Sbjct: 462  ERIKNLTQKKTKAEKTLHDKRIEIQKNESILKDLQDYQMNYDSEFSNLQKELDKERSKLD 521

Query: 535  EIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLENDIE 594
            +IK+SLKDKT + S +IS +EK++EPW  ++Q K+ QIQ+ ESEISL+KE + KL+  + 
Sbjct: 522  DIKLSLKDKTKDISSQISLYEKDIEPWVSKIQEKQVQIQLAESEISLLKESQAKLKEGLG 581

Query: 595  NLNSLXXXXXXXXXXXXXXXXXLRNELNRITKEVSIGDTEYTNAKEKLREMKAVLNQHRQ 654
            +L                    L+ E   + KEVS+G++E + AKEK +EM+ +LN HRQ
Sbjct: 582  SLKVEIDDVRKEIDNKNSIIENLKKEQVSLKKEVSLGESECSRAKEKEKEMRVILNSHRQ 641

Query: 655  KAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTACPRLN 714
            +AIDAR++L   ENK+ VL++L RLQKSGRI+GF+GRLGDLG I D+YDIAISTAC RL+
Sbjct: 642  RAIDARSALHMAENKSTVLSALTRLQKSGRINGFHGRLGDLGVIADKYDIAISTACSRLD 701

Query: 715  DLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVISSDPK 774
            D+VV++VECGQQCIEYLRKNKLGYARFILL+KLRNF + ++ TP NV RLFDLV   D K
Sbjct: 702  DIVVDSVECGQQCIEYLRKNKLGYARFILLDKLRNFQLGQLQTPENVLRLFDLVQPIDLK 761

Query: 775  FLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVXXXXXXXXXXXXXXLMK 834
            F  AFYSVLRDTLV  +++ ANRVAYG +R+RVVTL G+LID+              LMK
Sbjct: 762  FSNAFYSVLRDTLVATDIRQANRVAYGKRRYRVVTLDGKLIDISGTMTGGGSHVSKGLMK 821

Query: 835  LTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPDVELEIS 894
            L  S     + Y   DVEKIE++LA RE NF+IA++T  EM  EL+RL+D++P++ELEI+
Sbjct: 822  LKNSNMEHLEVYEAGDVEKIERDLAERENNFKIAHDTLQEMNNELKRLQDKEPEIELEIA 881

Query: 895  KFELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSLQLETKS 954
            K  +++ S   +  L +QQL E +++  + ++  + L   E  L TL+N++++L+ +++S
Sbjct: 882  KLLMDVDSLNDQLNLKEQQLKELEKNYTDVINKKDPLDRAEAFLQTLRNEHRALEDQSQS 941

Query: 955  KKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDIXXXXXXXXXXXXXXAETELKRLSK 1014
            KK++I  LK+EIMK+GG +LQ+Q+SKV S+ ++  I               E EL+++ +
Sbjct: 942  KKEKINTLKEEIMKIGGKELQIQNSKVSSLTERIGIVNAKHKKDKATIKRTEKELQKVQR 1001

Query: 1015 KQSECSTDLLTSTDKLENTDGQLSKIXXXXXXXXXXXXXXXXXREESLQNSENLKDQLKE 1074
               +   D     + LE     +  I                 +++     E+LK+++K+
Sbjct: 1002 LFKQAELDNTACVNDLETLQTNVIAIRTRLQETEAEFDIILNEKDDLTGQCESLKEKIKD 1061

Query: 1075 FEENLNSFKVFQXXXXXXXXXXXXXXXXXXXDIRSTDSELQSLKIRDITHTLQELDNGNI 1134
             EE++N +K F+                   DIRS + ELQS  +RD+T +L+++ N N 
Sbjct: 1062 MEESMNEYKSFEIEIKNKLEKLNSLLDYCKKDIRSLNQELQSYHVRDVTQSLEKIQNEN- 1120

Query: 1135 DQDEEDVSMKDNAVSV--SANN---SLGNSENMEGVEIETNESDVSPDANNDLE------ 1183
                      +N+V V  S+NN   S  ++ N++  + E +  D   D+ N++E      
Sbjct: 1121 ---------ANNSVGVKQSSNNLDVSSSHTPNVDKHDDEISMEDADNDSQNEIEEKEQDA 1171

Query: 1184 --MEIDEDNNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRV 1241
              M++D    E+SKGIP++++D+ K++D++ LE++  QLQDY++  N +I++LEEY RR+
Sbjct: 1172 DIMDLDNVTEEVSKGIPKLTDDDLKSIDLDSLESEINQLQDYVENSNADIELLEEYIRRL 1231

Query: 1242 AEYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAE 1301
             E+K+RKLDLN  V  R++VR+ L+KLKKTR +EFM+GF +IS+TLKEMYQMITMGGNAE
Sbjct: 1232 EEFKKRKLDLNTTVARRDEVRDELEKLKKTRHDEFMEGFSIISLTLKEMYQMITMGGNAE 1291

Query: 1302 LELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1361
            LELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE
Sbjct: 1292 LELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1351

Query: 1362 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNN 1421
            IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK +N T+SATL+N 
Sbjct: 1352 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRSNMTQSATLKNK 1411

Query: 1422 DIIN 1425
            DI+N
Sbjct: 1412 DILN 1415

>Smik_12.145 Chr12 (282081..286337) [4257 bp, 1418 aa] {ON} YLR086W
            (REAL)
          Length = 1418

 Score = 1339 bits (3465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 736/1434 (51%), Positives = 966/1434 (67%), Gaps = 25/1434 (1%)

Query: 1    MPKTPLSKRPK---LVEANLNANELDHNDD---DQRYNRQEIKVSPTTQDAAAVSHLNFK 54
            M  +PLSKR K   + E  L+ ++ D   +   +++ +R E    P   ++ A+     K
Sbjct: 1    MCDSPLSKRQKRKAVEEPELSLDDSDATQELQAEKQADRSEKTPDP---NSPALETSYAK 57

Query: 55   SQTPKKLILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESSSRGRTARTYXXXXXXXXXX 114
            S TP+KL+L   ++           ++SL  P+L PP  +SSRGR  + Y          
Sbjct: 58   SHTPRKLVLSSGENRYAFSQPTNSATTSLHVPNLQPPG-TSSRGRDYKAYSQSPPRSPGR 116

Query: 115  XXXXXXTRKLELIQLSPVKNSRIALQKIYESK--NEKQIERLCIDKLVLHDFKSYAGTQV 172
                  TR+LEL+QLSPVKNSR+ LQK+Y S   + KQ  RL I++LVL +FKSYAG QV
Sbjct: 117  SP----TRRLELLQLSPVKNSRVELQKLYNSHQSSTKQQGRLFINELVLENFKSYAGRQV 172

Query: 173  VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKSCSV 232
            VGPFH+SFSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQDRLSDLIHKSE FP+L+SCSV
Sbjct: 173  VGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEAFPNLQSCSV 232

Query: 233  EVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGID 292
             VHFEYVID+  GT+ I+  K  LVITRKAFKNN+SKYYINGKES+YT VTKLLK+EGID
Sbjct: 233  AVHFEYVIDESSGTSRIDEEKPGLVITRKAFKNNSSKYYINGKESSYTEVTKLLKNEGID 292

Query: 293  LDHNRFLILQGEVENIAQMKPKAENXXXXXXXXXXXXIIGTAKYKPLIEKKFEEIEALNE 352
            LDH RFLILQGEVENIAQMKPKAE             IIGTA YKPLIE++  +IEALNE
Sbjct: 293  LDHKRFLILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTANYKPLIEEQMNQIEALNE 352

Query: 353  ICIEKENRFEIVDREKASLESGXXXXXXXXXXXXXXXXXXXXXYQYKLWQDNKKLSTTLE 412
            +C+EKENRFEIVDREK SLESG                     +Q+K+ Q N KL++TLE
Sbjct: 353  VCLEKENRFEIVDREKNSLESGKETALEFLAKEKQLTLLKSKLFQFKVLQSNSKLASTLE 412

Query: 413  KLSNIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTERVS 472
            K+S++ ++FE  K K   +  ++ E+     E+   I ++  +EK L +++R  +  RVS
Sbjct: 413  KISSLNKDFETEKVKFQESLKKVEEVKTQRKEIKDRISSNDSREKDLVLERRELEGTRVS 472

Query: 473  LEEQRKNIXXXXXXXXXXLEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIERGL 532
            LEE+ KN+           +   ++IS  +  +++L   ++E+ES++ +LN  L+ ER +
Sbjct: 473  LEERTKNLANKIEKSERTSKCTKRSISEAEHTLKELHTQQTEHESEIKDLNQLLEEERSV 532

Query: 533  LEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLEND 592
            L+EIK+SLKDKT + S EI QHEKELEPW+LQLQ K+SQIQ+ ESE+SL++E + KL+ +
Sbjct: 533  LDEIKLSLKDKTKDISTEIIQHEKELEPWDLQLQEKESQIQLAESELSLLEETQSKLKKN 592

Query: 593  IENLNSLXXXXXXXXXXXXXXXXXLRNELNRITKEVSIGDTEYTNAKEKLREMKAVLNQH 652
            +E +                    L+ +L+ +  E S G+  +++A  KL EM+ VLN H
Sbjct: 593  VETMEEKILARKAHKQELQDLILNLKKKLSSLRDERSQGEENFSSAHLKLEEMQKVLNTH 652

Query: 653  RQKAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTACPR 712
            RQ+A++AR+SLS  +NK++VL +L +LQKSGRI+GF+GRLGDLG ID+ +D+AISTACPR
Sbjct: 653  RQRAMEARSSLSEAQNKSKVLTALSKLQKSGRINGFHGRLGDLGIIDNSFDVAISTACPR 712

Query: 713  LNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVISSD 772
            L+D+VV+TVEC QQCI+YLRKNKLGYARFILL++LR F++  ISTP NVPRLFDLV   D
Sbjct: 713  LDDVVVDTVECAQQCIDYLRKNKLGYARFILLDRLRQFNLQPISTPENVPRLFDLVKPKD 772

Query: 773  PKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVXXXXXXXXXXXXXXL 832
            PKF  AFYSVLRDTLV  +LK AN VAYG KRFRVVT+ G+LID+              L
Sbjct: 773  PKFSNAFYSVLRDTLVARSLKQANNVAYGRKRFRVVTIDGKLIDISGTISGGGNHVSKGL 832

Query: 833  MKLTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPDVELE 892
            M+L  + ++    YT E+V KIE EL+ RE NF +AN+T  EME EL+ L+D++P +E +
Sbjct: 833  MRLGTNQSNKIDDYTPEEVNKIEHELSERENNFRVANDTVHEMEAELKNLRDQEPAIESK 892

Query: 893  ISKFELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSLQLET 952
            ISK E+E  S  +E  L +QQ+ E + +    +S+  +++ +   L  L+ ++  LQ ET
Sbjct: 893  ISKTEMEADSITSELTLAEQQVKEARIAYHNALSDKAQVNMIMKNLERLKGEHDDLQSET 952

Query: 953  KSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDIXXXXXXXXXXXXXXAETELKRL 1012
            K+KK++IK L+ EIMK+GG KLQ+Q+SKV S+ Q+ DI              +E ++ + 
Sbjct: 953  KTKKEKIKVLQGEIMKIGGTKLQMQNSKVGSLCQRLDILVAKLKKVKSGIKKSEGDVLKF 1012

Query: 1013 SKKQSECSTDLLTSTDKLENTDGQLSKIXXXXXXXXXXXXXXXXXREESLQNSENLKDQL 1072
             K+      D+  S+++L+  + +L                    R E  + SE LK+ +
Sbjct: 1013 QKQLKNSERDVELSSNELKAIEEKLKHTKLDLSENDIKMTETFNLRSELKEESEQLKEMV 1072

Query: 1073 KEFEENLNSFKVFQXXXXXXXXXXXXXXXXXXXDIRSTDSELQSLKIRDITHTLQELDNG 1132
             E EEN++ FK  +                   +I   +  L  L IRD+THTL+ LDN 
Sbjct: 1073 AETEENIDEFKSLEIEMKNKLEKLNSLLMHIKKEINQQEKGLSELSIRDVTHTLEILDNN 1132

Query: 1133 NIDQDEEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSPDANNDLEMEIDEDNNE 1192
             +     D+   DN +  +      +SE  +   I+  E       ++   M+IDE +NE
Sbjct: 1133 TM-----DIVKTDNKIEQAVVKEKRSSETQDEKNIQEEER----TCDDHHSMDIDETSNE 1183

Query: 1193 ISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVAEYKRRKLDLN 1252
            + +GIPR SE+E K +D+E LE +  +L  YID  NV+I VLEEYARR+AE+KRRKLDLN
Sbjct: 1184 VIRGIPRFSEEELKELDIELLEKEISELSYYIDETNVDIGVLEEYARRLAEFKRRKLDLN 1243

Query: 1253 NAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFS 1312
             AV +R++V+  ++ LKK RF+EFM GF +IS+TLKEMYQMITMGGNAELELVDSLDPFS
Sbjct: 1244 QAVQKRDEVKGQVEVLKKKRFDEFMTGFNIISMTLKEMYQMITMGGNAELELVDSLDPFS 1303

Query: 1313 EGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1372
            EGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS
Sbjct: 1304 EGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVS 1363

Query: 1373 IVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDIINR 1426
            IVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK +N+T+S T++N DI+NR
Sbjct: 1364 IVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNRTRSTTVKNIDILNR 1417

>NCAS0B05000 Chr2 (917841..922070) [4230 bp, 1409 aa] {ON} Anc_8.259
            YLR086W
          Length = 1409

 Score = 1335 bits (3455), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 740/1428 (51%), Positives = 952/1428 (66%), Gaps = 31/1428 (2%)

Query: 5    PLSKRPKLVEANLNANELDHNDDDQRYN---RQEIKVSPTTQDAAAVSHLNFKSQTPKKL 61
            P +KR K+ E      E     +DQ+ N   R  ++     Q  + ++  N KS TP+KL
Sbjct: 4    PNTKRQKVTEPESKTPE--QGTEDQQANASLRSPLQRPEHQQSISPIN--NSKSHTPRKL 59

Query: 62   ILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESSSRGRT-ARTYXXXXXXXXXXXXXXXX 120
            IL   D+     +     SSS Q P+L PP  SSSRGR   ++Y                
Sbjct: 60   ILGQNDN-RYAFSQPSVSSSSFQVPTLQPPDSSSSRGRKDIKSYSQSPPRSPGRSPK--- 115

Query: 121  TRKLELIQLSPVKNSRIALQKIYESKN-EKQIERLCIDKLVLHDFKSYAGTQVVGPFHSS 179
             R+LELIQLSPVKN+RI L+++Y++ N + + ERL I+KL L++FKSYAG QVVGPFH+S
Sbjct: 116  -RRLELIQLSPVKNNRIKLRELYDAHNSQSKKERLFINKLTLNNFKSYAGQQVVGPFHTS 174

Query: 180  FSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKSCSVEVHFEYV 239
            FSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQDRLSDLIHKSE FPDL SCSV+V F Y 
Sbjct: 175  FSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSEKFPDLTSCSVDVEFLYA 234

Query: 240  IDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDHNRFL 299
            ID+ DG T I+  K KLVI+RKAFKNN+SKYYINGKESNYT VTKLLK+EGIDLDH RFL
Sbjct: 235  IDEHDGDTKISETKPKLVISRKAFKNNSSKYYINGKESNYTDVTKLLKEEGIDLDHKRFL 294

Query: 300  ILQGEVENIAQMKPKAENXXXXXXXXXXXXIIGTAKYKPLIEKKFEEIEALNEICIEKEN 359
            ILQGEVENIAQMKPKAE             IIGT+KYK LIEK   EIE+LNEICIEKEN
Sbjct: 295  ILQGEVENIAQMKPKAEKESDDGLLEYLEDIIGTSKYKQLIEKDLIEIESLNEICIEKEN 354

Query: 360  RFEIVDREKASLESGXXXXXXXXXXXXXXXXXXXXXYQYKLWQDNKKLSTTLEKLSNIKE 419
            RFEIVDREK SLESG                      QY LWQ+N KL+ TL+K+S + E
Sbjct: 355  RFEIVDREKNSLESGKNLALEFLEKEKQLTLSKSKLLQYNLWQNNSKLTNTLQKISALNE 414

Query: 420  EFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTERVSLEEQRKN 479
            E+   K K+ T + ++N   +  +E    IK  + +EK+    KR  + E VSL+E+ KN
Sbjct: 415  EYNVEKSKNQTLQNEINRTKQLLNESQSKIKVLEGEEKQQLKSKRILEGEHVSLDEKLKN 474

Query: 480  IXXXXXXXXXXLEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIERGLLEEIKIS 539
            +          +    KTIS+   +I++L K++ EY  +L+ LN QLQ ER  LE +K+ 
Sbjct: 475  LTQKKAKTEKIIATTEKTISSLTSEIQELEKSQKEYSDELETLNQQLQSERESLEAMKLK 534

Query: 540  LKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLENDIENLNSL 599
            LK+KT   S+EI  HE +LEPWN+++Q KK++IQ+ ES+ISL++EG+VKL+NDI+ L+  
Sbjct: 535  LKEKTSGISEEILIHEHDLEPWNIKVQEKKTEIQLVESQISLLQEGQVKLKNDIKVLSQE 594

Query: 600  XXXXXXXXXXXXXXXXXLRNELNRITKEVSIGDTEYTNAKEKLREMKAVLNQHRQKAIDA 659
                             L+ + + ITKE+S G+TE  + + KL+EMK VLN  RQ+A +A
Sbjct: 595  VSNQTALKIKREEDLVNLKKQQSSITKEISNGETECNDGRSKLKEMKNVLNMQRQRASEA 654

Query: 660  RTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTACPRLNDLVVE 719
            R +L+  +N+ +VL +L++LQKSGRI GF+GRLGDLG ID+ YD+A+STACPRL+D+VVE
Sbjct: 655  RLALANVQNRGKVLTALYKLQKSGRIVGFHGRLGDLGTIDNTYDVAVSTACPRLDDIVVE 714

Query: 720  TVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVISSDPKFLPAF 779
            TVECGQQCIEYLRKNKLGYARFILL+KLR+F+ N I TP NVPRLFDL+   D KF+PAF
Sbjct: 715  TVECGQQCIEYLRKNKLGYARFILLDKLRSFNTNTIQTPKNVPRLFDLIKPKDSKFVPAF 774

Query: 780  YSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVXXXXXXXXXXXXXXLMKLTKSG 839
            YSVLRDTLV  +LK ANRVAYG +R+RVVTL G+LIDV              LM L + G
Sbjct: 775  YSVLRDTLVAKDLKQANRVAYGQRRYRVVTLDGKLIDVSGTMSGGGNHVSKGLMMLQRKG 834

Query: 840  NSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPDVELEISKFELE 899
             + F  Y  EDVE+IEK+L+ +EKNFE+AN  F EME EL++L +RKP++ELEISK  +E
Sbjct: 835  QNYFDDYNPEDVEQIEKDLSDKEKNFELANNAFYEMENELQKLNNRKPEIELEISKIIME 894

Query: 900  ITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSLQLETKSKKDRI 959
            I ++  E +  ++QL EK    +  + +NEEL      L  L+ ++ +LQ +TK+KK +I
Sbjct: 895  IDTYSAEIKSKERQLQEKTNIDNSELQDNEELKVAIENLQKLKEEHLALQDKTKAKKKKI 954

Query: 960  KFLKDEIMKVGGIKLQVQSSKVDSIIQKKDIXXXXXXXXXXXXXXAETELKRLSKKQSEC 1019
              LK++IMK+GGI+LQVQ+SKV SI+Q+ DI              ++TEL++  K     
Sbjct: 955  ASLKEKIMKIGGIELQVQNSKVTSIVQRIDILTAKQKKDRTSKKKSDTELEKAKKTLLTS 1014

Query: 1020 STDLLTSTDKLENTDGQLSKIXXXXXXXXXXXXXXXXXREESLQNSENLKDQLKEFEENL 1079
              D+   TD ++    ++ KI                 +E      + LKD++ + EEN+
Sbjct: 1015 KNDITLITDDIKEISERIDKISSSLNNIDKSIEEFQAHKETLKDECDELKDKVVDLEENI 1074

Query: 1080 NSFKVFQXXXXXXXXXXXXXXXXXXXDIRSTDSELQSLKIRDITHTLQELDNGNIDQDEE 1139
            N FK F+                    I++ +  L  L +R +   L  LD  +  +   
Sbjct: 1075 NEFKSFEIEVNNKLEKLNGLLNHIKNQIKTLEDSLSKLTLRKMHQVLMALDEESEAKAPN 1134

Query: 1140 DVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSPDANNDLEMEIDEDNNEISKGIPR 1199
            + ++ D  +     + L N+                    +D  M+ID     IS G+P 
Sbjct: 1135 NGTLSDEQIHDQTGHELTNTA-----------------VQDDDSMDIDNGAEVISNGLPI 1177

Query: 1200 ISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVAEYKRRKLDLNNAVDERE 1259
            +S+DE   +D+  +E +   L+ YI++ + NI+VLEEY +R+ E+K RKLDLN+AVD+RE
Sbjct: 1178 LSDDELSALDITLVETEVSDLEKYIESTDANIEVLEEYVKRLTEFKTRKLDLNDAVDKRE 1237

Query: 1260 KVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVTFSV 1319
             VR+ L++LKKTR+EEFM GFG+IS+TLKEMYQMITMGGNAELELVDSLDPFSEGVTFSV
Sbjct: 1238 TVRKQLEELKKTRYEEFMHGFGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVTFSV 1297

Query: 1320 MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1379
            MPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK
Sbjct: 1298 MPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1357

Query: 1380 ERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDIINRD 1427
            ERTKNAQFIVISLRNNMFELA+QLVGIYK  N+T SAT++N +I+N D
Sbjct: 1358 ERTKNAQFIVISLRNNMFELAQQLVGIYKCENRTHSATIKNREILNSD 1405

>TPHA0J00720 Chr10 (161017..165198) [4182 bp, 1393 aa] {ON} Anc_8.259
            YLR086W
          Length = 1393

 Score = 1329 bits (3439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 734/1391 (52%), Positives = 949/1391 (68%), Gaps = 26/1391 (1%)

Query: 37   KVSPTTQDAA-AVSHLNFKSQTPKKLILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESS 95
            K++ +  D+   V++   KS TP K+I+ +  S +I+P  +   SSS Q PSL  P+ SS
Sbjct: 27   KIAQSRNDSPLQVANDPLKSYTPMKVIISNNHSNSISPLPSQLMSSSTQPPSLQHPS-SS 85

Query: 96   SRGRTARTYXXXXXXXXXXXXXXXXTRKLELIQLSPVKNSRIALQKIYESKNEKQIERLC 155
            SRGR  + Y                TRKLELIQLSP+KNSR  LQKIY SK E++IER+C
Sbjct: 86   SRGRAVKAYSQSPPRSPDRSPVRSPTRKLELIQLSPIKNSRSELQKIYSSKQEEKIERIC 145

Query: 156  IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLS 215
            ++KLVLH+FKSYAGTQ +GPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQ +L+
Sbjct: 146  LNKLVLHNFKSYAGTQTIGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLA 205

Query: 216  DLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGK 275
            DLIHKSE +PDL SC+V+VHFEY+ID PD TT IN  K+ L+ITR+AFKN+TSKYY+NGK
Sbjct: 206  DLIHKSEEYPDLTSCAVDVHFEYLIDYPDDTTKINPSKQPLIITRRAFKNSTSKYYLNGK 265

Query: 276  ESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPKAENXXXXXXXXXXXXIIGTAK 335
            ESNY ++T LLK+EGIDLDHNRFLILQGEVENIAQMKPKAE             IIGT K
Sbjct: 266  ESNYKTITALLKEEGIDLDHNRFLILQGEVENIAQMKPKAEKEGDDGLLEYLEDIIGTTK 325

Query: 336  YKPLIEKKFEEIEALNEICIEKENRFEIVDREKASLESGXXXXXXXXXXXXXXXXXXXXX 395
            YK LI+KKF EIEALN+ICIE+ENRF+I+DREK SLES                      
Sbjct: 326  YKELIDKKFIEIEALNDICIERENRFDIIDREKESLESEKESALEYLSKEKEQVIVKSKL 385

Query: 396  YQYKLWQDNKKLSTTLEKLSNIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQ 455
             QYK+WQ+N KLS TLEK++ +++E+ + K K++  + +++E+ K Y +    ++A  + 
Sbjct: 386  IQYKIWQNNIKLSNTLEKITKLEDEYNQEKNKNTELKNKIDELRKLYTKNQDELQALLKD 445

Query: 456  EKKLNIQKRNYDTERVSLEEQRKNIXXXXXXXXXXLEDCNKTISNTKIKIEDLGKNESEY 515
            EK+L   KR+ D++ VS  EQ KNI          +E+  KTIS++ +++++   N+  +
Sbjct: 446  EKELVNAKRSLDSDNVSNTEQLKNIEKKLKKTAKEIEEDLKTISSSNVRLKNFHDNKKLF 505

Query: 516  ESQLDELNAQLQIERGLLEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVK 575
            E+QL EL+  L  E  LLE IK+ LKDKT+  S+EI + EK+LEPWN++L   KS+IQ+K
Sbjct: 506  ETQLIELDNNLVTESQLLENIKLDLKDKTVGLSEEILKTEKDLEPWNIKLDELKSEIQIK 565

Query: 576  ESEISLIKEGRVKLENDIENLNSLXXXXXXXXXXXXXXXXXLRNELNRITKEVSIGDTEY 635
            ESE +L +E + KL+ +IE L                    L  +L  ++KEV  G  E 
Sbjct: 566  ESEKALFEESKNKLKANIEALEKDVNEKSKLTEDRRKEVKNLMTKLENVSKEVIFGTNEL 625

Query: 636  TNAKEKLREMKAVLNQHRQKAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDL 695
              A EKL EM+ +L Q RQKA DARTSLS  EN+++VL +L +LQKSGRI+GF+GRLG+L
Sbjct: 626  KKANEKLCEMQKILIQDRQKANDARTSLSNVENRSKVLRALLKLQKSGRINGFHGRLGNL 685

Query: 696  GAIDDRYDIAISTACPRLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKI 755
            G ID++YD+AISTACPRLND+VV++VECGQQCIEYLRKN LG+ARFILL+KL  F M KI
Sbjct: 686  GVIDEKYDVAISTACPRLNDIVVDSVECGQQCIEYLRKNNLGHARFILLDKLNKFSMEKI 745

Query: 756  STPNNVPRLFDLVISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELI 815
            STP NVPRLFDL+  +D KFLPAFYSVLR+TLV N+LK+AN VAYG  R+RVVTL G LI
Sbjct: 746  STPRNVPRLFDLIKVNDEKFLPAFYSVLRNTLVANDLKEANAVAYGKTRYRVVTLKGNLI 805

Query: 816  DVXXXXXXXXXXXXXXLMKLTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEM 875
            D+               M+L+ S +    +Y+ E+V +IEKEL+ REKN++ A  T  EM
Sbjct: 806  DISGTMSGGGNQASKGAMQLSNSTSKEKSTYSSEEVMEIEKELSIREKNYQNAYNTVQEM 865

Query: 876  ETELRRLKDRKPDVELEISKFELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTME 935
            E ELR LK+ +P +ELEISK   EI S   E  L ++QLNE   S     + + +++ M+
Sbjct: 866  EIELRNLKESEPKIELEISKLNFEIDSLENECSLKRKQLNEPNASFSIEDNMSADITEMD 925

Query: 936  HELGTLQNDYKSLQLETKSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDIXXXXX 995
            + L TL    K ++ + KSKKDRIK L+D+IMK+GGIKLQ+Q+SKVDS+ ++K I     
Sbjct: 926  NALYTLNEKQKLIESQMKSKKDRIKELQDKIMKIGGIKLQMQNSKVDSLQEQKKILIKKQ 985

Query: 996  XXXXXXXXXAETELKRLSKKQSECSTDLLTSTDKLENTDGQLSKIXXXXXXXXXXXXXXX 1055
                      E+++++LSKK  E  +D     +K    + +L  I               
Sbjct: 986  KSEKAGIMKIESDVRKLSKKLKESESDNTKLNEKKIALENELKNIEELLAQNENNMNCIQ 1045

Query: 1056 XXREESLQNSENLKDQLKEFEENLNSFKVFQXXXXXXXXXXXXXXXXXXXDIRSTDSELQ 1115
              +    + SE   ++L E E  L+ FK  +                    +++ + +  
Sbjct: 1046 DKKFTLREKSEITMNELTEMEGLLSEFKTLEVEYKIKSEKLASLLNQIKKILKALEEDHS 1105

Query: 1116 SLKIRDITHTLQELDNGNIDQDEEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVS 1175
            SL IR++ +   +LD  NI +++E   +K    +                + E N+S+  
Sbjct: 1106 SLSIREVAY---DLDLLNI-KEQEAQKIKTELYA----------------DFEQNQSN-- 1143

Query: 1176 PDANNDLEMEIDEDNNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLE 1235
             D  ND EM I+++NNEI+KGIP   E +FK  D+  LEA+ +QLQDY +   V++D+LE
Sbjct: 1144 -DVIND-EMIIEDNNNEIAKGIPSYMESDFKQFDISSLEAELVQLQDYFEIAKVDLDILE 1201

Query: 1236 EYARRVAEYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMIT 1295
            EY RR+ EY++RK DLN +V++R+KVR+ L+ LKK RF EFM+ F +IS+TLKEMYQ+IT
Sbjct: 1202 EYTRRMIEYRQRKYDLNQSVEQRDKVRKELEDLKKCRFNEFMESFNIISMTLKEMYQIIT 1261

Query: 1296 MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTP 1355
            MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTP
Sbjct: 1262 MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTP 1321

Query: 1356 LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKS 1415
            LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYK+ NQTKS
Sbjct: 1322 LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKNVNQTKS 1381

Query: 1416 ATLQNNDIINR 1426
            ATL+NNDI+ R
Sbjct: 1382 ATLKNNDILCR 1392

>SAKL0H17094g Chr8 complement(1508021..1512289) [4269 bp, 1422 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1422

 Score = 1308 bits (3385), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 718/1411 (50%), Positives = 943/1411 (66%), Gaps = 51/1411 (3%)

Query: 36   IKVSPTTQDAAAVSHLNFKSQTPKKLILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESS 95
            +K SPT QD          S TP+KL+L   +        +   SSSL  P+L PP    
Sbjct: 40   VKSSPTRQD-------RLPSPTPRKLVLGSPEKKYAYSQPST--SSSLSVPNLQPPNVDG 90

Query: 96   SRGRTARTYXXXXXXXXXXXXXXXXTRKLELIQLSPVKNSRIALQKIYESKNE---KQIE 152
            SRGR  R Y                TR+LELIQLSPVKN+R  LQKIY+ KN+   + + 
Sbjct: 91   SRGR--RFYSQSPPRSPHRSPNRSPTRRLELIQLSPVKNNRAELQKIYDEKNKDGNQCVH 148

Query: 153  RLCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQD 212
            RLCIDKL LH+FKSYAGTQ++GPFH+SFSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQ 
Sbjct: 149  RLCIDKLSLHNFKSYAGTQIIGPFHTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQG 208

Query: 213  RLSDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYI 272
            +LSDLIHKSE +P+L+SCSV++HF YV+D+ DGTT  +  K  +VITRKAF+NN+SKYYI
Sbjct: 209  KLSDLIHKSEAYPNLESCSVDIHFRYVVDESDGTTRSDDEKPPMVITRKAFRNNSSKYYI 268

Query: 273  NGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPKAENXXXXXXXXXXXXIIG 332
            +GKESNYT VT+LL+D+GIDLDH RFLILQGEVE+I+QMKPKAE             IIG
Sbjct: 269  DGKESNYTEVTQLLRDQGIDLDHKRFLILQGEVESISQMKPKAERESDDGLLEYLEDIIG 328

Query: 333  TAKYKPLIEKKFEEIEALNEICIEKENRFEIVDREKASLESGXXXXXXXXXXXXXXXXXX 392
            TAKYK  IE    EI+ LN++C+EKENRFE+V++EK SLESG                  
Sbjct: 329  TAKYKAGIEAGLVEIDTLNDVCVEKENRFELVEKEKNSLESGKDEALEFLEKEKSLTLLK 388

Query: 393  XXXYQYKLWQDNKKLSTTLEKLSNIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKAS 452
                QY +WQD +KLS TL K+S + E   + K K+   + ++ ++ +  ++  K +   
Sbjct: 389  SKLAQYHIWQDQRKLSETLGKISELNEHLGQEKAKYDQFQREVAQLRERCNDFKKQMVKL 448

Query: 453  QEQEKKLNIQKRNYDTERVSLEEQRKNIXXXXXXXXXXLEDCNKTISNTKIKIEDLGKNE 512
             ++ K L  ++R  D E+ S+EE+++N+          L+    +++++K K+E+L  ++
Sbjct: 449  DKEHKDLTSKRRLMDREKTSMEEKQRNLDKKRLKAEKLLKSTENSMADSKHKLEELNNSQ 508

Query: 513  SEYESQLDELNAQLQIERGLLEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQI 572
             +Y+ +L +LN  L  ER  L+EIK+SL+DKT E S EI+ HE++LEPWN QLQ KKSQ+
Sbjct: 509  KQYKEKLLQLNESLLEERSKLDEIKLSLRDKTSEISAEIANHERDLEPWNAQLQEKKSQM 568

Query: 573  QVKESEISLIKEGRVKLENDIENLNSLXXXXXXXXXXXXXXXXXLRNELNRITKEVSIGD 632
            ++ ES+I+++KE + K   +I  L +                  L+ E   I K + IG+
Sbjct: 569  KLTESQIAILKESKEKKVQNIIQLKTEIEAFAEKNNVQEIAIHKLQCEQANILKRIDIGE 628

Query: 633  TEYTNAKEKLREMKAVLNQHRQKAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRL 692
             E  +A  KL EMK VL  HRQ+A++AR++LS  ENKN+VL++L RLQ+SGRI+GF+GRL
Sbjct: 629  KECGSASSKLGEMKNVLISHRQRAMEARSTLSNVENKNKVLSALIRLQRSGRIAGFHGRL 688

Query: 693  GDLGAIDDRYDIAISTACPRLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDM 752
            GDLG IDD YD+AISTACPRL+D+VV+ VECGQQCIE+LRKNKLGYARFI+L+KLR F++
Sbjct: 689  GDLGTIDDMYDVAISTACPRLDDIVVDNVECGQQCIEHLRKNKLGYARFIILDKLRKFNL 748

Query: 753  NKISTPNNVPRLFDLVISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSG 812
            + I TP  VPRLFDLV S + KFLPAFYSVLRDTLVV++LK ANRVAYG +RFRVVTL G
Sbjct: 749  SPIQTPETVPRLFDLVRSKNGKFLPAFYSVLRDTLVVSDLKQANRVAYGKRRFRVVTLDG 808

Query: 813  ELIDVXXXXXXXXXXXXXXLMKLTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETF 872
            +LID               LMK  +   +G   YT E+V+ IEKEL  REKNF IA ETF
Sbjct: 809  KLIDTSGTLSGGGTHVMKGLMKSKQQPGAG---YTPEEVQNIEKELNEREKNFHIAIETF 865

Query: 873  TEMETELRRLKDRKPDVELEISKFELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELS 932
             +ME  L++ KDR+P++E+EI+K  L+I S  TE +L Q+QL E +   D     + EL+
Sbjct: 866  HDMEEALKKFKDREPEIEVEIAKRRLDIESSSTELKLKQEQLKELETDRDGGSVEDRELA 925

Query: 933  TMEHELGTLQNDYKSLQLETKSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDIXX 992
              E +L  L  +Y  ++ ETK+K+  I  LK++IMK+GG KLQ+Q+SKV+SI ++ +I  
Sbjct: 926  DAESKLQVLSEEYDEIENETKNKQQLINSLKEKIMKIGGTKLQLQNSKVNSINEQINIIS 985

Query: 993  XXXXXXXXXXXXAETELKRLSKKQSECSTDLLTSTDKLENTDGQLSKIXXXXXXXXXXXX 1052
                        AE +LKRL  +  E S D+       E+ + ++SKI            
Sbjct: 986  SKQKKDRTATKKAENDLKRLENQCREASNDI-------ESCNLEISKISVLNTELEAKIY 1038

Query: 1053 XXXXXREESLQNSENLKDQ-----------LKEFEENLNSFKVFQXXXXXXXXXXXXXXX 1101
                  + SL  +E+LK++           L+E   N + FK  +               
Sbjct: 1039 KL----DTSLNETESLKEEVEEEFERVKTNLEEKTNNTSDFKSVEIEINNRLEKLNGLTS 1094

Query: 1102 XXXXDIRSTDSELQSLKIRDITHTLQELDNGNI-DQDEEDVSMKDNAVS------VSANN 1154
                +I+    EL SLKIRDIT TLQ L+ G + +++E+D  ++D  V        S  N
Sbjct: 1095 HIKKEIKYNKDELNSLKIRDITQTLQALNEGKLPEENEDDFEVQDEEVQREQREMSSDPN 1154

Query: 1155 SLGNSENMEGVEIETNESDVSPDANNDLEMEIDEDNNEISKGIPRISEDEFKNVDVEELE 1214
            ++   E     + +  ++D   D+     M+IDE  NE S G+P+ SE + +++ +E++E
Sbjct: 1155 AMDIDEEQAAEQFQVQQTDGEIDS-----MDIDEYENETSNGLPKFSEAQLQSIQIEDVE 1209

Query: 1215 AQKLQLQDYIDTVNVNIDVLEEYARRVAEYKRRKLDLNNAVDEREKVRELLDKLKKTRFE 1274
             Q  +L  Y+D  +V+IDVLEEYARR+AEYK+RKLDLN AV +R++VR+  ++LKK R +
Sbjct: 1210 LQIDELNHYVDNAHVDIDVLEEYARRLAEYKKRKLDLNQAVLKRDEVRKNCEELKKKRLD 1269

Query: 1275 EFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSG 1334
            +FM+GF +IS+TLKEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSG
Sbjct: 1270 KFMEGFSIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSG 1329

Query: 1335 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN 1394
            GEKTLSSLALVFALHKY+PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN
Sbjct: 1330 GEKTLSSLALVFALHKYRPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRN 1389

Query: 1395 NMFELAEQLVGIYKSNNQTKSATLQNNDIIN 1425
            NMFELA+QLVGIYK+NN T+S TLQN DI+N
Sbjct: 1390 NMFELAQQLVGIYKNNNMTRSTTLQNIDILN 1420

>ZYRO0C01716g Chr3 complement(130331..134572) [4242 bp, 1413 aa] {ON}
            similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1413

 Score = 1277 bits (3304), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 711/1390 (51%), Positives = 943/1390 (67%), Gaps = 19/1390 (1%)

Query: 40   PTTQDAA-AVSHLNFKSQTPKKLILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESSSRG 98
            PTT  +    +H    ++TP+KL++ + D+     ++    SSSLQ P L PP  +SSRG
Sbjct: 37   PTTSSSQNTFAH----AKTPRKLVVGNGDN-RYAHSSQSISSSSLQVPPLQPPA-TSSRG 90

Query: 99   RTARTYXXXXXXXXXXXXXXXXTRKLELIQLSPVKNSRIALQKIYESK-NEKQIERLCID 157
            R ++TY                TRKLELIQ+SP+KNSR+ LQKIY+++ N+ +  RLCID
Sbjct: 91   RGSKTYSQSPPRSPGRSP----TRKLELIQISPLKNSRLELQKIYDAQQNQARHTRLCID 146

Query: 158  KLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDL 217
            +L+L DFKSYAG QVVGPF++SFSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQDRLSDL
Sbjct: 147  QLILQDFKSYAGRQVVGPFNTSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDL 206

Query: 218  IHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKES 277
            IHKSE +P L SCSVEVHF+YVID+P G T I+  K  LV+TRKAF+NNTSKYY+N +E+
Sbjct: 207  IHKSEEYPSLPSCSVEVHFKYVIDEPSGETRIDEEKPNLVVTRKAFRNNTSKYYVNDQET 266

Query: 278  NYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPKAENXXXXXXXXXXXXIIGTAKYK 337
            NY  VTKLLK EG+DLDH RFLILQGEVENIAQMK KAE             IIGTAKYK
Sbjct: 267  NYGEVTKLLKKEGVDLDHKRFLILQGEVENIAQMKSKAEREGEDGLLEYLEDIIGTAKYK 326

Query: 338  PLIEKKFEEIEALNEICIEKENRFEIVDREKASLESGXXXXXXXXXXXXXXXXXXXXXYQ 397
            PLIEK   ++E+LN+ICIEKENRF+IVDREK SLE+G                     YQ
Sbjct: 327  PLIEKNLADMESLNDICIEKENRFQIVDREKNSLENGKEEALLFLENERKLTVSKSKLYQ 386

Query: 398  YKLWQDNKKLSTTLEKLSNIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEK 457
            Y +   N KL  TL+K++N+ ++ E+   K+++ + +++++     E+   +K    +EK
Sbjct: 387  YHILNSNMKLKNTLDKITNLNQKLEKESDKNASVKKELDKLRAFGDELESKLKNCNNEEK 446

Query: 458  KLNIQKRNYDTERVSLEEQRKNIXXXXXXXXXXLEDCNKTISNTKIKIEDLGKNESEYES 517
            +L  +KR  D + V  EE+ KN           L   +++IS+++ ++ +L + + +YE+
Sbjct: 447  QLLGKKRELDGKNVLNEEKIKNFEKKRDKAEKTLSSMDRSISSSEARLSELKQLQVDYEN 506

Query: 518  QLDELNAQLQIERGLLEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKES 577
             L ELN Q ++E+  LE+IK SLKDKT   S EI+Q EKELEPWN QLQ KK+QIQ+ ES
Sbjct: 507  SLKELNEQTEVEKMKLEKIKFSLKDKTNGISLEIAQLEKELEPWNAQLQEKKTQIQLAES 566

Query: 578  EISLIKEGRVKLENDIENLNSLXXXXXXXXXXXXXXXXXLRNELNRITKEVSIGDTEYTN 637
            +ISLIKE   KL  +I+                      L ++   + +E+S G+ E  N
Sbjct: 567  QISLIKEAEAKLAQEIDQFKQEIETRKQQILQGSKELDSLHSQHKSVKEEISTGEKECLN 626

Query: 638  AKEKLREMKAVLNQHRQKAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGA 697
            A+ +L+EM+ +LN  RQKA+DAR++LS  ENK++VL +L RLQKSGRISGF+GRLGDLG 
Sbjct: 627  ARIRLKEMQNILNTQRQKALDARSALSNAENKSKVLTALSRLQKSGRISGFHGRLGDLGV 686

Query: 698  IDDRYDIAISTACPRLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKIST 757
            ID++YD+AISTACPRL D+VVETVECGQQCIEYLRKNKLGYARFILL+KLR F+++ I+T
Sbjct: 687  IDEKYDVAISTACPRLEDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRKFNLDSINT 746

Query: 758  PNNVPRLFDLVISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDV 817
            P +VPRLFDL+   DPKF  AF+SVL +TLV N+LK ANRVAYG KRFRVVTL G LID+
Sbjct: 747  PESVPRLFDLIHPKDPKFSSAFFSVLGNTLVANDLKQANRVAYGKKRFRVVTLDGNLIDI 806

Query: 818  XXXXXXXXXXXXXXLMKLTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMET 877
                          LM++ ++     + Y+ E+V ++E  L  REKNF++A++T  +ME 
Sbjct: 807  SGTMSGGGSRVSRGLMQINRNKTEDIEIYSSEEVAQLEVNLVEREKNFQVASDTIYQMEE 866

Query: 878  ELRRLKDRKPDVELEISKFELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHE 937
            +L+ LK+++P +E  IS+  +EI SW +E ++ + Q+ E +++      NN EL      
Sbjct: 867  QLKDLKEKEPAIENNISQLTMEIESWNSEIKIKEIQMLESERAYSATQDNNVELRETIQH 926

Query: 938  LGTLQNDYKSLQLETKSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDIXXXXXXX 997
            + +L++++KS+Q +TKSKK RI+ LK+EIM++GG +L++QSSKVDS+IQ+ DI       
Sbjct: 927  VQSLKDEFKSIQNQTKSKKHRIETLKNEIMEIGGAELKIQSSKVDSVIQRIDIVVSKQKK 986

Query: 998  XXXXXXXAETELKRLSKKQSECSTDLLTSTDKLENTDGQLSKIXXXXXXXXXXXXXXXXX 1057
                    E E+ +  K + E S DL     +++     +  +                 
Sbjct: 987  ERSVIKKTENEINKSHKMKLETSRDLENFNQEIQTLKTTIEGLQDSLNKVHESVTSVQHT 1046

Query: 1058 REESLQNSENLKDQLKEFEENLNSFKVFQXXXXXXXXXXXXXXXXXXXDIRSTDSELQSL 1117
            +E  ++ S  L+D+L +  E++  FK F+                   +I+  + +L  L
Sbjct: 1047 KEGLIEESRTLEDKLNDINEDIAIFKSFEMEMKNELEKLNSLSFHLKKEIKHYEEKLGDL 1106

Query: 1118 KIRDITHTLQEL-DNGNIDQDEEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSP 1176
            KIRD+T  L +L D  N   D  +  + D   S S+    G  EN + ++ +    D   
Sbjct: 1107 KIRDVTQILHDLKDESNNASDPSENPVSDVEESESSVGE-GKDENKD-LDAQDQVQDAEK 1164

Query: 1177 DANNDLEMEIDEDNNEIS-KGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLE 1235
              +N +++   ED  E S +G+ + SEDE   +++EELE +   LQ+++D  N +IDVLE
Sbjct: 1165 QGDNQMDV---EDGGEYSDRGLTQFSEDELHEIEIEELEKEIEDLQNFLDASNADIDVLE 1221

Query: 1236 EYARRVAEYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMIT 1295
            EYARR+ E+K R+LDLN AV+ER KV+E LD+LKK RF+EFMQGFG+IS+TLKEMYQMIT
Sbjct: 1222 EYARRLIEFKSRRLDLNQAVEERNKVKEKLDELKKKRFDEFMQGFGIISMTLKEMYQMIT 1281

Query: 1296 MGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTP 1355
            MGGNAELELVD+LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTP
Sbjct: 1282 MGGNAELELVDTLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTP 1341

Query: 1356 LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKS 1415
            LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK +N+TKS
Sbjct: 1342 LYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKRDNKTKS 1401

Query: 1416 ATLQNNDIIN 1425
            AT++N D ++
Sbjct: 1402 ATIKNIDFVS 1411

>NDAI0B01970 Chr2 (479208..483455) [4248 bp, 1415 aa] {ON} Anc_8.259
            YLR086W
          Length = 1415

 Score = 1276 bits (3302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 731/1436 (50%), Positives = 943/1436 (65%), Gaps = 39/1436 (2%)

Query: 1    MPKT---PLSKRPKLVEANLNANELDHNDDDQRYNRQEIKVSPT----TQDAAAVSHLNF 53
            MP++   P  KR K++E+        H  + Q  NR+E   SP      Q A ++S    
Sbjct: 1    MPESTNIPSPKRQKVLES--------HTPEQQEENRREDDESPLRFEHQQSAVSLSPPAI 52

Query: 54   -KSQTPKKLILRDYDS-IAIT-PTAAMPPSSSLQAPSLHPPTESSSRGRTARTYXXXXXX 110
             KS TP+KLIL   D+  A + PT +   +SSLQ PSL PP E+SS     R        
Sbjct: 53   SKSHTPRKLILHQSDNRYAFSQPTVS---ASSLQVPSLQPP-ETSSSSSRGRRDIKVYSQ 108

Query: 111  XXXXXXXXXXTRKLELIQLSPVKNSRI-ALQKIYESKNEKQIERLCIDKLVLHDFKSYAG 169
                      TRKLELIQLSPVKN+RI  LQ++Y S+ +K  ERL I+KLVL++FKSYAG
Sbjct: 109  SPPRSPGRSPTRKLELIQLSPVKNNRIRKLQELYNSQIKK--ERLFINKLVLNNFKSYAG 166

Query: 170  TQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKS 229
             QV+GPF+++FSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQDRLSDLIHKSE+FP+L S
Sbjct: 167  EQVIGPFNTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSESFPNLPS 226

Query: 230  CSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDE 289
            CSV+V F+YV+DK +G++ I+  K KL+ITRKAFKNN+SKY+INGKES+YT VTKLLK+E
Sbjct: 227  CSVDVEFQYVVDKSNGSSKIDDNKPKLIITRKAFKNNSSKYFINGKESSYTEVTKLLKEE 286

Query: 290  GIDLDHNRFLILQGEVENIAQMKPKAENXXXXXXXXXXXXIIGTAKYKPLIEKKFEEIEA 349
            GIDLDH RFLILQGEVENIAQMKPKAE             IIGTA YK  IEK   E++ 
Sbjct: 287  GIDLDHKRFLILQGEVENIAQMKPKAEREGDDGLLEYLEDIIGTADYKSSIEKNTIEVDT 346

Query: 350  LNEICIEKENRFEIVDREKASLESGXXXXXXXXXXXXXXXXXXXXXYQYKLWQDNKKLST 409
            LNEICIEKENRFEIV+REK SLES                       QY + ++++KL++
Sbjct: 347  LNEICIEKENRFEIVEREKNSLESSKNAALEFVKKERRLTLSKSKLLQYNILKEHEKLAS 406

Query: 410  TLEKLSNIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTE 469
            TL+KLS ++EE++    K   T+ + N++  ++ +M K I + +E  K    +KR    +
Sbjct: 407  TLQKLSVLQEEYQNESTKFENTQRETNKLEDNFKQMNKKIVSIKEDMKNNTSKKRELQNK 466

Query: 470  RVSLEEQRKNIXXXXXXXXXXLEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIE 529
            + SLEE+ K+           +    K + N + +IE L  ++ E ES L  L ++L+ E
Sbjct: 467  KASLEEKIKSYTRKKEKASKSIAQSKKLLKNYRNEIETLNVDQQERESNLQSLLSELKKE 526

Query: 530  RGLLEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKL 589
            + +LEEIK+SLKDKT + S+EI+QHE+ELEPW  QLQ KK +IQV ES+ISL++E + KL
Sbjct: 527  KNVLEEIKLSLKDKTTDISNEIAQHERELEPWKKQLQEKKLEIQVAESQISLLQENQSKL 586

Query: 590  ENDIENLNSLXXXXXXXXXXXXXXXXXLRNELNRITKEVSIGDTEYTNAKEKLREMKAVL 649
            +++IE L +                  L+ + + I+ E   G++E  NAK K+++M+ VL
Sbjct: 587  KDEIEKLKNDLKCQFENKKNQEEKLIDLKVQFSAISTEFDRGESECANAKSKIKDMQHVL 646

Query: 650  NQHRQKAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTA 709
               RQK +DAR+ L+  ENK++VL++L +LQKSGRISGFYGRLGDLG ID+ YDIAISTA
Sbjct: 647  QTQRQKVMDARSRLATVENKSKVLSALHKLQKSGRISGFYGRLGDLGVIDNEYDIAISTA 706

Query: 710  CPRLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVI 769
              RL+D+VV++VECGQ CIEYLRKNKLGYARFILLEKLRN  + +I TP NV RLFDLV 
Sbjct: 707  SARLDDIVVDSVECGQHCIEYLRKNKLGYARFILLEKLRNLILKRIQTPENVKRLFDLVK 766

Query: 770  SSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVXXXXXXXXXXXX 829
                 F+PAFYSVLR+TLV  +LK ANRVAYG  RFRVVT+ G+LID+            
Sbjct: 767  PDKDIFIPAFYSVLRNTLVAKDLKQANRVAYGATRFRVVTMDGKLIDISGTITGGGKQTA 826

Query: 830  XXLMKLTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPDV 889
              LMKL K G      Y+ +D+EKIEKEL  RE NF+ AN+T+ EME  L+RLKDRKP++
Sbjct: 827  QGLMKLRKKGQENIDIYSNDDIEKIEKELVERENNFKFANDTYFEMEQALQRLKDRKPEL 886

Query: 890  ELEISKFELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSLQ 949
            ELEISK  ++      E E  Q QL +K    +    N +E+  +EH+L  LQ +Y+ L 
Sbjct: 887  ELEISKCLMDTDISSKELESTQDQLKQKITFYERHTQNKDEVVEIEHQLNLLQKEYQLLL 946

Query: 950  LETKSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDIXXXXXXXXXXXXXXAETEL 1009
              TK+  ++I  LK  IM++GGI LQ+Q+SKV+SIIQ  DI               E E+
Sbjct: 947  DSTKNISEKIDKLKKRIMEIGGIDLQMQNSKVNSIIQNIDIIKSKQKRGISSMKKIENEI 1006

Query: 1010 KRLSKKQSECSTDLLTSTDKLENTDGQLSKIXXXXXXXXXXXXXXXXXREESLQNSENLK 1069
            +R  K  S    D  T + ++++   ++  +                   E      NLK
Sbjct: 1007 RRSEKALSGAELDFKTCSKEMDSFSQEMESVERSLGSIDETFLKLENENSELEIECCNLK 1066

Query: 1070 DQLKEFEENLNSFKVFQXXXXXXXXXXXXXXXXXXXDIRSTDSELQSLKIRDITHTL-QE 1128
            +++ E E     FK ++                    I+  D +L++L++R+ T     E
Sbjct: 1067 EKINEAEIEGTKFKSYEIDVKDRLEKLNNLLKHIKRVIKEYDEQLRALELRNTTTIFGDE 1126

Query: 1129 LDNGNIDQDEEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSPDANNDLEMEIDE 1188
             DN +I+    D +     V +   N +    NM     E N ++         EMEID+
Sbjct: 1127 GDNNSING--VDRTSHGGGVPLQDQNKVVRENNMRN---EKNSTEA--------EMEIDD 1173

Query: 1189 DNNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVAEYKRRK 1248
              +E S GIPRIS+ +   +DV+ LEA+  QL++Y+   NVNIDVLEEYARR+A+Y  RK
Sbjct: 1174 VADEFSPGIPRISKAKLLQIDVQALEAEIGQLEEYVAITNVNIDVLEEYARRLADYNSRK 1233

Query: 1249 LDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSL 1308
            LDLN AV+ RE +++LLD+LKK R++EFMQGFG+IS+TLKEMYQMITMGGNAELEL+DSL
Sbjct: 1234 LDLNQAVERREALKKLLDELKKKRYDEFMQGFGIISMTLKEMYQMITMGGNAELELIDSL 1293

Query: 1309 DPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1368
            DPFSEGVTFSVMPPKKSWRNI NLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF
Sbjct: 1294 DPFSEGVTFSVMPPKKSWRNIANLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1353

Query: 1369 RNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDII 1424
            RNVSIVANYIKERTKNAQFIVISLRNNMFELA+QL+GIYK +N+TKSA ++N D +
Sbjct: 1354 RNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKRDNKTKSAAIRNKDFL 1409

>Kwal_56.23825 s56 complement(721498..725688) [4191 bp, 1396 aa] {ON}
            YLR086W (SMC4) - SMC chromosomal ATPase family member
            [contig 172] FULL
          Length = 1396

 Score = 1269 bits (3285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 705/1385 (50%), Positives = 915/1385 (66%), Gaps = 34/1385 (2%)

Query: 54   KSQTPKKLILRDYDS-IAITPTAAMPPSSSLQAPSLHPPTE--SSSRGRTARTYXXXXXX 110
            +S+TP+KL+L   D   A +   +   SSS   P L P     SSSRGR           
Sbjct: 33   RSRTPRKLVLGSPDKRFAFSQPVS---SSSSNVPHLQPLKNELSSSRGRV-------YSQ 82

Query: 111  XXXXXXXXXXTRKLELIQLSPVKNSRIALQKIYESKNE-KQIERLCIDKLVLHDFKSYAG 169
                      TRKLELIQLSP+K SR+  QK  ES+     I+RLCID+LVLH+FKSYAG
Sbjct: 83   SPPRSPNRSPTRKLELIQLSPMKKSRLESQKFQESRAMMGSIQRLCIDRLVLHNFKSYAG 142

Query: 170  TQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKS 229
            TQVVGPFH+SFSAVVGPNGSGKSNVIDS+LFVFGFRA+KMRQ +LS+LIHKSE  PDL S
Sbjct: 143  TQVVGPFHNSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSELIHKSELHPDLDS 202

Query: 230  CSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDE 289
            C V++ F+YV D+PDGTT I   K  +VI RKAF+NNTSKYY+NGKES+YT +T+LL+DE
Sbjct: 203  CHVDIFFQYVQDEPDGTTSIIQQKPSMVIRRKAFRNNTSKYYLNGKESSYTIITQLLRDE 262

Query: 290  GIDLDHNRFLILQGEVENIAQMKPKAENXXXXXXXXXXXXIIGTAKYKPLIEKKFEEIEA 349
            GIDLDH RFLILQGEVE+IAQMKPKAE             IIGTA+YKPLIE    EI  
Sbjct: 263  GIDLDHKRFLILQGEVESIAQMKPKAEKESDDGLLEYLEDIIGTAQYKPLIENTLSEIAK 322

Query: 350  LNEICIEKENRFEIVDREKASLESGXXXXXXXXXXXXXXXXXXXXXYQYKLWQDNKKLST 409
            LN+IC EKENRFEIV+REK+SLE G                      QY LW++ +KL++
Sbjct: 323  LNDICEEKENRFEIVEREKSSLEQGKNEALEYLEKEKTLTILRSKLLQYHLWKNEQKLNS 382

Query: 410  TLEKLSNIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTE 469
            T EK++  +E+    K K +    +M  +      +   +    E EKKL ++KR  D +
Sbjct: 383  TKEKIAKAQEKLSAEKAKRTKHSEEMAAMKADLQSLKLILGDLGESEKKLTLEKRACDRD 442

Query: 470  RVSLEEQRKNIXXXXXXXXXXLEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIE 529
            RVSLEE+ KN+          L+    +IS T+ K+E+L  ++ ++E  L ELN  ++ E
Sbjct: 443  RVSLEEKLKNLTQKEVKSSRSLQSITSSISTTQAKMEELANDQEQHEKDLLELNGTMKEE 502

Query: 530  RGLLEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKL 589
            +  L+EIK SLKDK    S++I + EKELEPWN++LQ KK+Q++++E+ IS+ KE   K+
Sbjct: 503  KEKLDEIKSSLKDKISLISEQIREIEKELEPWNVKLQEKKAQVKLEETTISVFKESHAKI 562

Query: 590  ENDIENLNSLXXXXXXXXXXXXXXXXXLRNELNRITKEVSIGDTEYTNAKEKLREMKAVL 649
            E DI  +N                   L  E   I +++++G +E  NA +K++EMK +L
Sbjct: 563  EQDIILVNKGIDELRNKMNEQRGSVFSLEKEQVDIGRQLTVGQSECDNAVKKIKEMKGIL 622

Query: 650  NQHRQKAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTA 709
              HRQ++IDAR+SLS  ENKN+VLA+L RLQ+SGRISGF+GRLGDLG IDD+YD+AISTA
Sbjct: 623  TAHRQRSIDARSSLSTFENKNKVLAALLRLQRSGRISGFHGRLGDLGTIDDKYDVAISTA 682

Query: 710  CPRLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVI 769
            CPRL+D+VVETVECGQQCIEYLRKNKLGYARFILL+KLRNF+++ I TP NVPRL+DLV 
Sbjct: 683  CPRLDDIVVETVECGQQCIEYLRKNKLGYARFILLDKLRNFNLSPIKTPENVPRLYDLVR 742

Query: 770  SSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVXXXXXXXXXXXX 829
             ++PKF  AFYSVLRDTLV  +LK+AN+VAYG +R+RVVTL G+LID+            
Sbjct: 743  PNNPKFRNAFYSVLRDTLVAKDLKEANKVAYGKQRYRVVTLDGKLIDLSGTMSGGGNFKA 802

Query: 830  XXLMKLTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPDV 889
              +MK  +  NS F   T E+V++I+KEL+ RE NF+IA +T  EME  L++LKDR+P++
Sbjct: 803  RGMMKSEQQSNSAF---TAEEVQQIDKELSEREHNFQIAADTLHEMEEALQKLKDREPEI 859

Query: 890  ELEISKFELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSLQ 949
            EL+ISK +L+I S  +E +  + +L    Q   +  S+NEELST E +L +L+++Y+ L+
Sbjct: 860  ELDISKRKLDIDSLSSEMKASEGRLEYLLQEKAQKESSNEELSTAEVKLKSLKSEYRELE 919

Query: 950  LETKSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDIXXXXXXXXXXXXXXAETEL 1009
             E +SKK  +K L+++IMKVGG KLQ+QSS VDS+ Q+  I              A+ ++
Sbjct: 920  NEMQSKKKEMKVLQEQIMKVGGTKLQMQSSMVDSVNQRITIVLAKSKKTKTDLKKAQNDI 979

Query: 1010 KRLSKKQSECSTDLLTSTDK---LENTDGQLSKIXXXXXXXXXXXXXXXXXREESLQNSE 1066
            KR  K+  + + +L + + +   +EN     SK                   EE ++ +E
Sbjct: 980  KRYQKQAEQLAEELKSCSQEKSLIENNLDSSSKKVDELSESINKLKDELELTEERVRKAE 1039

Query: 1067 NLKDQLKEFEENLNSFKVFQXXXXXXXXXXXXXXXXXXXDIRSTDSELQSLKIRDITHTL 1126
               D+ K  E     F+  +                   +       L SLKIRD+T TL
Sbjct: 1040 ESIDE-KTVEGR--DFEALEIQCVAQLDKLKELFAILNKEAAEFLHSLNSLKIRDVTATL 1096

Query: 1127 QELDNGNIDQDEEDVSMK-----DNAVSVSANNSLGNSENMEGVEIETNESDVSPDANND 1181
            Q LD    ++ + +V+ +     D   S S ++ +   EN +G    T E+ +       
Sbjct: 1097 QALDESLENESKNEVAAETPGEEDGEHSSSLHDPMDVDEN-QGESTSTTEAQLQAG---- 1151

Query: 1182 LEMEIDEDNNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRV 1241
             E E       +  G+P++ EDE +N +VE +E +  QLQDY++    +I++LEEYARR+
Sbjct: 1152 -EAERRNTEESLPNGLPKLLEDELENFEVETVELEIHQLQDYVENAYADIEILEEYARRL 1210

Query: 1242 AEYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAE 1301
             EYK RK+DLN+AV ER+KVR+  + LKK R +EFM+GF  I + LKEMYQMITMGGNAE
Sbjct: 1211 IEYKARKVDLNHAVQERDKVRQSNENLKKKRLDEFMEGFNAICMILKEMYQMITMGGNAE 1270

Query: 1302 LELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1361
            LELVDSLDPFSEGV FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE
Sbjct: 1271 LELVDSLDPFSEGVLFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1330

Query: 1362 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNN 1421
            IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVG+YK+ N TKS  LQN 
Sbjct: 1331 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGVYKNKNMTKSVALQNT 1390

Query: 1422 DIINR 1426
            D+I+R
Sbjct: 1391 DLIDR 1395

>KNAG0G02020 Chr7 (449115..453449) [4335 bp, 1444 aa] {ON} Anc_8.259
            YLR086W
          Length = 1444

 Score = 1265 bits (3273), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 689/1387 (49%), Positives = 914/1387 (65%), Gaps = 15/1387 (1%)

Query: 46   AAVSHLNFK-SQTPKKLILRDYDSIAITPTAAMPPSSSLQAPSLHP---PTESSSRGRTA 101
            ++VS L+FK + TP+KLI+   ++           SSSLQ P+L     P    SRGR  
Sbjct: 55   SSVSPLDFKKTVTPRKLIIGPSENKYALSQPTTSASSSLQVPALQQKLVPLSQDSRGRRI 114

Query: 102  RTYXXXXXXXXXXXXXXXXTRKLELIQLSPVKNSRIALQKIYESKNEK--QIERLCIDKL 159
            + Y                 RKLELIQLSP+KNSR+ LQK+Y++ N K  ++ RL I KL
Sbjct: 115  KMYSQSPPRSPGRSPNRSPVRKLELIQLSPIKNSRLELQKLYDAHNAKIGKMNRLYIHKL 174

Query: 160  VLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIH 219
            VLH+FKSYAG Q +GPF +SFSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQDRLSDLIH
Sbjct: 175  VLHNFKSYAGEQTIGPFDASFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIH 234

Query: 220  KSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEK--LVITRKAFKNNTSKYYINGKES 277
            KSE F +L  CSVEVHF YV D+    T  +T++ +  LVITRKAFKNN+SKY+INGKES
Sbjct: 235  KSERFTNLNFCSVEVHFRYVKDEYTAPTDGDTMEAENTLVITRKAFKNNSSKYFINGKES 294

Query: 278  NYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPKAENXXXXXXXXXXXXIIGTAKYK 337
            N+T VTKLLK++GIDLDH RFLILQGEVENIAQMK KAE             IIGT  YK
Sbjct: 295  NFTEVTKLLKEQGIDLDHKRFLILQGEVENIAQMKAKAEKDNEDGLLEYLEDIIGTKHYK 354

Query: 338  PLIEKKFEEIEALNEICIEKENRFEIVDREKASLESGXXXXXXXXXXXXXXXXXXXXXYQ 397
            PLIE+K  EIEA+NE+CIEKENRF IVD EK SLE                        Q
Sbjct: 355  PLIEQKTVEIEAMNELCIEKENRFRIVDDEKNSLEKDKDAALEFLEKEKQLTLLKSKLTQ 414

Query: 398  YKLWQDNKKLSTTLEKLSNIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEK 457
            Y L+ +N K+ TTL ++ +++ +FE+ K++HS    ++  +  S  E   N+ +   +EK
Sbjct: 415  YHLYVNNDKIKTTLGQIDSLRTDFEQEKQRHSQFMKEVETLQNSIDESKNNLTSLTTEEK 474

Query: 458  KLNIQKRNYDTERVSLEEQRKNIXXXXXXXXXXLEDCNKTISNTKIKIEDLGKNESEYES 517
             L  +KR  +T+ VSLEE  KN+          +E     IS  + ++++  + + EYE+
Sbjct: 475  SLIQRKREINTQSVSLEETTKNLDQKLKKAKATVESSKSLISKNEHELQEQSQLQEEYEA 534

Query: 518  QLDELNAQLQIERGLLEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKES 577
            ++++L+ Q ++E  +L +IK+ LKDKT+ FSDEI+  EKELEP N ++Q KKSQI++ E 
Sbjct: 535  EVNDLSKQREVEEKILLDIKLQLKDKTVTFSDEIASIEKELEPSNTEIQEKKSQIKLVEM 594

Query: 578  EISLIKEGRVKLENDIENLNSLXXXXXXXXXXXXXXXXXLRNELNRITKEVSIGDTEYTN 637
            EI LI++ + K+  +IE+L                    L      + KE   GD E  +
Sbjct: 595  EIDLIRDSKRKVGAEIESLKEELLKLQKDLEDNEKDVTDLNKSKRNLVKEKQEGDKECKD 654

Query: 638  AKEKLREMKAVLNQHRQKAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGA 697
            A  KL EMKA+LN HRQK ++AR+++S  +NKN+VL SL R+Q+SGRI+GF+GRLGDLG 
Sbjct: 655  AGVKLNEMKAILNSHRQKTMEARSTVSTAQNKNKVLTSLMRMQQSGRINGFHGRLGDLGI 714

Query: 698  IDDRYDIAISTACPRLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKIST 757
            I D+YD+AISTACPRL+D+VVE+VECGQ CIE+LRKNKLGYARF++L+KL+ FDM+ I T
Sbjct: 715  IADQYDVAISTACPRLDDMVVESVECGQTCIEFLRKNKLGYARFVVLDKLKRFDMSPIQT 774

Query: 758  PNNVPRLFDLVISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDV 817
            P NVPRLFDLV   + +F PA YSVLRDTLV  +LK ANRVAYG +RFRVVTL G+LID+
Sbjct: 775  PENVPRLFDLVKPKEKRFAPAIYSVLRDTLVAKDLKQANRVAYGKRRFRVVTLDGQLIDI 834

Query: 818  XXXXXXXXXXXXXXLMKLTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMET 877
                          LM LT   +   + +++ED++K+E ELAAREK F++A+ETF  ME 
Sbjct: 835  SGTMSGGGSRVFKGLMNLTTKVSGTSEIFSLEDMKKLEMELAAREKQFDVASETFHSMEQ 894

Query: 878  ELRRLKDRKPDVELEISKFELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHE 937
            ELR+L DR+P +ELEISK  ++I +   + +L + QL EK    ++ + + ++L  +   
Sbjct: 895  ELRKLCDREPQLELEISKKLIDIDALTQQIQLTRSQLTEKSNDYEKSIKDTDDLDLLLGN 954

Query: 938  LGTLQNDYKSLQLETKSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDIXXXXXXX 997
            L  L  + K LQ ++K+  +R+ FLKDEIM++GG +LQ+Q+SKV S+ Q+ DI       
Sbjct: 955  LEALNQELKYLQDQSKTSSERVSFLKDEIMRIGGSELQLQNSKVSSLNQRIDILQAKLKK 1014

Query: 998  XXXXXXXAETELKRLSKKQSECSTDLLTSTDKLENTDGQLSKIXXXXXXXXXXXXXXXXX 1057
                     TELK+  K     + +   ST+++ +   +                     
Sbjct: 1015 SKTVVKKLNTELKKARKSLIASTEESTNSTEEIAHAKARAEVAKNSLLDINKSLESIQDE 1074

Query: 1058 REESLQNSENLKDQLKEFEENLNSFKVFQXXXXXXXXXXXXXXXXXXXDIRSTDSELQSL 1117
            +    Q  EN  D+L E  EN+N FK  Q                   +      EL + 
Sbjct: 1075 KINLEQELENFSDKLHESNENVNEFKTIQLELENKIERANSILSYLKKENGQLLEELNNF 1134

Query: 1118 KIRDITHTLQEL-DNGNIDQDEEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSP 1176
            ++RD+THTL  L +    + +++  +  D   S   N  LG ++   GVE   N S +S 
Sbjct: 1135 RLRDVTHTLDLLREEEGTEANQQPTTGTDETTSNVDNEMLGAAD--AGVE-NMNTSSLSN 1191

Query: 1177 D---ANNDLEMEIDEDNNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDV 1233
                A++++ M++D+  + +S+GIPR+S+ E   +D + L  +  QLQ +I+ V++NI++
Sbjct: 1192 SVKVASDEISMDVDDCGDLVSQGIPRLSDKELSTIDTDNLNEEINQLQSFINNVSINIEI 1251

Query: 1234 LEEYARRVAEYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQM 1293
            LEEYA+R+ E+K+RK+DLNN+V ER ++  ++++LKK R+ EFM+GF +IS+TLKEMYQM
Sbjct: 1252 LEEYAKRLVEFKKRKIDLNNSVGERNQLTSIMEELKKKRYNEFMEGFSIISMTLKEMYQM 1311

Query: 1294 ITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKP 1353
            ITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKP
Sbjct: 1312 ITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKP 1371

Query: 1354 TPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQT 1413
            TPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK  N T
Sbjct: 1372 TPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAKQLVGIYKHENMT 1431

Query: 1414 KSATLQN 1420
            K+AT++N
Sbjct: 1432 KNATIRN 1438

>AGR089C Chr7 complement(901437..905549) [4113 bp, 1370 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR086W
            (SMC4)
          Length = 1370

 Score = 1234 bits (3192), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 672/1384 (48%), Positives = 903/1384 (65%), Gaps = 44/1384 (3%)

Query: 57   TPKKLILRDYDSI-AITPTAAMPPSSSLQAPSLHPPTESS-SRGRTARTYXXXXXXXXXX 114
            TP KL+    D    ++  +++  +  L+ PSL PP     SRGR+  +           
Sbjct: 14   TPVKLLATSPDRKNVVSRGSSVSTTMGLRGPSLQPPVAHQISRGRSQYS------QSPPR 67

Query: 115  XXXXXXTRKLELIQLSPVKNSRIALQKIYESKNEKQIERLCIDKLVLHDFKSYAGTQVVG 174
                   R +ELIQLSP+KNSR+ LQ++Y++K +K++ERLCI  LVL +FKSYAG QVVG
Sbjct: 68   SPNRSPGRAVELIQLSPIKNSRLELQRLYDTK-QKKVERLCIRTLVLENFKSYAGRQVVG 126

Query: 175  PFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKSCSVEV 234
            PFHSSFSAVVGPNGSGKSNVIDSMLF FGFRA+KMRQ +LS LIHKSE +PDL  CSVE+
Sbjct: 127  PFHSSFSAVVGPNGSGKSNVIDSMLFAFGFRANKMRQGKLSHLIHKSEKYPDLDFCSVEI 186

Query: 235  HFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLD 294
             F+YV+D+PDGTT + + K +L + RKAFKNNTSKYY+NGKES YT VT+LL+DEGIDLD
Sbjct: 187  QFQYVVDEPDGTTRVLSGKPELSVMRKAFKNNTSKYYLNGKESTYTEVTRLLRDEGIDLD 246

Query: 295  HNRFLILQGEVENIAQMKPKAENXXXXXXXXXXXXIIGTAKYKPLIEKKFEEIEALNEIC 354
            H RFLILQGEVE+IAQMKPKAE+            IIGT KYK  IE+   E+++LN+IC
Sbjct: 247  HKRFLILQGEVESIAQMKPKAEHEGDDGLLEYLEDIIGTTKYKAQIEQALVEVDSLNDIC 306

Query: 355  IEKENRFEIVDREKASLESGXXXXXXXXXXXXXXXXXXXXXYQYKLWQDNKKLSTTLEKL 414
            +EKENRF++V++EK SLE G                     YQY L+ +  KL+ TL  +
Sbjct: 307  MEKENRFDLVEKEKLSLEPGKDEALAFLKKEKDLTLLMSKKYQYHLFHNGSKLAKTLSNV 366

Query: 415  SNIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTERVSLE 474
            SN   + E+ K K    + ++ E++ +  ++   + +     K+   + R  + E VS E
Sbjct: 367  SNTMNKLEQEKAKKVEAQKEIVELTDASEQLANRLVSMNNTNKESLAKMRQLERELVSNE 426

Query: 475  EQRKNIXXXXXXXXXXLEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIERGLLE 534
            E++K++          L    K+I   + KIE+      EYE+ L  LN  +   +  LE
Sbjct: 427  EKQKSLLQKRSKAEKTLNTVEKSIKQCENKIEEYISQNQEYETSLTTLNHTIVDAQAELE 486

Query: 535  EIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLENDIE 594
            ++K++L DKT + + E++  EKELEPW  +++ KKS+I++ ESEIS+IKE  +KLE++I 
Sbjct: 487  KMKLALSDKTGDITKEVAVLEKELEPWTNKVEEKKSEIKLVESEISIIKEADLKLESEIA 546

Query: 595  NLNSLXXXXXXXXXXXXXXXXXLRNELNRITKEVSIGDTEYTNAKEKLREMKAVLNQHRQ 654
            NL+                   L  E + I   + +G+ E T+A+ KL EMK VL  HRQ
Sbjct: 547  NLSQEIEQLRGNISHREESIETLNVESSSIRDYILVGERECTSARSKLEEMKKVLVTHRQ 606

Query: 655  KAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTACPRLN 714
            +  DAR+++S+ ENKN+VL +L RLQKSGRI G++GRLGDLG IDD+YDIAISTACPRL+
Sbjct: 607  RVNDARSAVSSAENKNKVLTALSRLQKSGRIDGYHGRLGDLGTIDDKYDIAISTACPRLD 666

Query: 715  DLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVISSDPK 774
            D+VV+TVECGQQCIE+LRKNKLGYARFILL+KLR F++    TP NVPRLFDLV   +PK
Sbjct: 667  DIVVDTVECGQQCIEHLRKNKLGYARFILLDKLRKFNLQPAHTPENVPRLFDLVKPKEPK 726

Query: 775  FLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVXXXXXXXXXXXXXXLMK 834
            F PAFYSVLRDTLV  +L  ANRVAYG KR+RVVTL G+LID+              LMK
Sbjct: 727  FAPAFYSVLRDTLVTTDLSQANRVAYGKKRYRVVTLDGKLIDISGTMTGGGDRAASGLMK 786

Query: 835  LTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPDVELEIS 894
             T+  +     YT E+V+++E+EL  REKNF++A ETF EME+ L+   DR+P++E+E+S
Sbjct: 787  STQQSSL----YTPEEVQRMEEELNEREKNFKVAFETFQEMESALQNYLDRQPEIEVELS 842

Query: 895  KFELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSLQLETKS 954
            K +++I +   E E   ++  E ++S    + ++ EL T E +L  L  D  S    ++S
Sbjct: 843  KQKMDIETISAELESKIERKLELERSNKTSIEDSSELRTAEEKLAALNADLNSFMSASES 902

Query: 955  KKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDIXXXXXXXXXXXXXXAETELKRLSK 1014
            K  RIK L+ +IM++GG++LQ  +SKVDS+ Q+  I              AE ELKR  K
Sbjct: 903  KNQRIKELRAKIMEIGGLELQTLNSKVDSLNQQIKIVAAKQKKDKTAQKKAELELKRARK 962

Query: 1015 KQSECSTDLLTSTDKLENTDGQLSKIXXXXXXXXXXXXXXXXXREESLQNSENLKDQ--- 1071
            +Q       +T+ D +E+ D ++ K+                   +  +    L D+   
Sbjct: 963  QQ-------ITAKDDIEHCDIEIQKMKSSYDTISTGMQELQKQLSDLQEEIGTLTDEHAV 1015

Query: 1072 ----LKEFEENLNSFKVFQXXXXXXXXXXXXXXXXXXXDIRSTDSELQSLKIRDITHTLQ 1127
                L +  E ++S+   +                   ++   DS+L  LK+RD+   + 
Sbjct: 1016 TKHELDQKNEKIDSYSSIEIELTEQLQKLQNLANYLKKEMNEYDSKLSHLKLRDLGQVML 1075

Query: 1128 ELDNGNIDQDEEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSPD------ANND 1181
            +L        EE+ S++  + S + +      EN++   +ET+ +  SP+      A N+
Sbjct: 1076 DL--------EENKSLQSFSHSPTPDT---KRENIQSSMLETHLASPSPNERKISIAENN 1124

Query: 1182 LEMEIDEDNNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRV 1241
            L ME+DE  + +  G+P++ + E   VD+E+LE   +QLQDYID   V+I++L+EYA+R+
Sbjct: 1125 LSMEVDEQASVLENGLPKLPDSELARVDLEDLERDIVQLQDYIDNSTVDIEILDEYAKRL 1184

Query: 1242 AEYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAE 1301
            AEY+RR++DLN A+ +R++ R   + LKK R +EFM+GFG+ISITLKEMYQMITMGGNAE
Sbjct: 1185 AEYRRRRIDLNEAIMKRDETRMHCEVLKKRRLDEFMEGFGIISITLKEMYQMITMGGNAE 1244

Query: 1302 LELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1361
            LELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDE
Sbjct: 1245 LELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1304

Query: 1362 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNN 1421
            IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA++LVGIYK++N T+S TLQN 
Sbjct: 1305 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQRLVGIYKNSNMTRSTTLQNR 1364

Query: 1422 DIIN 1425
            DIIN
Sbjct: 1365 DIIN 1368

>KLTH0G13750g Chr7 complement(1184169..1188368) [4200 bp, 1399 aa]
            {ON} similar to uniprot|Q12267 Saccharomyces cerevisiae
            YLR086W SMC4 Subunit of the condensin complex which
            reorganizes chromosomes during cell division forms a
            stable complex with Smc2p that has ATP-hydrolyzing and
            DNA- binding activity and promotes knotting of circular
            DNA potential Cdc28p substrate
          Length = 1399

 Score = 1227 bits (3174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 696/1384 (50%), Positives = 915/1384 (66%), Gaps = 29/1384 (2%)

Query: 54   KSQTPKKLILRDYDS-IAITPTAAMPPSSSLQAPSLHPPTE--SSSRGRTARTYXXXXXX 110
            +S+TP+KL+L   D   A +       SSS   P L P     SSSRGR           
Sbjct: 33   RSRTPRKLVLGSPDKRFAFSQPVT---SSSSNVPYLQPLKSELSSSRGRV-------YSQ 82

Query: 111  XXXXXXXXXXTRKLELIQLSPVKNSRIALQKIYESKNEKQ-IERLCIDKLVLHDFKSYAG 169
                      TRKLELIQLSP K +R+  QK  + +   Q IERLCI++L LH+FKSYAG
Sbjct: 83   SPPRSPTRSPTRKLELIQLSPTKKTRLESQKTEQVRGLAQPIERLCINRLSLHNFKSYAG 142

Query: 170  TQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKS 229
            TQVVGPFHSSFSAVVGPNGSGKSNVIDS+LFVFGFRA+KMRQ +LSDLIHKSE  P+L S
Sbjct: 143  TQVVGPFHSSFSAVVGPNGSGKSNVIDSLLFVFGFRANKMRQGKLSDLIHKSEAHPNLDS 202

Query: 230  CSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDE 289
            C VEV F+YV D+ DG T +   +  LV+TRKAFKNNTSKYY+NGKES+YT VT+LL+ E
Sbjct: 203  CHVEVFFQYVQDELDGRTTVRQDRPGLVVTRKAFKNNTSKYYVNGKESSYTQVTELLRKE 262

Query: 290  GIDLDHNRFLILQGEVENIAQMKPKAENXXXXXXXXXXXXIIGTAKYKPLIEKKFEEIEA 349
            GIDLDH RFLILQGEVE+IAQMKPKAE             IIGTAKYKPLIE+   +I+ 
Sbjct: 263  GIDLDHKRFLILQGEVESIAQMKPKAEKEGDDGLLEYLEDIIGTAKYKPLIEQTLVQIDQ 322

Query: 350  LNEICIEKENRFEIVDREKASLESGXXXXXXXXXXXXXXXXXXXXXYQYKLWQDNKKLST 409
            LN++C EKENR+EIV+REK+SLESG                      Q+KLW+++ K + 
Sbjct: 323  LNDVCQEKENRYEIVEREKSSLESGKDEALEFLEKEKKLTFLRSKLLQHKLWKNSFKSTN 382

Query: 410  TLEKLSNIKEEFEETKKKHSTTEIQMNEI---SKSYHEMLKNIKASQEQEKKLNIQKRNY 466
            T EK+  ++E+    + K++  + ++ ++   SKS +  ++ IK S   E  L  +KR  
Sbjct: 383  TQEKIKTLEEKLSAERAKYTEHKREIKQLESESKSLNVTIRGIKDS---ESSLTSEKRTC 439

Query: 467  DTERVSLEEQRKNIXXXXXXXXXXLEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQL 526
            D +RVSLEE+ KNI                +I+ T+ K+E+L K++ +YE +LDELN  L
Sbjct: 440  DRDRVSLEEKLKNISQKKVKAEKTHHATVNSINATQAKLEELFKDQVQYEKELDELNKSL 499

Query: 527  QIERGLLEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGR 586
             +E+  L+EIKISLK KT   S +I + E+ELEPWN++LQ K+SQI+++E++IS++KE  
Sbjct: 500  LVEKTKLDEIKISLKGKTGAISVQIGEIEQELEPWNVKLQEKRSQIKLEETKISVLKESL 559

Query: 587  VKLENDIENLNSLXXXXXXXXXXXXXXXXXLRNELNRITKEVSIGDTEYTNAKEKLREMK 646
             K+  +I    +                  L  E   I +++ IG TE  NA  K++EMK
Sbjct: 560  AKIAEEISKSENDISNNRKKVAEQHQAIEGLEKEHTDIQRQIIIGQTECDNASNKMKEMK 619

Query: 647  AVLNQHRQKAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAI 706
            AVL  HRQ+++DA++SLS  ENKN+VL++L RLQ+SGRISGF+GRLGDLG IDD+YD+AI
Sbjct: 620  AVLTTHRQRSLDAKSSLSTFENKNKVLSALQRLQRSGRISGFHGRLGDLGTIDDKYDVAI 679

Query: 707  STACPRLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFD 766
            STACPRL+D+VVETVECGQQCIE+LRKNKLGYARFILL+KLR+F+MN I TPNNV RLFD
Sbjct: 680  STACPRLDDVVVETVECGQQCIEHLRKNKLGYARFILLDKLRSFNMNTIQTPNNVSRLFD 739

Query: 767  LVISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVXXXXXXXXX 826
            LV   D KF  AFYSVLRDTLV  +LK+ANRVAYG +RFRVVTL G+LID+         
Sbjct: 740  LVHPIDNKFRNAFYSVLRDTLVAKDLKEANRVAYGKQRFRVVTLDGKLIDLSGTMSGGGN 799

Query: 827  XXXXXLMKLTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRK 886
                 +MK ++  N+G  S+T E+V +I++EL  RE+NF+IA +T  EME  L+ LKDR+
Sbjct: 800  HRASGMMK-SERLNTG-ASFTAEEVRQIDEELTERERNFKIATDTLHEMEDALQSLKDRE 857

Query: 887  PDVELEISKFELEITSWVTEHELMQQQLN--EKQQSLDECMSNNEELSTMEHELGTLQND 944
            P++E +ISK  +EI S ++E +L + +    +K+Q L+E  S+++ L      L +L+ +
Sbjct: 858  PEIETDISKRRMEIDSLLSEIKLCEDRAASLKKEQKLNE--SSDDTLIEANSRLDSLKAE 915

Query: 945  YKSLQLETKSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDIXXXXXXXXXXXXXX 1004
             K L+ E KSKK++IK L+++IMK+GG KLQ+Q S VDSI Q+  I              
Sbjct: 916  CKLLEGEMKSKKNKIKELQEQIMKIGGTKLQLQGSLVDSIGQRISITLGKQKRDKTAVKK 975

Query: 1005 AETELKRLSKKQSECSTDLLTSTDKLENTDGQLSKIXXXXXXXXXXXXXXXXXREESLQN 1064
            AE +LKR  K+  + S D+   T++LE+    +S                    EE  + 
Sbjct: 976  AENDLKRYEKQAGQLSVDIDQCTNELESIKELISSSDNKILELEASIDKLQKEGEEIEEK 1035

Query: 1065 SENLKDQLKEFEENLNSFKVFQXXXXXXXXXXXXXXXXXXXDIRSTDSELQSLKIRDITH 1124
               ++  ++E       F VF+                   D      +L+SLKIRD+T 
Sbjct: 1036 VREIERLIEEKSSEGQDFAVFEVDINNQLEKLNDLLNHIGKDGHDLLKQLESLKIRDVTA 1095

Query: 1125 TLQELDNGNIDQDEEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSPDANNDLEM 1184
            TLQ L+   + +      +   + S + +    N + ME   +E    +    +  + +M
Sbjct: 1096 TLQTLNKLLLSESRSGDELHGQS-SEARSQEPSNGDLMEVDTVEGCMGNEPTASQPEDQM 1154

Query: 1185 EIDE-DNNEISKG-IPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVA 1242
            ++DE +  E S   +P+++E + K ++VEE+E +  QL D+++    +I+VLEEY +R+ 
Sbjct: 1155 DVDEPEEMETSPSDLPKLTEAQLKELNVEEVELEIGQLNDFVENAYADIEVLEEYTKRLV 1214

Query: 1243 EYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAEL 1302
            +++ RKL+LN AV++R+ VR+  D L+K R +EFM GF  IS+TLKEMYQMITMGGNAEL
Sbjct: 1215 DFQARKLELNKAVEQRDSVRQNCDNLRKKRLDEFMNGFNTISMTLKEMYQMITMGGNAEL 1274

Query: 1303 ELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1362
            ELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEI
Sbjct: 1275 ELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1334

Query: 1363 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNND 1422
            DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QLVGIYK+ N TKS  L+N D
Sbjct: 1335 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLVGIYKNRNMTKSVALENKD 1394

Query: 1423 IINR 1426
            +INR
Sbjct: 1395 LINR 1398

>TBLA0E04410 Chr5 (1122005..1126273) [4269 bp, 1422 aa] {ON} Anc_8.259
            YLR086W
          Length = 1422

 Score = 1221 bits (3158), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 694/1450 (47%), Positives = 923/1450 (63%), Gaps = 52/1450 (3%)

Query: 1    MPKTPLSKRPKLVEAN---------------LNANELDHNDDDQ----RYNRQEIKVSPT 41
            MP +P+SK+ K+ E+                       H DD       Y  QE  + P 
Sbjct: 1    MPDSPISKKQKITESRDEDKKINNNIIINHNNRDINRSHVDDADITIGPYQGQEKHIQPQ 60

Query: 42   TQDAAAVSHLNFKSQTPKKLILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESSSRGRTA 101
            +QD         +S+TP+KLI+   D    T +     S+  Q PSL  P  S S GR  
Sbjct: 61   SQDRHG------RSRTPRKLIVSSADH-RFTMSQPNLLSADSQTPSLQHP--SVSTGREH 111

Query: 102  RTYXXXXXXXXXXXXXXXXTRKLELIQLSPVKNSRIALQKIYE-SKNEKQIERLCIDKLV 160
            + Y                 + LELIQLSP+KN+R  LQK+YE  + +K+  RL I++LV
Sbjct: 112  KFYSQSPPRSPHRSPVRSPKKALELIQLSPIKNNRAELQKMYELQQTQKRTIRLVIERLV 171

Query: 161  LHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHK 220
            L +FKSYAG QVVGPFH++FSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQ +L DLIHK
Sbjct: 172  LTNFKSYAGRQVVGPFHTNFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLKDLIHK 231

Query: 221  SENFPDLKSCSVEVHFEYVIDKPDG-TTIINTVKEKLVITRKAFKNNTSKYYINGKESNY 279
            SE +P+L SCSVE+HF+YVID P+G  + I+  KEKLV+ RKAFKNN+SKYYIN KES++
Sbjct: 232  SEKYPELSSCSVEIHFQYVIDDPNGGPSKIDESKEKLVVMRKAFKNNSSKYYINDKESSF 291

Query: 280  TSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPKAENXXXXXXXXXXXXIIGTAKYKPL 339
            T VT LLK+EGIDLDH RFLILQGEVENIAQMKPK+E             IIGT+ YK  
Sbjct: 292  TQVTTLLKNEGIDLDHKRFLILQGEVENIAQMKPKSEKEGDDGLLEYLEDIIGTSHYKVQ 351

Query: 340  IEKKFEEIEALNEICIEKENRFEIVDREKASLESGXXXXXXXXXXXXXXXXXXXXXYQYK 399
            IE    ++EALNEICIEKENRF IV++EK SL  G                     YQ++
Sbjct: 352  IEHNLSKVEALNEICIEKENRFNIVEKEKDSLVDGKNEALKYLANEKNLVLAKSKKYQHQ 411

Query: 400  LWQDNKKLSTTLEKLSNIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKL 459
            L+ DNKKL++TL K+++ +E +++  +K+ST   ++  +      + K +  +++ E+KL
Sbjct: 412  LYIDNKKLTSTLAKITDAQENYDKELEKYSTISKELKNLQDEEITLNKRLNETKKYEEKL 471

Query: 460  NIQKRNYDTERVSLEEQRKNIXXXXXXXXXXLEDCNKTISNTKIKIEDLGKNESEYESQL 519
               +R  ++E +S +E  KNI          +    K+I+ T  K+E L   + +Y  Q+
Sbjct: 472  LSNQRKNNSELISTQEMIKNIEKKKDNAEKLVNTTEKSITQTNNKLETLNNQQEDYTKQI 531

Query: 520  DELNAQLQIERGLLEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEI 579
            +ELN +L+IE+  LEEIKISLK KT +FS+EI ++EKELEP+ +QLQ K SQIQ+ +SEI
Sbjct: 532  EELNEKLKIEKSKLEEIKISLKGKTEQFSNEILKNEKELEPYQIQLQEKMSQIQLLQSEI 591

Query: 580  SLIKEGRVKLENDIENLNSLXXXXXXXXXXXXXXXXXLRNELNRITKEVSIGDTEYTNAK 639
            SL+ E +  L N+I ++  L                  + +L    KEV  GD E+    
Sbjct: 592  SLLNENKDNLSNEIISIKKLIEEKKLSVVRMSEKITGWKQQLLEQRKEVESGDIEFNKFT 651

Query: 640  EKLREMKAVLNQHRQKAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAID 699
            +K++EM+  L+ HRQKA D+RTSLS  +NKN VL +LF+LQKSGRISGFYGRLGDLG ID
Sbjct: 652  KKIQEMRDKLDSHRQKANDSRTSLSNVQNKNSVLTALFKLQKSGRISGFYGRLGDLGVID 711

Query: 700  DRYDIAISTACPRLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPN 759
            ++YD+AISTACPRL DLVV++V+CGQQCI+YLRKN+LGYARFILL+KLR F++N+I TP+
Sbjct: 712  EKYDVAISTACPRLEDLVVDSVDCGQQCIDYLRKNRLGYARFILLDKLRKFNLNRIETPD 771

Query: 760  NVPRLFDLVISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVXX 819
            N PRLFDL+   + KFLPAFYSVLRDTLV  NL  AN+VAYG +RFRVVTL G+LID+  
Sbjct: 772  NAPRLFDLIQVREDKFLPAFYSVLRDTLVATNLLHANKVAYGKRRFRVVTLDGKLIDISG 831

Query: 820  XXXXXXXXXXXXLMKLTKS-GNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETE 878
                        LMKL +    + F+  + E+V+K+E+EL   EKNF++A  +  EM  E
Sbjct: 832  TMSGGGNYVLRGLMKLGQDLPENDFEQTSPEEVQKLERELEILEKNFKVAYNSLKEMNQE 891

Query: 879  LRRLKDRKPDVELEISKFELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHEL 938
            +  +K++ P  EL ISK  +EI     E + +  QL EKQ+  D+  +NN+E+   + +L
Sbjct: 892  ILHMKEQIPATELNISKTTIEIEYCENEIKQLISQLKEKQEIHDQESNNNDEIKVADDKL 951

Query: 939  GTLQNDYKSLQLETKSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDIXXXXXXXX 998
              L+ +Y SL  +TK  K  I+ L+ +IM  GGI+L++Q+SKV S++ +  I        
Sbjct: 952  QALKKEYYSLNDQTKVTKQEIEKLRQQIMDAGGIELKMQNSKVTSLVNQLKIVNSKQKND 1011

Query: 999  XXXXXXAETELKRLSKKQSECSTDLLTSTDKLENTDGQLSKIXXXXXXXXXXXXXXXXXR 1058
                      LK+L  + +    + L     LEN+  +++ +                 +
Sbjct: 1012 KSAIKKNNNILKKLQNELNTTKDNSLEFKTNLENSKKKVTLLSEELAKLESDINDTQNAK 1071

Query: 1059 EESLQNSENLKDQLKEFEENLNSFKVFQXXXXXXXXXXXXXXXXXXXDIRSTDSELQSLK 1118
            EE L N +  K++ +E EE+  +FK F+                    I   D+EL +L 
Sbjct: 1072 EEILLNIDGNKEKAQELEEDSRNFKSFELEIKNKLDKLKDLSHHLEKQIGKLDTELNALT 1131

Query: 1119 IRDITHTLQELDNGNIDQD-EEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSPD 1177
            IR+I+  L+  D      D  ++ + +D   + SA NS+ N               ++ D
Sbjct: 1132 IREISQNLESFDERLEKYDISKNGATEDTQHTSSALNSVSN---------------INTD 1176

Query: 1178 ANNDLEMEIDEDNNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEY 1237
                  M+ID  +NEI+ GI R+SE E   +D+E L+A+   L++ ++    NI++LEEY
Sbjct: 1177 T-----MDIDSTDNEINPGIKRLSELEINELDIESLDAEIENLEEQLEHSTANIEILEEY 1231

Query: 1238 ARRVAEYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMG 1297
             RR++EYK+RK DL+ ++ E+E  +E  + LKK R EEF  GF +IS+TLKEMYQMITMG
Sbjct: 1232 VRRLSEYKKRKSDLDESISEKETAKEETEVLKKKRLEEFTTGFDIISLTLKEMYQMITMG 1291

Query: 1298 GNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLY 1357
            GNAELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLY
Sbjct: 1292 GNAELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLY 1351

Query: 1358 VMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSAT 1417
            VMDEIDAALDFRNVSIVANYIKERTK+AQ IVISLRNNMFEL++QLVGIYKS N T+SAT
Sbjct: 1352 VMDEIDAALDFRNVSIVANYIKERTKDAQLIVISLRNNMFELSKQLVGIYKSENMTQSAT 1411

Query: 1418 LQNNDIINRD 1427
            L NND++NRD
Sbjct: 1412 LVNNDMLNRD 1421

>Ecym_4311 Chr4 complement(666871..671001) [4131 bp, 1376 aa] {ON}
            similar to Ashbya gossypii AGR089C
          Length = 1376

 Score = 1220 bits (3157), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 677/1383 (48%), Positives = 892/1383 (64%), Gaps = 37/1383 (2%)

Query: 57   TPKKLILRDYDSIAITPTAAMPPSSSLQAPSLHPPTESS-SRGRTARTYXXXXXXXXXXX 115
            TP KL+        +   A+   +++L+ PSL PPT S  SRGR+  +            
Sbjct: 15   TPSKLMFGSPGRKHVASQASSNSTTALRGPSLQPPTYSQLSRGRSVYS------QSPPRS 68

Query: 116  XXXXXTRKLELIQLSPVKNSRIALQKIYESKNEKQIERLCIDKLVLHDFKSYAGTQVVGP 175
                  R++ELIQLSP+KNSR+ LQKIY+ K +   +RL I  L+L++FKSYAG QVVGP
Sbjct: 69   PNRSPARRIELIQLSPIKNSRLELQKIYDGK-QTTTKRLSIKNLILNNFKSYAGVQVVGP 127

Query: 176  FHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKSCSVEVH 235
            FHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA+KMRQ +LS+LIHKSEN  +L  CSVE+ 
Sbjct: 128  FHSSFSAVVGPNGSGKSNVIDSMLFVFGFRANKMRQGKLSNLIHKSENHENLSFCSVEIT 187

Query: 236  FEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDH 295
            F+YV+D  DG T +    ++L + RK FKNNTSKYYINGKES+YT VT+ L++EGIDLDH
Sbjct: 188  FQYVMDDADGNTKVLPDVQELSVMRKVFKNNTSKYYINGKESSYTEVTQFLRNEGIDLDH 247

Query: 296  NRFLILQGEVENIAQMKPKAENXXXXXXXXXXXXIIGTAKYKPLIEKKFEEIEALNEICI 355
             RFLILQGEVE+IAQMKPKA++            IIGTAKYK  I     E++ LN+IC+
Sbjct: 248  KRFLILQGEVESIAQMKPKADHEGDDGLLEYLEDIIGTAKYKSQIRDALVEMDTLNDICM 307

Query: 356  EKENRFEIVDREKASLESGXXXXXXXXXXXXXXXXXXXXXYQYKLWQDNKKLSTTLEKLS 415
            EKE RFE+V++EK SLE+G                      Q+ + ++ KKL+ TL+K+S
Sbjct: 308  EKEIRFELVEKEKRSLEAGKEQALEFIAKEKQLTLLKSKQLQWDINKETKKLAVTLDKIS 367

Query: 416  NIKEEFEETKKKHSTTEIQ-----MNEISKSYHEMLKNIKASQEQ--EKKLNIQKRNYDT 468
               E+ E  + K+   E+Q     + E+S +  E +  I A + Q  + KL +Q+     
Sbjct: 368  AFTEKLENERNKYG--ELQKEITDLRELSDNLEEQITKINAEKSQLVKDKLQLQR----- 420

Query: 469  ERVSLEEQRKNIXXXXXXXXXXLEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQI 528
            E VS EE+ K++          L+   K I + +  I  L + ++E+E+ L ELN  L  
Sbjct: 421  ELVSSEEKLKSLNQKRTKAEKTLQVAEKNIRHCENNIRRLNEAQTEFENSLLELNESLHS 480

Query: 529  ERGLLEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVK 588
            ER  L+ IK+SL+DKT   S+E++  EKELEPW  +L+ K SQI++ ESEI +IKE ++K
Sbjct: 481  ERSELDAIKMSLRDKTSSISEEVASLEKELEPWTTKLEAKNSQIKLAESEILIIKESKLK 540

Query: 589  LENDIENLNSLXXXXXXXXXXXXXXXXXLRNELNRITKEVSIGDTEYTNAKEKLREMKAV 648
            LE +I  L                    L  E   IT  +S    E  +AK+KL +MK V
Sbjct: 541  LEQEISQLRKDIESYKDRIENHKKKINKLEKESAAITSFISTAQGECDSAKKKLVDMKQV 600

Query: 649  LNQHRQKAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAIST 708
            L  HRQ+  DAR +LS  ENKN+VL +L RLQKSGRI GF+GRLGDLG IDD+YDIAIS 
Sbjct: 601  LTNHRQRMTDARVALSNVENKNKVLGALCRLQKSGRIHGFHGRLGDLGTIDDKYDIAISV 660

Query: 709  ACPRLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLV 768
            ACPRL+D+VVETVEC QQCIE+LRKNKLGYARFILL+KL+ F+M K++TP NVPRLFDL 
Sbjct: 661  ACPRLDDIVVETVECAQQCIEHLRKNKLGYARFILLDKLKKFNMAKVTTPENVPRLFDLT 720

Query: 769  ISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVXXXXXXXXXXX 828
               +  F PA YSVLRDTLV  +L  ANRVAYG +RFRVVTL G+LID+           
Sbjct: 721  TPKNEIFAPALYSVLRDTLVAKDLAQANRVAYGTRRFRVVTLDGKLIDISGTMSGGGDRV 780

Query: 829  XXXLMKLTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPD 888
               LMK  +  N     YT E+V+++E EL  RE NF+IA +TF EME  L++ KDR+P+
Sbjct: 781  VKGLMKSKQRSND---MYTSEEVQRMEAELTDRETNFKIATDTFQEMEAALQKYKDRQPN 837

Query: 889  VELEISKFELEITSWVTEHELMQQQLNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSL 948
            +++EISK +++I +  +E +  +  L E + + +    +N  L  +E++L  L ++  +L
Sbjct: 838  IDVEISKHKIDIDTLSSELQSKKDTLIELESTAENNQRDNGPLEDIENQLVALNSELVAL 897

Query: 949  QLETKSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDIXXXXXXXXXXXXXXAETE 1008
            + E+K K ++I  L+ +IMK+GG+KLQ Q+SKVDS+ Q+  I               E E
Sbjct: 898  KDESKVKNEQISELRAQIMKIGGLKLQSQNSKVDSLTQQLQIIVAKQKKNRTELKKNELE 957

Query: 1009 LKRLSKKQSECSTDLLTSTDKLENTDGQLSKIXXXXXXXXXXXXXXXXXREESLQNSENL 1068
            + R SK++     D+     +L  T+     +                 +E+  Q  E  
Sbjct: 958  MNRASKQKLGAENDINHCEIELSKTNNSHEALQEGLRETEHLIEVIEDKKEQLNQEHETA 1017

Query: 1069 KDQLKEFEENLNSFKVFQXXXXXXXXXXXXXXXXXXXDIRSTDSELQSLKIRDITHTLQE 1128
            K  L +    +  FK  +                   +I  TD EL +LK+RD+   LQ+
Sbjct: 1018 KKNLDDKAAYVEKFKSEEIEMCTHLEKLKNLEHHIKAEISRTDEELNTLKLRDVEQLLQK 1077

Query: 1129 LDNGNIDQDEEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVS-----PDANNDLE 1183
            LD  N+  +    S+ D AV+ S  N       +E  + + N+ +       P++ ND E
Sbjct: 1078 LDEHNLPLE----SLTDRAVTPS--NQCIPEMTVEDHDADMNDGEAKLISEDPNSFNDQE 1131

Query: 1184 -MEIDEDNNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVA 1242
             M++D+D + I  G+P+++E E  N+D+EEL  +  QL++Y+DT   +ID+LEEYA R+A
Sbjct: 1132 SMDVDQDASYIGPGLPKLTEAELDNIDIEELALEIAQLKEYMDTAYADIDILEEYALRLA 1191

Query: 1243 EYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAEL 1302
            EYKRRKLDLN +V++RE++R   + LKK+R EEFM GFG+IS+T+KE+YQMITMGGNAEL
Sbjct: 1192 EYKRRKLDLNESVEKREEIRNRYEMLKKSRLEEFMDGFGIISMTVKEIYQMITMGGNAEL 1251

Query: 1303 ELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1362
            ELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVMDEI
Sbjct: 1252 ELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVMDEI 1311

Query: 1363 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNND 1422
            DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELA+QL+GIYKS+N TKS TLQN D
Sbjct: 1312 DAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAQQLIGIYKSSNMTKSTTLQNID 1371

Query: 1423 IIN 1425
            I+N
Sbjct: 1372 ILN 1374

>KLLA0F19085g Chr6 (1758111..1762229) [4119 bp, 1372 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086W SMC4
            subunit of the condensin complex which reorganizes
            chromosomes during cell division
          Length = 1372

 Score = 1152 bits (2981), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 653/1406 (46%), Positives = 876/1406 (62%), Gaps = 48/1406 (3%)

Query: 24   HNDDDQRYNRQEIKVSPTTQDAAAVSHLNFKSQTPKKLILRDYDS-IAITPT-AAMPPSS 81
            H  D     RQ +  SPT              +TP+KL+L   +   A++ + A    S+
Sbjct: 9    HLGDSPEIKRQRVSQSPT--------------RTPRKLVLGSPEKKYAVSNSQATTAASN 54

Query: 82   SLQAPSLHPPTESSSRGRTARTYXXXXXXXXXXXXXXXXTRKLELIQLSPVKNSRIALQK 141
            ++  PSL PPT  + RGR    Y                TRKLELI+LSP K++R+ LQK
Sbjct: 55   TMDPPSLQPPTAHAVRGRE---YSQSPPRSPTRSPTRSPTRKLELIRLSPKKSTRLELQK 111

Query: 142  IYESKNEKQIERLCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFV 201
            ++E+ N +  +RLCIDKLVL++FKSYAG Q +GPFH+SFSAVVGPNGSGKSNVIDSMLFV
Sbjct: 112  MHEA-NTQTSQRLCIDKLVLNNFKSYAGIQEIGPFHTSFSAVVGPNGSGKSNVIDSMLFV 170

Query: 202  FGFRASKMRQDRLSDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRK 261
            FGFRA+KMRQ +LS+LIHKSE FP L SCSV++HF YV D  +G T I      +V+ R+
Sbjct: 171  FGFRANKMRQGKLSELIHKSEQFPSLASCSVQIHFHYVHDTDNGETKILPSAGTMVVERR 230

Query: 262  AFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPKAENXXXX 321
            AFKNN+SKYY+NGKESNYT VT+LLK+EGIDLDH RFLILQGEVE+IAQMK KAE     
Sbjct: 231  AFKNNSSKYYVNGKESNYTEVTRLLKEEGIDLDHKRFLILQGEVESIAQMKAKAEKDNDD 290

Query: 322  XXXXXXXXIIGTAKYKPLIEKKFEEIEALNEICIEKENRFEIVDREKASLESGXXXXXXX 381
                    IIGTAK+KP IEK  EEIE LNE+C+EKENRFE+VD+EK +LESG       
Sbjct: 291  GLLEYLEDIIGTAKFKPQIEKCLEEIETLNEVCMEKENRFELVDKEKQNLESGKEEALEF 350

Query: 382  XXXXXXXXXXXXXXYQYKLWQDNKKLSTTLEKLSNIKEEFEETKKKHSTTEIQMNEISKS 441
                           Q +++  N+KL+T+ +K+S +  EF+E K ++   + +   ++  
Sbjct: 351  LDKERKHTILKAQLLQRQIYDSNRKLATSCDKISALNMEFQEEKSQYEHLQKEAETLTHE 410

Query: 442  YHEMLKNIKASQEQEKKLNIQKRNYDTERVSLEEQRKNIXXXXXXXXXXLEDCNKTISNT 501
             +   K   A + + K +N +KR+ + + ++ +E+ K+I                     
Sbjct: 411  INNTKKESTALETESKNVNSKKRSLEKDFIATDEKLKSIARKLKAAEKAFSQSESNGKAA 470

Query: 502  KIKIEDLGKNESEYESQLDELNAQLQIERGLLEEIKISLKDKTIEFSDEISQHEKELEPW 561
              +IE L KN  + E +L  LN  + IE+  L EIKI L +KT + S E+   E++LEP+
Sbjct: 471  VNEIESLKKNHDDCEIELHNLNHSISIEKEKLNEIKIHLHEKTKDLSQEMESLERQLEPF 530

Query: 562  NLQLQGKKSQIQVKESEISLIKEGRVKLENDIENLNSLXXXXXXXXXXXXXXXXXLRNEL 621
              Q+Q K+S+I++ E++I+++K     L  +   + S                  LRNE 
Sbjct: 531  RDQIQEKQSEIKLSETKITMLKSSHSNLLKEKATIESKIEDLQLEELKQKETETSLRNEK 590

Query: 622  NRITKEVSIGDTEYTNAKEKLREMKAVLNQHRQKAIDARTSLSAEENKNQVLASLFRLQK 681
            +++   +S    E   A+++  EM+ VL Q RQ   +A+ +L+  +NKN+VL +L +LQ 
Sbjct: 591  SKVEARISTAQKECEEAQKQTNEMRDVLIQQRQIVEEAKANLNGFQNKNRVLLALTKLQN 650

Query: 682  SGRISGFYGRLGDLGAIDDRYDIAISTACPRLNDLVVETVECGQQCIEYLRKNKLGYARF 741
            SGRI+GF+GRLGDLG IDD+YDIAISTACPRL+D+VVETVECGQQCI++LRKNKLGY RF
Sbjct: 651  SGRITGFHGRLGDLGTIDDQYDIAISTACPRLDDIVVETVECGQQCIDHLRKNKLGYGRF 710

Query: 742  ILLEKLRNFDMNKISTPNNVPRLFDLVISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYG 801
            ILL+KLR  ++++I+TP NVPRLFDL+      F PAFYSVLRDTLV  +L+ ANRVAYG
Sbjct: 711  ILLDKLRKCNLDRIATPENVPRLFDLITPVRDLFRPAFYSVLRDTLVARDLQQANRVAYG 770

Query: 802  NKRFRVVTLSGELIDVXXXXXXXXXXXXXXLMKLTKSGNSGFKSYTIEDVEKIEKELAAR 861
             +RFRVVTL G+LID+              LM+   S  +    Y+ ++VEK+E +L+ +
Sbjct: 771  KRRFRVVTLDGKLIDISGTMSGGGSSPQSGLMR---SKATTASQYSRDEVEKMEVQLSTK 827

Query: 862  EKNFEIANETFTEMETELRRLKDRKPDVELEISKFELEITSWVTEHELMQQQLNEKQQSL 921
            E N+  A     EME+ L++L DR P+++++ISK +LE  S V E E   Q+L++  + L
Sbjct: 828  ETNYRSALSMVHEMESALQKLTDRLPEIDIQISKIQLEKGSRVAEVESYHQRLSQLAREL 887

Query: 922  DECMSNNEELSTMEHELGTLQNDYKSLQLETKSKKDRIKFLKDEIMKVGGIKLQVQSSKV 981
                 N + L   E +L  L+   +     +K  +D+I  LKD IM+ GGI+L++Q +KV
Sbjct: 888  SMNEKNQQPLLDEEKKLDILRQHLQQTIDASKFSQDKIDDLKDRIMQKGGIELKMQIAKV 947

Query: 982  DSIIQKKDIXXXXXXXXXXXXXXAETELKRLSKKQSECSTDLLTSTDKLENTDGQLSKIX 1041
             S+ Q  +I               + +L R ++++++ S ++L     +     QL  I 
Sbjct: 948  ASLEQHIEILHEKQKKEKTRSKKLDIDLARATREKNKYSEEVLVCNKDISILSEQLESIR 1007

Query: 1042 XXXXXXXXXXXXXXXXREESLQNSENLKDQLKEFEENLNSFKVFQXXXXXXXXXXXXXXX 1101
                            + E   + E LK +L   E + N FK  +               
Sbjct: 1008 LEKERIEEQVIENNERKAELNSSVEKLKQELLSIERDSNEFKAKELEYSDRLEKLHGLQE 1067

Query: 1102 XXXXDIRSTDSELQSLKIRDITHTLQELDNGNIDQ--DEEDVSMKDNAVSVSANNSLGNS 1159
                 +RS ++ LQSLKIRD++  L +L++G I+   D     M  + V   +   +GN+
Sbjct: 1068 YVKKQLRSYETSLQSLKIRDVSKLLSQLNDGIIESCTDVTAKVMNGDIVQTQSITDVGNN 1127

Query: 1160 ENMEGVEIETNESDVSPDANNDLEMEIDEDNNEISKGIPRISEDEFKNVDVEELEAQKLQ 1219
            + ME                       D        G+P ++E E +N+D+E LE +  Q
Sbjct: 1128 DAME-----------------------DSGEAATHSGLPSLTETELENLDLETLELELHQ 1164

Query: 1220 LQDYIDTVNVNIDVLEEYARRVAEYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQG 1279
            LQDY+D  N +I+VLEEYARR+AEY+RRKLDLN AV +RE+VR   +  K  R E+FM+G
Sbjct: 1165 LQDYLDNFNGDIEVLEEYARRLAEYQRRKLDLNQAVAKREEVRNKCESFKNERLEKFMEG 1224

Query: 1280 FGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTL 1339
            FG+IS+TLKEMYQMITMGGNAELELVDSLDPFSEGV FSVMPPKKSWRNI+NLSGGEKTL
Sbjct: 1225 FGIISMTLKEMYQMITMGGNAELELVDSLDPFSEGVLFSVMPPKKSWRNISNLSGGEKTL 1284

Query: 1340 SSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFEL 1399
            SSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFEL
Sbjct: 1285 SSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFEL 1344

Query: 1400 AEQLVGIYKSNNQTKSATLQNNDIIN 1425
            A+ LVGIYK+NN TKS TLQN DI++
Sbjct: 1345 AQNLVGIYKNNNMTKSTTLQNIDILH 1370

>CAGL0L12188g Chr12 (1310968..1315164) [4197 bp, 1398 aa] {ON} similar
            to uniprot|Q12267 Saccharomyces cerevisiae YLR086w Stable
            Maintenance of Chromosomes
          Length = 1398

 Score = 1117 bits (2888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 658/1387 (47%), Positives = 883/1387 (63%), Gaps = 37/1387 (2%)

Query: 56   QTPKKLILRDY---DSIAITPTAAMPPSSSLQAPSLHPP-TESSSRGRTARTYXXXXXXX 111
            Q+P+ +  R+    ++  + PT     S +LQ PSL PP +  S+RGR  ++Y       
Sbjct: 32   QSPRAITPRNLLGSENRNVLPTGG---SQNLQIPSLLPPESLGSARGRDFKSYSQSPPRS 88

Query: 112  XXXXXXXXXTRKLELIQLSPVKNSRIALQKIYESKN-EKQIERLCIDKLVLHDFKSYAGT 170
                     TR+L+LI+LSP+KNSR  LQK+YESK  + + ERL I +LVL+DFKSYAG 
Sbjct: 89   PGRSP----TRRLKLIELSPIKNSRAELQKLYESKKLDVKKERLFIHQLVLNDFKSYAGR 144

Query: 171  QVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHKSENFPDLKSC 230
            QV+GPFH+SFSA+VGPNGSGKSNVIDSMLFVFGFRA+KMRQDRLSDLIHKSE FPDLKSC
Sbjct: 145  QVIGPFHTSFSAIVGPNGSGKSNVIDSMLFVFGFRANKMRQDRLSDLIHKSETFPDLKSC 204

Query: 231  SVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEG 290
            SVEVHF+YVIDK DG+T I+  K  LV+TRKAFKNN SKY++NGKESNYT VT LLK EG
Sbjct: 205  SVEVHFKYVIDKDDGSTTIDETKGNLVVTRKAFKNNASKYFVNGKESNYTEVTTLLKKEG 264

Query: 291  IDLDHNRFLILQGEVENIAQMKPKAENXXXXXXXXXXXXIIGTAKYKPLIEKKFEEIEAL 350
            IDLDH RFLILQGEVENIAQMK KAE             IIGT+KYK  IEK   EIE+L
Sbjct: 265  IDLDHKRFLILQGEVENIAQMKAKAEKENDDGLLEYLEDIIGTSKYKESIEKLSMEIESL 324

Query: 351  NEICIEKENRFEIVDREKASLESGXXXXXXXXXXXXXXXXXXXXXYQYKLWQDNKKLSTT 410
            NEIC+EKENRF IV+REK SLESG                     YQY L QDNKKL   
Sbjct: 325  NEICVEKENRFSIVEREKNSLESGKEEALQFLNKEKELVLEKSKLYQYNLMQDNKKLDDV 384

Query: 411  LEKLSNIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQKRNYDTER 470
            L K +N+++E  + + +       +++I+ S + +  +++    +E  L+  KR  + ++
Sbjct: 385  LNKKTNVQQEQTKQEDEFRKANSHISDITASLNVLKADLEKVHTEEVNLSKTKRTLENKK 444

Query: 471  VSLEEQRKNIXXXXXXXXXXLEDCNKTISNTKIKIEDLGKNESEYESQLDELNAQLQIER 530
            V  E+   N+           +     I++T  +I+ + + +S        L+  L IE+
Sbjct: 445  VENEQIVNNLDSKRKEFEEQSKILQDKINSTDQEIQTIIEEQSSLAEGTTVLSTNLDIEK 504

Query: 531  GLLEEIKISLKDKTIEFSDEISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLE 590
              LE IK+ L++KT   + +I+++EKEL PWN Q Q  K +I++ ESE+S+I+E R  LE
Sbjct: 505  EKLENIKLKLREKTEHLTIQIAEYEKELSPWNEQSQQLKKEIKITESELSIIEENRKGLE 564

Query: 591  NDIENLNSLXXXXXXXXXXXXXXXXXLRNELNRITKEVSIGDTEYTNAKEKLREMKAVLN 650
            NDI  L +                  L  +  ++ +E  +G+ E  NA+  L  ++  + 
Sbjct: 565  NDIAGLENAILSQKRDLEVQEQEIKSLLEQKTKVIQERELGERECKNAQATLANVREKVE 624

Query: 651  QHRQKAIDARTSLSAEENKNQVLASLFRLQKSGRISGFYGRLGDLGAIDDRYDIAISTAC 710
              RQKAI+ R++ SA EN N+VL++L RLQKSGR++GF+GRLGDL  ID +YD+AISTAC
Sbjct: 625  ALRQKAIEIRSTYSATENNNKVLSALLRLQKSGRLNGFHGRLGDLAVIDPKYDVAISTAC 684

Query: 711  PRLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNVPRLFDLVIS 770
            PRLNDLVV+TVE GQQCIEYLRKNKLGYARFILL+KL  F+ N+I TP+   RLFDL+  
Sbjct: 685  PRLNDLVVDTVESGQQCIEYLRKNKLGYARFILLDKLNTFNTNRIDTPDQSQRLFDLITV 744

Query: 771  SDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRVVTLSGELIDVXXXXXXXXXXXXX 830
             + +F  AFYSVLRDTLV  N++ ANRVAYG KR+RVVTL G LID+             
Sbjct: 745  KEKRFNNAFYSVLRDTLVCQNMEQANRVAYGKKRYRVVTLDGNLIDLSGTMTGGGRNVSK 804

Query: 831  XLMKLTKSGNSGFKSYTIEDVEKIEKELAAREKNFEIANETFTEMETELRRLKDRKPDVE 890
             LMKL+KS + G   ++ E+V+ IE EL  +E  ++ A + + EME ELRRL+DR P+++
Sbjct: 805  GLMKLSKSSSKGSAFFSPEEVQAIENELNQKENQYKSALDAYHEMEEELRRLRDRAPEID 864

Query: 891  LEISKFELEITSWVTEHELMQQQLN---EKQQSLDECMSNNEELSTMEHELGTLQNDYKS 947
              +SK E++I    T H  +   +N   EK++ L+   + N+   T+  +L  L++    
Sbjct: 865  NLVSKKEMDIE---TAHNDINSNINVLEEKRKKLESMKNQNDPSITLLAKLKELKSKLDD 921

Query: 948  LQLETKSKKDRIKFLKDEIMKVGGIKLQVQSSKVDSIIQKKDIXXXXXXXXXXXXXXAET 1007
            + ++TKS KD+IK +KD+I+++GG +L+ QS  V  I  K                  E+
Sbjct: 922  IDVQTKSTKDKIKTIKDKIIELGGDELKNQSLLVTDITNKISENSRRLKKIKSNKLKKES 981

Query: 1008 ELKRLSKKQSECSTDLLTSTDKLENTDGQLSKIXXXXXXXXXXXXXXXXXREESLQNSEN 1067
             LK+ +K+ +E + +L   +   EN D + SK                   E  L++   
Sbjct: 982  LLKKFNKELTEANEELTNFSKNAENADIE-SKEIESKLLDIKESIENLKENEVKLEHEIE 1040

Query: 1068 LK-DQLKEFEENLNSFKVFQXXXXXXXXXXXXXXXXXXXDIRSTDSELQSLKIRDITHTL 1126
            +K ++L+  ++ ++ +K                       I+  +  L  L IRD+T  L
Sbjct: 1041 MKHNELESHQKVVSDYKSISLEYNNKLEKLEASEASLKKSIKRYNDLLSELTIRDVTQVL 1100

Query: 1127 QEL---DNGNIDQDEEDVSMKDNAVSVSANNSLGNSENMEGVE-IETNESDVSPDANNDL 1182
              +   +N ++D+   D  +++ +  ++A++        +G+  +  N+S    D N+D+
Sbjct: 1101 NTIMTEENASVDKS--DPKLENTSAVINADD--------DGISAVSENQSFNHNDENDDI 1150

Query: 1183 E---MEIDEDNNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYAR 1239
            +   MEID     I+ GIP +S  E   VD +E+E     L D+I +   N+DVLEEYA 
Sbjct: 1151 DSNKMEIDSQGGFINPGIPVLSASELAKVDPQEVELLITSLDDFITSSEANVDVLEEYAL 1210

Query: 1240 RVAEYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGN 1299
            R  E+ +RK DLN+AV  R+ V++ L+ +K+ R++EFM+GF +IS+TLKEMYQMIT+GGN
Sbjct: 1211 RFVEFNKRKNDLNSAVQSRDSVKDRLEGIKRKRYDEFMEGFKIISMTLKEMYQMITLGGN 1270

Query: 1300 AELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVM 1359
            AELELVDSLDPFSEGVTFSVMPPKKSWRNI+NLSGGEKTLSSLALVFALHKYKPTPLYVM
Sbjct: 1271 AELELVDSLDPFSEGVTFSVMPPKKSWRNISNLSGGEKTLSSLALVFALHKYKPTPLYVM 1330

Query: 1360 DEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQ 1419
            DEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFEL +QLVGIYK  N TKSA L 
Sbjct: 1331 DEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELTKQLVGIYKHENMTKSAALV 1390

Query: 1420 NNDIINR 1426
            N D++ R
Sbjct: 1391 NEDLVGR 1397

>NDAI0G03320 Chr7 (781468..785163) [3696 bp, 1231 aa] {ON} 
          Length = 1231

 Score =  177 bits (449), Expect = 4e-44,   Method: Compositional matrix adjust.
 Identities = 208/784 (26%), Positives = 351/784 (44%), Gaps = 145/784 (18%)

Query: 687  GFYGRLGDLG-AIDDRYDIAISTACPR-LNDLVVETVECGQQCIEYLRKNKLGYARFILL 744
            G  G + DL     D+Y +A+ST   +  + ++V+ +   Q+CI + +K + G A FI L
Sbjct: 534  GVRGLVHDLCRPKKDKYGLAVSTILGKNFDSIIVDNLNVAQECIAFFKKQRSGTASFIPL 593

Query: 745  EKLRNFDMNKISTPNNVPRLFDL-VISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNK 803
            + + + +   ++ P++   +  +  I  DP++  A   V  D+++ N+L  A  + +   
Sbjct: 594  DTISS-EQPTLNLPSSQDYILTINAIEYDPEYERAMQYVCSDSIICNSLDIARDLKWNKG 652

Query: 804  -RFRVVTLSGELIDVXXXXXXXXXXXXXXLMK--LTKSGNSGFKSYTIEDVEKIEKELAA 860
             R ++VT+ G LI                LM   ++K  N+ +     + +  ++ +L  
Sbjct: 653  VRSKLVTIEGALI------------HKAGLMTGGISKDSNNRWDKEEYQSLMTLKDKLLL 700

Query: 861  REKNFEIANETFTEMETELRRLKDRKPDVELEISKFELEITSWVTEHELMQQQLNEKQQS 920
            +            E+ T+ R    R  DVE+E+S    EI+S       ++ QL++ Q+S
Sbjct: 701  Q----------VEEISTKSRLSSTRARDVEIELSTLNAEISS-------LRMQLSQVQRS 743

Query: 921  LDE-------------------CMSNNEELSTMEHELGTLQNDYKSLQLET-KSKKDRIK 960
            LDE                     S  E++   +     L+++ + LQ E  K   D++ 
Sbjct: 744  LDENKTEINHQNTLLDQQYNPKLKSLKEKVDEFDKSWNELKSNKEKLQNEIFKELTDKVG 803

Query: 961  FLKDEIMKVGGIKLQVQSSKVDSIIQKKDIXXXXXXXXXXXXXXAETELKRLSKKQSECS 1020
            F  +E  +  G  L+ QS                             EL++L K+     
Sbjct: 804  FTIEEYERHSGELLRKQSK----------------------------ELQQLQKEILNIE 835

Query: 1021 TDLLTSTDKLENTDGQLSKIXXXXXXXXXXXXXXXXXREESLQNSEN-LKDQLKEFEENL 1079
              L    ++LENT  +L+                     +SLQ  EN L +Q+K+ E  +
Sbjct: 836  NKLQFEIERLENTQKRLTSAESNLEKAHETL--------KSLQKDENELAEQVKQIESEI 887

Query: 1080 NSFKVFQXXXXXXXXXXXXXXXXXXXDIRSTDSELQSLKIRDITHTLQELDNGNIDQDEE 1139
            NS +                      DI   +  L  L   D + TL+     N D+ +E
Sbjct: 888  NSAR-------NELDSVNKVFTAQQLDINRMEESLGELN--DNSQTLKR----NRDEIKE 934

Query: 1140 DVSMKD-NAVSVSANNSLGNSENMEGVEIETNESDVSPDANNDLEMEIDED----NNEIS 1194
            D++  D   + +  N  + N +    V  ETN SD+  D        IDED    +NEI 
Sbjct: 935  DIAKNDLERIGILKNAKVTNIDI--PVISETNLSDLPID-------RIDEDTISVSNEID 985

Query: 1195 ---KGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVAEYKRRKLDL 1251
                 +P   ++E  +    EL+ +   ++D +D +  N       A R  E + R   +
Sbjct: 986  VDYTALPAKYKEEMGSATKNELDTKIKNVEDLLDVLQPNARA----ADRFTEAQERFEII 1041

Query: 1252 NNAVD-----EREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMIT---------MG 1297
            +   +     ER+ +++ L K+KK R E F   F  +S  L  +Y+ +T          G
Sbjct: 1042 DGETEKIKTTERKALQQFL-KIKKKRKELFENAFDFVSEHLDNIYRELTRNPNSSADLAG 1100

Query: 1298 GNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLY 1357
            GNA L L D  +PF+ GV +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +
Sbjct: 1101 GNASLTLEDEDEPFNAGVRYHATPPLKRFKDMEYLSGGEKTVAALALLFAINAYQPSPFF 1160

Query: 1358 VMDEIDAALDFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAEQLVGIYKSN--NQTK 1414
            V+DE+DAALD  NV  +A YI+     N QFIVISL+N MFE ++ LVG+++    N +K
Sbjct: 1161 VLDEVDAALDITNVERIAAYIRRHGNPNLQFIVISLKNTMFEKSDALVGVFRQQQENSSK 1220

Query: 1415 SATL 1418
              TL
Sbjct: 1221 IVTL 1224

>Kwal_23.5043 s23 (978758..982435) [3678 bp, 1225 aa] {ON} YFL008W
            (SMC1) - SMC chromosomal ATPase family member [contig 7]
            FULL
          Length = 1225

 Score =  149 bits (375), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 81/218 (37%), Positives = 132/218 (60%), Gaps = 19/218 (8%)

Query: 1220 LQDYIDTVNVNIDVLEEYARRVAEYKRRKLDLNNAVDEREK-------VRELLDKLKKTR 1272
            L+  ID +N  + +L+  ++    Y+  KL   +   E EK       V E   ++K+ R
Sbjct: 1001 LKKSIDELNELLTILQPNSKAAGRYEDAKLRYESIYKETEKCKAKEKKVNEDFTRIKRLR 1060

Query: 1273 FEEFMQGFGVISITLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMPPK 1323
             E F + F  +S ++ E+Y+ +T          GGNA L L D  +P+  G+ +   PP 
Sbjct: 1061 KEAFEKAFDHVSSSIDEIYRELTRDPHSRAELAGGNASLTLEDEDEPYLAGIRYHATPPA 1120

Query: 1324 KSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT- 1382
            K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV  VA+YI+ +  
Sbjct: 1121 KRFKDMEYLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDISNVERVASYIRRKAG 1180

Query: 1383 KNAQFIVISLRNNMFELAEQLVGIYK--SNNQTKSATL 1418
             + QFIVISL+N MFE ++ LVG+++   NN +K+ TL
Sbjct: 1181 ADLQFIVISLKNTMFEKSQALVGVFRQQQNNTSKALTL 1218

 Score = 95.1 bits (235), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 67/222 (30%), Positives = 111/222 (50%), Gaps = 36/222 (16%)

Query: 159 LVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLI 218
           L L++FKSY G   +G   S+F++++GPNGSGKSN++D++ FV G ++  +R   L+DLI
Sbjct: 7   LELNNFKSYKGKVSIGFRDSNFTSIIGPNGSGKSNLMDAISFVLGVKSVHLRSHLLADLI 66

Query: 219 HK--------------SENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFK 264
           ++              SEN P+  S  V+  +      P      N   + + ++R   +
Sbjct: 67  YRGTLSEEEASSADFESENHPN--SAYVKAFY-----SPS-----NNEDDVVELSRTVTR 114

Query: 265 NNTSKYYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPKAENXXXXXXX 324
           +  S Y I+GK   Y   ++ L+ E I +    FL+ QG+VE +A  KP+          
Sbjct: 115 SQESTYRIDGKTVGYKKYSQFLESENILIKARNFLVFQGDVEQVAAQKPQ-------ELT 167

Query: 325 XXXXXIIGTAKYKPLIEKKFEEIE-ALNEI--CIEKENRFEI 363
                + G+ +YK   ++  EE+E A +E   CI+   R  I
Sbjct: 168 DLFEQVSGSLQYKQDYDRIREELERARSETSDCIQSRKRAHI 209

>KNAG0G00910 Chr7 (172759..176439) [3681 bp, 1226 aa] {ON} Anc_8.68
            YFL008W
          Length = 1226

 Score =  143 bits (360), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 92/273 (33%), Positives = 153/273 (56%), Gaps = 34/273 (12%)

Query: 1161 NMEGVEIETNESDVSPDANNDLEMEIDEDNNEISKGIPRISEDEFKNVDVEELEAQKLQL 1220
            N+  V I +NE   +   +N+++++ +E        +P     ++K    ++LE +   L
Sbjct: 958  NLADVPITSNEQGDAIKMSNEIDIDYEE--------LP----TKYKESSSKQLEKE---L 1002

Query: 1221 QDYIDTVNVNIDVLEEYARRVAEYKRRKLDLNNAVD--------EREKVRELLDKLKKTR 1272
               I+ VN  +++L+  AR V  +   + +  NA+D        E  K+     K KK R
Sbjct: 1003 TRSIEEVNEMLEILQPNARAVGRFDEAQ-ERFNAIDNETERLKSEERKIYAQFLKTKKKR 1061

Query: 1273 FEEFMQGFGVISITLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMPPK 1323
             E F + F  +S  +  +Y+ +T          GG+A L L D  +PF+ G+ +   PP 
Sbjct: 1062 KELFDRAFDYVSTHIDGIYRELTKDPNSTAELAGGSASLTLEDEDEPFNAGIKYHATPPL 1121

Query: 1324 KSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-KERT 1382
            K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAALD +NV  +A YI K   
Sbjct: 1122 KRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAALDIKNVERIAAYIRKHGN 1181

Query: 1383 KNAQFIVISLRNNMFELAEQLVGIYKSNNQTKS 1415
             + QFIVISL+N+MFE ++ LVG+Y+   +  S
Sbjct: 1182 PSLQFIVISLKNSMFEKSDALVGVYRRQQENSS 1214

>TPHA0P00340 Chr16 (65711..69370) [3660 bp, 1219 aa] {ON} Anc_8.68
            YFL008W
          Length = 1219

 Score =  143 bits (360), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 80/213 (37%), Positives = 130/213 (61%), Gaps = 17/213 (7%)

Query: 1220 LQDYIDTVNVNIDVLEEYARRVAEYKRRKLDLNNAVDEREKV----RELLDK---LKKTR 1272
            L+  I+ V   +  L+  AR V  +   K   ++A DE E +    R+LL +   +KK R
Sbjct: 995  LEHEIEVVEDLLQDLQPNARAVDRFDEAKERFDSASDETETLKKQERKLLTQFLAIKKKR 1054

Query: 1273 FEEFMQGFGVISITLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMPPK 1323
             E F + F  +S  ++ +Y+ +T          GGNA L L D  +PF  G+ +   PP 
Sbjct: 1055 REVFEKAFDYVSEHIEPIYRELTKNPNSTAELSGGNASLTLEDEDEPFDAGIKYHATPPL 1114

Query: 1324 KSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT- 1382
            K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  N+  +ANYI++ + 
Sbjct: 1115 KRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFILDEVDAALDVTNIERIANYIRKHSN 1174

Query: 1383 KNAQFIVISLRNNMFELAEQLVGIYKSNNQTKS 1415
             + QFIVISL+N+MFE ++ LVGI++   +  S
Sbjct: 1175 SDIQFIVISLKNSMFEKSDALVGIHRQQQENSS 1207

 Score = 94.7 bits (234), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 83/164 (50%), Gaps = 21/164 (12%)

Query: 159 LVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLI 218
           L L +FKSY G   VG   S+F++++GPNGSGKSN++D++ FV GF++S +R   L DL+
Sbjct: 7   LELFNFKSYKGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGFQSSNLRSSTLKDLV 66

Query: 219 HKSENFPD--------LKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKY 270
           ++     D         +S  V+  +E      DGT +         + R       S Y
Sbjct: 67  YRDIASADENEFGEDGERSAYVKAFYE-----KDGTVV--------ELMRAITAGRDSVY 113

Query: 271 YINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPK 314
            I+ K + Y   +  L  E I +    FL+ QG+VE IA   P+
Sbjct: 114 KIDNKTTTYKHYSDFLAAENILIKARNFLVFQGDVEQIAAQSPR 157

>Smik_6.71 Chr6 (132627..136313) [3687 bp, 1228 aa] {ON} YFL008W
            (REAL)
          Length = 1228

 Score =  142 bits (358), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 78/234 (33%), Positives = 134/234 (57%), Gaps = 10/234 (4%)

Query: 1195 KGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARRVAEYKRRKLDLNNA 1254
            KG+P+  ++   +    ELE +  ++++ ++ +  N   +E Y      ++    +    
Sbjct: 986  KGLPKKYKENNSDSAKRELEQKIREIEEILNELQPNARAVERYDEAEGRFEVINNETEQL 1045

Query: 1255 VDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMIT---------MGGNAELELV 1305
              E +K+     K+K+ R E F + F  +S  L  +Y+ +T          GGNA L + 
Sbjct: 1046 KTEEKKILNQFLKIKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIE 1105

Query: 1306 DSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1365
            D  +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAA
Sbjct: 1106 DEDEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAA 1165

Query: 1366 LDFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATL 1418
            LD  NV  +A YI + R  + QFIVISL+N MFE ++ LVG+Y+   +  S  +
Sbjct: 1166 LDITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKII 1219

 Score = 87.0 bits (214), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 51/159 (32%), Positives = 84/159 (52%), Gaps = 4/159 (2%)

Query: 159 LVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLI 218
           L L +FKSY G   VG   S+F++++GPNGSGKSN++D++ FV G R++ +R + L DLI
Sbjct: 7   LELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNILKDLI 66

Query: 219 HKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEK----LVITRKAFKNNTSKYYING 274
           ++     D      +   + V      +  +    +K    + + R   +N  + Y I+ 
Sbjct: 67  YRGVLNDDNDDNYNDTSDDDVASSNPKSAYVKAFYQKGNKMVELMRIISRNGDTSYKIDE 126

Query: 275 KESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP 313
           K  +Y   +  L++E I +    FL+ QG+VE IA   P
Sbjct: 127 KTVSYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSP 165

 Score = 58.9 bits (141), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 37/133 (27%), Positives = 72/133 (54%), Gaps = 5/133 (3%)

Query: 687 GFYGRLGDLG-AIDDRYDIAISTACPR-LNDLVVETVECGQQCIEYLRKNKLGYARFILL 744
           G  G + DL     ++Y +A+ST   +  + ++VE +   Q+CI +L+K + G A FI L
Sbjct: 531 GVKGLVHDLCHPKKEKYGLAVSTILGKNFDSVIVENLTVAQECIAFLKKQRAGTASFIPL 590

Query: 745 EKLRNFDMNKISTPNNVPRLFDL-VISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNK 803
           + +   ++  +S P++   +  +  I  +P++  A   V  D+++ N+LK A  + +   
Sbjct: 591 DTIET-ELPTLSLPDSQEYILSINAIDYEPEYEKAMQYVCGDSIICNSLKIAKGLKWNKG 649

Query: 804 -RFRVVTLSGELI 815
            R ++VT+ G LI
Sbjct: 650 VRAKLVTIEGALI 662

>Skud_6.64 Chr6 (121616..125308) [3693 bp, 1230 aa] {ON} YFL008W
            (REAL)
          Length = 1230

 Score =  141 bits (356), Expect = 4e-33,   Method: Compositional matrix adjust.
 Identities = 70/172 (40%), Positives = 109/172 (63%), Gaps = 10/172 (5%)

Query: 1257 EREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMIT---------MGGNAELELVDS 1307
            E +K+     K+K+ R E F + F  +S  L  +Y+ +T          GGNA L + D 
Sbjct: 1050 EEKKILSQFLKIKRKRKELFEKTFDYVSDHLDAIYRELTKNPNSNVELAGGNASLTIEDE 1109

Query: 1308 LDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD 1367
             +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD
Sbjct: 1110 DEPFNAGIKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALD 1169

Query: 1368 FRNVSIVANYI-KERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATL 1418
              NV  +A YI + R  + QFIVISL+N MFE ++ LVG+Y+   +  S T+
Sbjct: 1170 ITNVQRIAAYIRRHRNPDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKTI 1221

 Score = 90.9 bits (224), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 54/174 (31%), Positives = 89/174 (51%), Gaps = 32/174 (18%)

Query: 159 LVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLI 218
           L L +FKSY G   VG   S+F++++GPNGSGKSN++D++ FV G R++ +R + L DLI
Sbjct: 7   LELSNFKSYRGVTKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSNHLRSNVLKDLI 66

Query: 219 HKS-------------------ENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVIT 259
           ++                        + KS  V+  ++       G  ++  ++   +I+
Sbjct: 67  YRGILNDGNDNDNDDDSASDDDATTSNPKSAYVKAFYQ------KGNKLVELMR---IIS 117

Query: 260 RKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP 313
           R    N  + Y I+GK  +Y   +  L++E I +    FL+ QG+VE IA   P
Sbjct: 118 R----NGDTSYKIDGKSVSYRDYSVFLENENILIKAKNFLVFQGDVEQIAAQSP 167

>KLTH0A02706g Chr1 complement(234723..238409) [3687 bp, 1228 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  141 bits (355), Expect = 6e-33,   Method: Compositional matrix adjust.
 Identities = 77/219 (35%), Positives = 131/219 (59%), Gaps = 19/219 (8%)

Query: 1219 QLQDYIDTVNVNIDVLEEYARRVAEYKRRKLDLNN-------AVDEREKVRELLDKLKKT 1271
            +LQ  ID +N  + VL+  ++    Y+  K+   +          + +KV E   K+++ 
Sbjct: 1003 ELQRSIDELNELLTVLQPNSKAAGRYEEAKVKYESIFKETEKCKTKEKKVNEQFAKIRRL 1062

Query: 1272 RFEEFMQGFGVISITLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMPP 1322
            R + F   F  +S  + ++Y+ +T          GGNA L L D  +P+  G+ +   PP
Sbjct: 1063 RKDAFESAFDHVSNAIDDVYRELTRDPHSTAELAGGNASLTLEDEDEPYLAGIRYHATPP 1122

Query: 1323 KKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1382
             K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD  NV  +A YI++R 
Sbjct: 1123 TKRFKDMEFLSGGEKTIAALALLFAINSFQPSPFFVLDEVDAALDILNVERIATYIRQRA 1182

Query: 1383 -KNAQFIVISLRNNMFELAEQLVGIYKS--NNQTKSATL 1418
              N QFIVISL+N MFE ++ LVG+++   +N +++ TL
Sbjct: 1183 LSNLQFIVISLKNTMFEKSQALVGVFRQQRDNTSRALTL 1221

 Score = 92.4 bits (228), Expect = 6e-18,   Method: Compositional matrix adjust.
 Identities = 55/164 (33%), Positives = 85/164 (51%), Gaps = 15/164 (9%)

Query: 161 LHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLIHK 220
           L++FKSY G   +G   S+F++V+GPNGSGKSN++D++ FV G ++  +R   L+DLI++
Sbjct: 9   LYNFKSYKGKVSIGFGESNFTSVIGPNGSGKSNLMDAISFVLGMKSIHLRSHTLADLIYR 68

Query: 221 SE-NFPDLKSCSVEVH---------FEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKY 270
                 D  S   E H         +      P G    N V E   +TR    +  S Y
Sbjct: 69  GTLQDGDADSGYSETHDNENNPSSAYVKAFYSPSGQE--NDVAE---LTRTITLSQESTY 123

Query: 271 YINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPK 314
            +NG+  ++      L+ E I +    FL+ QG+VE +A  KP+
Sbjct: 124 KLNGETVSHKKYCDFLESENILIKARNFLVFQGDVEQVASQKPR 167

>KAFR0C03200 Chr3 (643231..646902) [3672 bp, 1223 aa] {ON} Anc_8.68
            YFL008W
          Length = 1223

 Score =  140 bits (352), Expect = 1e-32,   Method: Compositional matrix adjust.
 Identities = 71/164 (43%), Positives = 106/164 (64%), Gaps = 12/164 (7%)

Query: 1267 KLKKTRFEEFMQGFGVISITLKEMYQMITM---------GGNAELELVDSLDPFSEGVTF 1317
            K+KK R E F + F  ++  L  +Y+ +T          GGNA L L D  +PF+ G+ +
Sbjct: 1053 KIKKRRRELFEKAFEHVTNHLDSIYRELTRDPHSSAELSGGNASLTLEDEDEPFNAGIRY 1112

Query: 1318 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1377
               PP K ++++  LSGGEKT+++LAL+FA++ ++P+P +V+DE+DAALD RNV  +A Y
Sbjct: 1113 HATPPLKRFKDMEYLSGGEKTMAALALLFAINSFQPSPFFVLDEVDAALDVRNVERIAAY 1172

Query: 1378 IKER-TKNAQFIVISLRNNMFELAEQLVGIYKSN--NQTKSATL 1418
            I+     N QFIVISL+N MFE ++ LVG+Y+    N +K  TL
Sbjct: 1173 IRRHGNPNLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTL 1216

 Score = 94.4 bits (233), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 54/159 (33%), Positives = 86/159 (54%), Gaps = 9/159 (5%)

Query: 159 LVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLI 218
           L L++FKSY G+  +G   S+F++++GPNGSGKSN++D++ FV G R+S +R   L DLI
Sbjct: 7   LELYNFKSYKGSVKLGFGESNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSSILRDLI 66

Query: 219 HKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEK----LVITRKAFKNNTSKYYING 274
           ++      +     E   +  ++ P  T  +    EK    + + R   +N  + Y I G
Sbjct: 67  YRGV----ITGEDSESDEDGSVNNP-STAYVKAFYEKENKTIELMRTISRNGDTNYKIGG 121

Query: 275 KESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP 313
           K  +Y   +  L+ E I +    FL+ QG+VE IA   P
Sbjct: 122 KVVSYKDYSSFLESENILIKAKNFLVFQGDVEQIASQSP 160

>SAKL0B02288g Chr2 (215750..219436) [3687 bp, 1228 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1228

 Score =  139 bits (351), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 67/169 (39%), Positives = 111/169 (65%), Gaps = 10/169 (5%)

Query: 1260 KVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMIT---------MGGNAELELVDSLDP 1310
            K+RE   K+K++R E F + +  +S  + ++Y+ +T          GG+A L L D  +P
Sbjct: 1051 KIREQYLKVKQSRREMFEKAYNHVSDHIDQIYRELTKDPHSTAALAGGSASLTLEDEDEP 1110

Query: 1311 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1370
            +  G+ +   PP K ++++ +LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAALD  N
Sbjct: 1111 YLAGIKYHATPPMKRFKDMEHLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAALDNTN 1170

Query: 1371 VSIVANYIKER-TKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATL 1418
            V  +A YIK   + N QFIVISL+N+MFE ++ LVG+++   +  S  +
Sbjct: 1171 VEKIATYIKRHASPNFQFIVISLKNSMFEKSQALVGVFRQQQENTSKVI 1219

 Score = 88.6 bits (218), Expect = 8e-17,   Method: Compositional matrix adjust.
 Identities = 54/156 (34%), Positives = 82/156 (52%), Gaps = 5/156 (3%)

Query: 159 LVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLI 218
           L L +FKSY GT  VG   ++F++++GPNGSGKSN++D++ FV G R+S +R   L DL+
Sbjct: 7   LELSNFKSYKGTVKVGFGDANFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSHLLMDLV 66

Query: 219 HKSENFPDLKSCSVEVHFEYVIDKPDGTTI-INTVKEK----LVITRKAFKNNTSKYYIN 273
           ++     D +    E      I       +    +KE     +   R   ++  S Y +N
Sbjct: 67  YRGRRTGDEEESMEEEPSSSKISSTRSAYVKAFYLKEGEESPIEFMRTISRSGESAYKVN 126

Query: 274 GKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIA 309
           GK   Y   T +L+ E I +    FL+ QG+VE IA
Sbjct: 127 GKTVGYKDYTDILEKENILIKARNFLVFQGDVEQIA 162

>Kpol_1011.5 s1011 complement(13399..17064) [3666 bp, 1221 aa] {ON}
            complement(13399..17064) [3666 nt, 1222 aa]
          Length = 1221

 Score =  136 bits (343), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 77/184 (41%), Positives = 117/184 (63%), Gaps = 17/184 (9%)

Query: 1258 REKVRELLDK---LKKTRFEEFMQGFGVISITLKEMYQMIT---------MGGNAELELV 1305
            ++K R+LL +   +KK R E F + F  ++  +  +Y+ +T          GGNA L L 
Sbjct: 1039 KKKERKLLTQFVNIKKKRKELFEKAFEYVNEHIDPIYRELTKNPNSSVELAGGNASLTLE 1098

Query: 1306 DSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1365
            D  +P++ GV +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DEIDAA
Sbjct: 1099 DEDEPYNGGVKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEIDAA 1158

Query: 1366 LDFRNVSIVANYIKERTKNA--QFIVISLRNNMFELAEQLVGIYKSN--NQTKSATLQNN 1421
            LD  NV  +A YI +R  N   QFIVISL+N+MFE +E LVGIY+    N ++  TL   
Sbjct: 1159 LDITNVERIATYI-QRHGNPELQFIVISLKNSMFEKSEALVGIYRHQKENSSRIITLNLT 1217

Query: 1422 DIIN 1425
            + +N
Sbjct: 1218 NYVN 1221

 Score = 90.9 bits (224), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 58/159 (36%), Positives = 83/159 (52%), Gaps = 19/159 (11%)

Query: 159 LVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLI 218
           L L++FKSY G   VG   S+F++++GPNGSGKSN++D++ FV G ++S +R + L DLI
Sbjct: 7   LELNNFKSYKGVVNVGFGESNFTSIIGPNGSGKSNMMDAISFVLGVQSSHLRSNVLKDLI 66

Query: 219 HKS--------ENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKY 270
           ++          N  D+   S  V   Y   K D T           + R    +  S Y
Sbjct: 67  YRGFLSGDDEDNNNEDVNPNSAYVKAFY--QKEDVTH---------ELMRSISNSGDSTY 115

Query: 271 YINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIA 309
            IN K  +Y   T  L+DE I +    FL+ QG+VE IA
Sbjct: 116 KINNKTVSYKQYTSFLEDENILIKAKNFLVFQGDVEQIA 154

>KLLA0D07502g Chr4 complement(642751..646482) [3732 bp, 1243 aa] {ON}
            similar to uniprot|P32908 Saccharomyces cerevisiae
            YFL008W SMC1 Subunit of the multiprotein cohesin complex
            essential protein involved in chromosome segregation and
            in double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1243

 Score =  134 bits (337), Expect = 9e-31,   Method: Compositional matrix adjust.
 Identities = 73/202 (36%), Positives = 119/202 (58%), Gaps = 17/202 (8%)

Query: 1224 IDTVNVNIDVLEEYARRVAEYKRRKLDLNNAVDEREKVR-------ELLDKLKKTRFEEF 1276
            I  V   +++L+  ++ V  Y   K  L+   +E E++R       E   ++K  R E F
Sbjct: 1022 IKKVEEKLEILQPNSKAVQRYDETKHKLDQVSNENERLRNKERKAKEKFLEVKAKRKELF 1081

Query: 1277 MQGFGVISITLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMPPKKSWR 1327
               F  +   + ++Y+ +T          GGNA L + +  +P+  G+ +   PP K ++
Sbjct: 1082 EACFKHVDKHIDQIYRALTKNPHDKSELAGGNASLTVENEDEPYLGGIKYFATPPLKRFK 1141

Query: 1328 NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK-NAQ 1386
            ++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAALD  NV  +A+YIK     NAQ
Sbjct: 1142 DMEYLSGGEKTMAALALLFTINSYQPSPFFVLDEVDAALDITNVERIAHYIKRNANPNAQ 1201

Query: 1387 FIVISLRNNMFELAEQLVGIYK 1408
            FIVISL+N MFE ++ LVGI++
Sbjct: 1202 FIVISLKNAMFEKSQSLVGIFR 1223

 Score = 85.9 bits (211), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 59/183 (32%), Positives = 88/183 (48%), Gaps = 33/183 (18%)

Query: 159 LVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLI 218
           L LH+FKSY  T  VG   S F++++GPNGSGKSN++D++ FV G R++++R   L DLI
Sbjct: 7   LELHNFKSYKDTVQVGFGESYFTSIIGPNGSGKSNLMDAISFVLGVRSNQLRSSALVDLI 66

Query: 219 HK----------------------SENFPDLKSCSVE----VHFEYVIDKPDGTTIINTV 252
           ++                      SE  P+  + S E     +   V  K D       +
Sbjct: 67  YRGRIENGDPDNGNAKRMHRSDADSEAGPENATYSEEEPRSAYVSCVYQKDD-------L 119

Query: 253 KEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMK 312
            E    TR    +  S Y IN +  +Y    + L+ E I +    FL+ QG+VE IA   
Sbjct: 120 DEPTKFTRTINTSGDSVYKINDRAVSYKKYNEELESENILVKAKNFLVFQGDVERIASQG 179

Query: 313 PKA 315
           P++
Sbjct: 180 PES 182

>TBLA0G03530 Chr7 complement(941941..945639) [3699 bp, 1232 aa] {ON}
            Anc_8.68 YFL008W
          Length = 1232

 Score =  133 bits (335), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/176 (40%), Positives = 114/176 (64%), Gaps = 13/176 (7%)

Query: 1255 VDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITM---------GGNAELELV 1305
             +E+E + + L+ +KK R E F   F  ++  ++ +Y+ +T          GG A L L 
Sbjct: 1051 TEEKEILTKFLN-IKKKRKELFESCFDFVNEHIEPIYKELTKDPNSTTELGGGQATLTLE 1109

Query: 1306 DSLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1365
            D  +PF+ GV +   PP K ++++  LSGGEKT+++LAL+FA++ Y+P+P +V+DE+DAA
Sbjct: 1110 DEDEPFNGGVKYHATPPLKRFKDMEYLSGGEKTVAALALLFAINSYQPSPFFVLDEVDAA 1169

Query: 1366 LDFRNVSIVANYI-KERTKNAQFIVISLRNNMFELAEQLVGIYK--SNNQTKSATL 1418
            LD  NV  +A YI K   K+ QFI+ISL+N MFE ++ LVG+++  + N +K+ TL
Sbjct: 1170 LDHTNVERIAAYIRKHGNKDLQFIIISLKNTMFEKSDALVGVFRQQTENSSKALTL 1225

 Score = 92.0 bits (227), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 53/155 (34%), Positives = 86/155 (55%), Gaps = 14/155 (9%)

Query: 159 LVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLI 218
           L L +FKSY GT  +G   S+F++++GPNGSGKSN++D++ FV G R++ +R   + DLI
Sbjct: 7   LELSNFKSYKGTVKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSNDLRSSGMKDLI 66

Query: 219 HK----SENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYING 274
           H+    S++  D  + +    F  V D  + T ++  V            +  + Y ING
Sbjct: 67  HRSVRDSQSSNDDPTSAYVKAFYKVTDASEITELMRIVN----------LSGETIYKING 116

Query: 275 KESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIA 309
           K +++ + +  L  E I +    FL+ QG+VE IA
Sbjct: 117 KTTSFKNYSDWLAKENILIKAKNFLVFQGDVETIA 151

>Ecym_7303 Chr7 (638719..642387) [3669 bp, 1222 aa] {ON} similar to
            Ashbya gossypii AGL023W
          Length = 1222

 Score =  132 bits (333), Expect = 2e-30,   Method: Compositional matrix adjust.
 Identities = 71/222 (31%), Positives = 129/222 (58%), Gaps = 18/222 (8%)

Query: 1219 QLQDYIDTVNVNIDVLEEYARRVAEYKRRKLDLNNAVDEREKVREL-------LDKLKKT 1271
            + +D I  +   +  L+  ++ V  +   K   + A+DE EK++E+         K+K+ 
Sbjct: 995  EFEDSIKDIENTLRELQPNSKAVERFDEAKEQFSVAIDESEKLKEIERESKEKYLKIKEK 1054

Query: 1272 RFEEFMQGFGVISITLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTFSVMPP 1322
            R + F+  F  ++  +  +Y+ +T          GG+A L L D  +P+  G+ +   PP
Sbjct: 1055 RVKTFLSCFQHVTDHIDRIYRELTRNPGSTAELAGGSASLTLEDEDEPYLAGIRYHATPP 1114

Query: 1323 KKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER- 1381
             K ++++  LSGGEKT+++LAL+FA++ Y+P+P +++DE+DAALD  NV  +A YIK   
Sbjct: 1115 MKRFKDMDYLSGGEKTMAALALLFAINSYQPSPFFILDEVDAALDVTNVERIAAYIKRHA 1174

Query: 1382 TKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDI 1423
            +   QFIVISL++N+F  ++ + G+++ N Q  S+ +   D+
Sbjct: 1175 SPKFQFIVISLKSNLFGKSQSMAGVFR-NQQANSSMVITTDL 1215

 Score = 53.9 bits (128), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 50/169 (29%), Positives = 83/169 (49%), Gaps = 18/169 (10%)

Query: 657 IDARTSLSAEENKNQVL----ASLFRLQKSGRISGFYGRLGDLG-AIDDRYDIAISTACP 711
           +D  T+   E NK + L    A+L RL       G  G + DL     D+Y +A+S+   
Sbjct: 495 LDDLTADQRESNKERKLRENVATLKRL-----FPGVKGLVHDLCRPKKDKYALAVSSMLG 549

Query: 712 R-LNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTP-NNVPRLFDLV- 768
           +  + +VV++V   QQCI YL+K++ G A FI L+ +   D+N  + P  N+      V 
Sbjct: 550 KNFDSIVVDSVSVAQQCISYLKKHRSGAASFIPLDTI---DINTPTLPVRNLKGCILTVN 606

Query: 769 -ISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNK-RFRVVTLSGELI 815
            I  D +   A   V  D+++ + L  A  + +    + ++VT+ G LI
Sbjct: 607 AIEYDSELEKAMQYVCSDSIICDTLDIAKNLKWDRGIKSKLVTIQGALI 655

>CAGL0F02079g Chr6 (201002..204673) [3672 bp, 1223 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008w SMC1
            chromosome segregation protein
          Length = 1223

 Score =  130 bits (326), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 79/212 (37%), Positives = 121/212 (57%), Gaps = 22/212 (10%)

Query: 1232 DVLEEY---ARRVAEYKRRKLDLNNAVDEREKV----RELLD---KLKKTRFEEFMQGFG 1281
            DVLEE    AR V  +   K   +    E E +    R++ D   K+K+ R E F   F 
Sbjct: 1008 DVLEELQPNARAVERFDDAKSRFDEVDKETEGLKTEERKVFDEFLKVKQKRKELFENAFE 1067

Query: 1282 VISITLKEMYQMITM---------GGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNL 1332
             I+  L  +Y  +T          GG+A + + D  +PF+ G+ +   PP K ++++  L
Sbjct: 1068 KINEHLDAIYSELTRNVNSTSILGGGSASMTIEDEDEPFNAGIRYHATPPMKRFKDMEYL 1127

Query: 1333 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER-TKNAQFIVIS 1391
            SGGEKT+++LAL+FA++ Y P+P +++DE+DAALD  NV  +A YI+     + QFIVIS
Sbjct: 1128 SGGEKTVAALALLFAINSYNPSPFFILDEVDAALDISNVQRIAAYIRRHGNPDLQFIVIS 1187

Query: 1392 LRNNMFELAEQLVGIYKSN--NQTKSATLQNN 1421
            L+N MFE ++ LVG+++    N +K  TL  N
Sbjct: 1188 LKNTMFEKSDALVGVFRQQQENSSKIVTLDLN 1219

 Score = 55.1 bits (131), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 62/122 (50%), Gaps = 8/122 (6%)

Query: 700 DRYDIAISTACPR-LNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTP 758
           D+Y +A+ST   +  + ++V+++   Q+CI +L+K + G   FI L+ +   D      P
Sbjct: 540 DKYKLAVSTVLGKNFDSVIVDSLSVAQECISFLKKQRAGVISFIPLDTI---DAATPRMP 596

Query: 759 NNVPRLFDLVISS---DPKFLPAFYSVLRDTLVVNNLKDANRVAYG-NKRFRVVTLSGEL 814
                 + L I++       + A Y V  DT++ +NL  A  + +  N   ++VTL G L
Sbjct: 597 VPESETYTLAINTVEYKDDLVRAMYYVCSDTIICDNLDIARDLKWNKNANVKIVTLDGAL 656

Query: 815 ID 816
           I+
Sbjct: 657 IN 658

>TDEL0C00960 Chr3 (153572..157240) [3669 bp, 1222 aa] {ON} Anc_8.68
            YFL008W
          Length = 1222

 Score =  130 bits (326), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 68/175 (38%), Positives = 110/175 (62%), Gaps = 13/175 (7%)

Query: 1256 DEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMIT---------MGGNAELELVD 1306
            DE++ + + + K+K+ R   F + F  ++  +  +Y+ +T          GG+A L L D
Sbjct: 1042 DEKKVLAQFI-KIKRKRKSLFEEAFEYVTEHIDPIYRELTKNPNSTSELAGGSASLTLED 1100

Query: 1307 SLDPFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1366
              +PF+ G+ +   PP K ++++  LSGGEKT+++LAL+F ++ Y+P+P +V+DE+DAAL
Sbjct: 1101 EDEPFNAGIRYHATPPLKRFKDMEYLSGGEKTVAALALLFTVNSYQPSPFFVLDEVDAAL 1160

Query: 1367 DFRNVSIVANYIKER-TKNAQFIVISLRNNMFELAEQLVGIYKSN--NQTKSATL 1418
            D  NV  VA YI+     + QFIVISL+N MFE ++ LVG+Y+    N +K  TL
Sbjct: 1161 DTTNVERVATYIRRHGNPDLQFIVISLKNTMFEKSDALVGVYRQQELNTSKIVTL 1215

 Score = 96.3 bits (238), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 54/158 (34%), Positives = 84/158 (53%), Gaps = 16/158 (10%)

Query: 159 LVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLI 218
           L LH+FKSY GT  VG   S+F++++GPNGSGKSN++D++ FV G R+  +R + L DLI
Sbjct: 7   LELHNFKSYKGTVKVGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSRHLRSNVLKDLI 66

Query: 219 HK-------SENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYY 271
           ++        +   D+ +     + +    K D T         + ++R   K   + Y 
Sbjct: 67  YRGVASEEEGDGESDVVNNPTTAYVKAFYSKGDST---------IELSRSISKGGDTTYR 117

Query: 272 INGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIA 309
           +NGK  +Y      L+DE I +    FL+ QG+V  IA
Sbjct: 118 MNGKVVDYKRYASFLEDENILIRAKNFLVFQGDVVQIA 155

>ZYRO0F03828g Chr6 (318190..321843) [3654 bp, 1217 aa] {ON} similar to
            uniprot|P32908 Saccharomyces cerevisiae YFL008W SMC1
            Subunit of the multiprotein cohesin complex essential
            protein involved in chromosome segregation and in
            double-strand DNA break repair SMC chromosomal ATPase
            family member binds DNA with a preference for DNA with
            secondary structure
          Length = 1217

 Score =  129 bits (323), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 66/164 (40%), Positives = 103/164 (62%), Gaps = 12/164 (7%)

Query: 1267 KLKKTRFEEFMQGFGVISITLKEMYQMIT---------MGGNAELELVDSLDPFSEGVTF 1317
            K+KK R   F + F   S  +  +Y+ +T          GG+A L L D  +PF+ G+ +
Sbjct: 1047 KIKKKRKALFERAFEYASEHIDPIYRELTKNPGSTNELAGGSASLTLEDEDEPFNAGIRY 1106

Query: 1318 SVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANY 1377
               PP K ++++  LSGGEKT+++LAL+F ++ ++P+P +V+DE+DAALD  NV  +A Y
Sbjct: 1107 HATPPFKRFKDMEYLSGGEKTVAALALLFTINSFQPSPFFVLDEVDAALDSTNVDRIAAY 1166

Query: 1378 I-KERTKNAQFIVISLRNNMFELAEQLVGIYKSN--NQTKSATL 1418
            I +   ++ QFIVISL+N MFE ++ LVG+Y+    N +K  TL
Sbjct: 1167 ISRHGNRDLQFIVISLKNTMFEKSDALVGVYRQQQENSSKIVTL 1210

 Score = 90.1 bits (222), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 53/157 (33%), Positives = 86/157 (54%), Gaps = 19/157 (12%)

Query: 159 LVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLI 218
           L L++FKSY GT  VG   S+F +++GPNGSGKSN++D++ FV G ++S +R   L DLI
Sbjct: 7   LELYNFKSYRGTVRVGFGDSNFISIIGPNGSGKSNMMDAISFVLGVKSSHLRSQILKDLI 66

Query: 219 HKS------ENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYI 272
           ++       E   + ++  V+  +     K D T         + ++R   +N  ++Y +
Sbjct: 67  YRGVEGEEDEEDGEGRTAYVKAFYL----KSDST---------VELSRSISRNGDTQYKM 113

Query: 273 NGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIA 309
           NGK   Y    + L++E I +    FL+ QG+V  IA
Sbjct: 114 NGKNCGYKQYAEFLEEENILIKAQNFLVFQGDVVQIA 150

>KAFR0G02930 Chr7 complement(609210..612722) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score =  102 bits (254), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 57/159 (35%), Positives = 90/159 (56%), Gaps = 4/159 (2%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-SKMRQDRL 214
           I++L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + S +R   L
Sbjct: 3   IEELIIDGFKSYAARTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 215 SDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYING 274
            DLI+K      +   SV V F+      D + I  T   K+ +TR+     TSKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTVVFDN--SDRDNSPIGFTNSPKISVTRQVVLGGTSKYLING 119

Query: 275 KESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP 313
             +   SV +L +   +++++  FLI+QG++  +  MKP
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 83.2 bits (204), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 82/138 (59%), Gaps = 1/138 (0%)

Query: 1260 KVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVTFSV 1319
            K++E + KL + + E  ++ +  ++    ++++ +     A+L   +  D  +EG+   V
Sbjct: 1013 KIQETIGKLNEYKRETLIKTWEKVTNDFGKIFEDLLPNSFAKLVPCEGKD-VTEGLEVKV 1071

Query: 1320 MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1379
                    ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK
Sbjct: 1072 RLGTIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIK 1131

Query: 1380 ERTKNAQFIVISLRNNMF 1397
             R K +QFIV+SL+  MF
Sbjct: 1132 TRFKGSQFIVVSLKEGMF 1149

>TDEL0H02610 Chr8 (434116..437628) [3513 bp, 1170 aa] {ON} Anc_7.186
           YFR031C
          Length = 1170

 Score =  100 bits (250), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 58/160 (36%), Positives = 93/160 (58%), Gaps = 4/160 (2%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-SKMRQDRL 214
           I++L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  A + +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISAMTTVRASSL 62

Query: 215 SDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYING 274
            DLI+K      +   SV V F+   DK + + I  T   K+ +TR+     +SKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTVVFDNS-DKSN-SPIGFTNSAKISVTRQVMLGGSSKYLING 119

Query: 275 KESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPK 314
             +   SV +L +   +++++  FLI+QG++  +  MKPK
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPK 159

 Score = 88.2 bits (217), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 51/180 (28%), Positives = 102/180 (56%), Gaps = 5/180 (2%)

Query: 1219 QLQDYIDTVNVNI-DVLEEYARRVAEYKRRKLDLNNAVDEREKVRELLDKLKKTRFEEFM 1277
            Q QD    VN NI  ++E   ++ A  K     ++    ++ K++E + KL + + +  +
Sbjct: 974  QFQDMRRKVNPNIMSMIESVEKKEAALKAM---IDTIEKDKVKIQETIHKLNEYKKDTLI 1030

Query: 1278 QGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNLSGGEK 1337
            + +  +++   +++  +     A+L  ++  +  +EG+ F V        ++  LSGG++
Sbjct: 1031 KTWKKVTVDFGQVFADLLPNSFAKLVPLEGKE-VTEGLEFKVRLGSIWKESLVELSGGQR 1089

Query: 1338 TLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMF 1397
            +L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K +QFIV+SL+  MF
Sbjct: 1090 SLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQFIVVSLKEGMF 1149

>NDAI0G02070 Chr7 (461697..465212) [3516 bp, 1171 aa] {ON} Anc_7.186
           YFR031C
          Length = 1171

 Score =  100 bits (249), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 55/160 (34%), Positives = 91/160 (56%), Gaps = 4/160 (2%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-SKMRQDRL 214
           +++L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGITSMTTVRASNL 62

Query: 215 SDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYING 274
            DLI+K      +   SV + F+   DK +     N    K+ +TR+     TSKY ING
Sbjct: 63  QDLIYKRGQ-AGITKASVTIVFDNT-DKTNSPIGFNN-SAKISVTRQVVLGGTSKYLING 119

Query: 275 KESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPK 314
             +   SV +L +   +++++  FLI+QG++  +  MKPK
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPK 159

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 42/138 (30%), Positives = 80/138 (57%), Gaps = 1/138 (0%)

Query: 1260 KVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVTFSV 1319
            K++E + KL + + E  ++ +  ++     ++  +     A+L   +  D  +EG+   V
Sbjct: 1014 KIQETISKLNEYKREALIKTWEKVTTDFGAIFSDLLPNSFAKLVPSEGKD-VTEGLEVKV 1072

Query: 1320 MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1379
                    ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK
Sbjct: 1073 KLGTIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIK 1132

Query: 1380 ERTKNAQFIVISLRNNMF 1397
             R K +QFIV+SL+  MF
Sbjct: 1133 TRFKGSQFIVVSLKEGMF 1150

>ZYRO0D15642g Chr4 complement(1307703..1311215) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 99.8 bits (247), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 57/159 (35%), Positives = 89/159 (55%), Gaps = 4/159 (2%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-SKMRQDRL 214
           I++L++  FKSYA   V+  +   F+A+ G NGSGKSNV+D++ FV G  + S +R   L
Sbjct: 3   IEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNVLDAICFVLGIASMSTVRASSL 62

Query: 215 SDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYING 274
            DLI+K      +   SV + F  +   P  + I      KL +TR+     TSKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFSNL--DPKCSPIGFENSPKLSVTRQIILGGTSKYLING 119

Query: 275 KESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP 313
             +   SV +L +   +++++  FLI+QG++  +  MKP
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 83.6 bits (205), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 83/141 (58%), Gaps = 1/141 (0%)

Query: 1257 EREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVT 1316
            ++EK++E + KL + + E  +  +  +++   E+   +     A+L   +  +  +EG+ 
Sbjct: 1010 DKEKIQETIFKLNEYKKETLVNTWKKVTVDFGEVVADLLPNAFAKLVPCEGKE-VTEGLE 1068

Query: 1317 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1376
              V        ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + +
Sbjct: 1069 VKVKLGGIWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGH 1128

Query: 1377 YIKERTKNAQFIVISLRNNMF 1397
             IK R K +QFIV+SL+  MF
Sbjct: 1129 LIKTRFKGSQFIVVSLKEGMF 1149

>AGR236W Chr7 (1189845..1193357) [3513 bp, 1170 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFR031C (SMC2)
          Length = 1170

 Score = 99.0 bits (245), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 89/159 (55%), Gaps = 4/159 (2%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-SKMRQDRL 214
           +++L++  FKSYA   V+  +   F+A+ G NGSGKSN++DS+ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISGWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 215 SDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYING 274
            DLI+K      +K+ SV + F+     P  +        K+ +TR+     TSKY ING
Sbjct: 63  QDLIYKRGQAGVIKA-SVTIVFDN--SDPSSSPFGFETYPKISVTRQIILGGTSKYLING 119

Query: 275 KESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP 313
             +   +V  L +   +++++  FLI+QG++  +  MKP
Sbjct: 120 HRAQQLTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 68.9 bits (167), Expect = 9e-11,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 81/138 (58%), Gaps = 1/138 (0%)

Query: 1260 KVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVTFSV 1319
            K+ E ++KL + + +  ++ +  +++    ++  +     A+L  ++  D  + G+   V
Sbjct: 1013 KIVETIEKLNEYKRDALVKTWEKVNVDFGNIFAELLPNSFAKLAAIEGKD-VTAGLEVKV 1071

Query: 1320 MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1379
                    ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + + IK
Sbjct: 1072 KLGTLWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGHLIK 1131

Query: 1380 ERTKNAQFIVISLRNNMF 1397
             R K +QFIV+SL+  MF
Sbjct: 1132 TRFKGSQFIVVSLKEGMF 1149

>CAGL0D05258g Chr4 (500858..504370) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031c SMC2
           chromosome segregation protein
          Length = 1170

 Score = 98.2 bits (243), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 56/159 (35%), Positives = 92/159 (57%), Gaps = 4/159 (2%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-SKMRQDRL 214
           +++L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 215 SDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYING 274
            DLI+K      +   SV + F+   DK + T I  +   K+ +TR+     TSKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNT-DKSN-TPIGFSEYPKISVTRQIVLGGTSKYLING 119

Query: 275 KESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP 313
             +   SV +L +   +++++  FLI+QG++  I  MKP
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKILNMKP 158

>NCAS0E01920 Chr5 (368382..371894) [3513 bp, 1170 aa] {ON} Anc_7.186
          Length = 1170

 Score = 97.4 bits (241), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 54/159 (33%), Positives = 90/159 (56%), Gaps = 4/159 (2%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-SKMRQDRL 214
           +++L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVIADWDPQFNAITGLNGSGKSNILDAICFVLGISSMTIVRASNL 62

Query: 215 SDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYING 274
            DLI+K      +   SV + F+   DK +     N    K+ +TR+     TSKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNS-DKTNSPIGFNN-SSKISVTRQIILGGTSKYLING 119

Query: 275 KESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP 313
             +   SV +L +   +++++  FLI+QG++  +  MKP
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1326 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1384
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLVELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1385 AQFIVISLRNNMF 1397
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>YFR031C Chr6 complement(216594..220106) [3513 bp, 1170 aa] {ON}
           SMC2Subunit of the condensin complex; essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase; Smc2p/Smc4p
           complex binds DNA; required for clustering of tRNA genes
           at the nucleolus
          Length = 1170

 Score = 97.1 bits (240), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 55/159 (34%), Positives = 92/159 (57%), Gaps = 4/159 (2%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-SKMRQDRL 214
           +++L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + S +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 215 SDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYING 274
            DLI+K      +   SV + F+   DK + + I  T   ++ +TR+     TSKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNT-DKSN-SPIGFTNSPQISVTRQVVLGGTSKYLING 119

Query: 275 KESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP 313
             +   SV +L +   +++++  FLI+QG++  +  MKP
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 82.4 bits (202), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 81/138 (58%), Gaps = 1/138 (0%)

Query: 1260 KVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVTFSV 1319
            K++E + KL + + E  ++ +  +++    ++  +     A+L   +  D  ++G+   V
Sbjct: 1013 KIQETISKLNEYKRETLVKTWEKVTLDFGNIFADLLPNSFAKLVPCEGKD-VTQGLEVKV 1071

Query: 1320 MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1379
                    ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK
Sbjct: 1072 KLGNIWKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIK 1131

Query: 1380 ERTKNAQFIVISLRNNMF 1397
             R K +QFIV+SL+  MF
Sbjct: 1132 TRFKGSQFIVVSLKEGMF 1149

>Suva_6.104 Chr6 complement(183396..186908) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 54/159 (33%), Positives = 92/159 (57%), Gaps = 4/159 (2%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-SKMRQDRL 214
           +++L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMTTVRASSL 62

Query: 215 SDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYING 274
            DLI+K      +   SV + F+   DK + + I  T   ++ +TR+     TSKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNT-DKSN-SPIGFTNSPQISVTRQVVLGGTSKYLING 119

Query: 275 KESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP 313
             +   SV +L +   +++++  FLI+QG++  +  MKP
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 83.2 bits (204), Expect = 3e-15,   Method: Compositional matrix adjust.
 Identities = 33/73 (45%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1326 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1384
            W++ +  LSGG+++L +LAL+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALALIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1385 AQFIVISLRNNMF 1397
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>KNAG0L01160 Chr12 complement(206434..209946) [3513 bp, 1170 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1170

 Score = 96.7 bits (239), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 91/159 (57%), Gaps = 4/159 (2%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-SKMRQDRL 214
           +++L++  FKSYA   V+  + + F+A+ G NGSGKSN++D++ FV G  + S +R   +
Sbjct: 3   VEELIIDGFKSYATRTVISGWDAQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNM 62

Query: 215 SDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYING 274
            DLI+K      +   SV + F+   DK +     N    K+ +TR+     TSKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNS-DKSNSPIGFND-SLKISVTRQIVLGGTSKYLING 119

Query: 275 KESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP 313
             +   SV +L +   +++++  FLI+QG++  +  M+P
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMRP 158

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1326 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1384
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1385 AQFIVISLRNNMF 1397
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>Skud_6.119 Chr6 complement(211918..215430) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 96.3 bits (238), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 92/161 (57%), Gaps = 8/161 (4%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-SKMRQDRL 214
           +++L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + S +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 215 SDLIHKSENFPDLKSCSVEVHFEYV--IDKPDGTTIINTVKEKLVITRKAFKNNTSKYYI 272
            DLI+K      +   SV + F     ++ P G T  N+   ++ +TR+     TSKY I
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFNNTDKLNSPIGFT--NS--PQISVTRQVVLGGTSKYLI 117

Query: 273 NGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP 313
           NG  +   SV +L +   +++++  FLI+QG++  +  MKP
Sbjct: 118 NGHRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1326 WRN-ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1384
            W++ +  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKDSLIELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1385 AQFIVISLRNNMF 1397
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>TBLA0D04610 Chr4 complement(1139885..1143409) [3525 bp, 1174 aa]
           {ON} Anc_7.186 YFR031C
          Length = 1174

 Score = 95.1 bits (235), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 53/158 (33%), Positives = 90/158 (56%), Gaps = 4/158 (2%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-SKMRQDRL 214
           +++L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMTTVRASNL 62

Query: 215 SDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYING 274
            DLI+K      +   SV + F+   DK +     NT   ++ +TR+     TSKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNT-DKSNSPIGFNT-SPRISVTRQIVIGGTSKYLING 119

Query: 275 KESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMK 312
             +   SV +L +   +++++  FLI+QG++  +  MK
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMK 157

 Score = 84.0 bits (206), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 80/138 (57%), Gaps = 1/138 (0%)

Query: 1260 KVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVTFSV 1319
            K++E + KL   + E  ++ +  ++     ++  +    +A+L   +  D  +EG+   V
Sbjct: 1017 KIQETISKLNDYKRETLLKTWEKVTKDFGNIFGDLLPNSSAKLVPSEGKD-ITEGLEVKV 1075

Query: 1320 MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1379
                    ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK
Sbjct: 1076 KLGNIWKESLVELSGGQRSLVALSLILALLQFRPAPMYILDEVDAALDLSHTQNIGHLIK 1135

Query: 1380 ERTKNAQFIVISLRNNMF 1397
             R K AQFIV+SL+  MF
Sbjct: 1136 TRFKGAQFIVVSLKEGMF 1153

>Suva_6.52 Chr6 (91156..94950) [3795 bp, 1264 aa] {ON} YFL008W
           (REAL)
          Length = 1264

 Score = 95.5 bits (236), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 60/176 (34%), Positives = 98/176 (55%), Gaps = 12/176 (6%)

Query: 145 SKNEKQIERLCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGF 204
           +KN+  + RL    L L +FKSY G   VG   S+F++++GPNGSGKSN++D++ FV G 
Sbjct: 31  AKNQSTMGRLV--GLELSNFKSYRGITKVGFGESNFTSIIGPNGSGKSNMMDAISFVLGV 88

Query: 205 RASKMRQDRLSDLIHKS----ENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKE--KLV- 257
           R++ +R + L DLI++      N  ++ S + +     +   P+   +    ++  KLV 
Sbjct: 89  RSNHLRSNILKDLIYRGVLDDGNDENIDSGADD---NAITSNPNSAYVKAFYQKGNKLVE 145

Query: 258 ITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP 313
           +TR   +N  + Y I+GK   Y   +  L++E I +    FL+ QG+VE IA   P
Sbjct: 146 LTRLISRNGDTTYKIDGKTVTYKDYSIFLENENILIKAKNFLVFQGDVEQIAAQSP 201

>Smik_7.346 Chr7 complement(577634..581146) [3513 bp, 1170 aa] {ON}
           YFR031C (REAL)
          Length = 1170

 Score = 95.1 bits (235), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 88/159 (55%), Gaps = 4/159 (2%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-SKMRQDRL 214
           +++L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + S +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGIASMSTVRASSL 62

Query: 215 SDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYING 274
            DLI+K      +   SV + F+            N+   ++ +TR+     TSKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNTDKSNSPIGFANS--PQISVTRQVVLGGTSKYLING 119

Query: 275 KESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP 313
             +   SV +L +   +++++  FLI+QG++  +  MKP
Sbjct: 120 HRAPQQSVLQLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 81.6 bits (200), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 59/191 (30%), Positives = 105/191 (54%), Gaps = 22/191 (11%)

Query: 1229 VNIDVLEEYARRVAEY---KRRKLDLN--NAVDEREKVRELLDKLKKTRFEEFMQGFGVI 1283
            +N+D   E +R++ E     R+K++ N  N ++  EK    L  + KT  ++ M+    I
Sbjct: 959  INLDTYRERSRQLNEKFQELRKKVNPNIMNMIENVEKKEAALKTMIKTIEKDKMKIQETI 1018

Query: 1284 SI-------TLKEMYQMITMG-GNAELELVDS----LDPF-----SEGVTFSVMPPKKSW 1326
            S        TL + ++ +T+  GN   +L+ +    L PF     ++G+   V       
Sbjct: 1019 SKLNEYKRETLVKTWEKVTLDFGNIFADLLPNSFAKLVPFKDKDVTQGLEVKVKLGSIWK 1078

Query: 1327 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQ 1386
             ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K +Q
Sbjct: 1079 ESLIELSGGQRSLVALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKGSQ 1138

Query: 1387 FIVISLRNNMF 1397
            FIV+SL+  MF
Sbjct: 1139 FIVVSLKEGMF 1149

>Ecym_4390 Chr4 (816076..819588) [3513 bp, 1170 aa] {ON} similar to
           Ashbya gossypii AGR236W
          Length = 1170

 Score = 95.1 bits (235), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 55/161 (34%), Positives = 90/161 (55%), Gaps = 8/161 (4%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-SKMRQDRL 214
           +++L++  FKSYA   V+  +   F+A+ G NGSGKSN++DS+ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDSICFVLGISSMATVRAQNL 62

Query: 215 SDLIHKSENFPDLKSCSVEVHFEYVIDKPD--GTTIINTVKEKLVITRKAFKNNTSKYYI 272
            DLI+K      +K+ SV + F    D  D   + I      K+ +TR+     TSKY I
Sbjct: 63  QDLIYKRGQAGVIKA-SVTIVF----DNSDIKSSPIGFERYPKISVTRQIALGGTSKYLI 117

Query: 273 NGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP 313
           NG  +   +V  L +   +++++  FLI+QG++  +  MKP
Sbjct: 118 NGHRAQQQTVLHLFQSVQLNINNPNFLIMQGQITKVLNMKP 158

 Score = 70.1 bits (170), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 56/203 (27%), Positives = 108/203 (53%), Gaps = 11/203 (5%)

Query: 1200 ISEDEFKNVDVEELEAQKLQLQDYIDT----VNVNI-DVLEEYARRVAEYKRRKLDLNNA 1254
            ISEDE   +D+ E   +   LQ+        VN NI  ++E   ++ +  K   + +   
Sbjct: 953  ISEDE--GIDLNEYRQRATCLQEKFQGMKRKVNPNIMSMIESVEKKESALKAMIITIEK- 1009

Query: 1255 VDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEG 1314
              ++ K+ E + KL + + +  ++ +  +++    ++  +     A+L  ++  D  + G
Sbjct: 1010 --DKTKIMETIKKLNEYKLDALLKTWEKVNVDFGNIFAELLPNSFAKLTHLEDRD-ITAG 1066

Query: 1315 VTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1374
            +   V        ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   +
Sbjct: 1067 LEVKVKLGSIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLNHTQNI 1126

Query: 1375 ANYIKERTKNAQFIVISLRNNMF 1397
             + IK R K +QFIV+SL+  MF
Sbjct: 1127 GHLIKTRFKGSQFIVVSLKEGMF 1149

>SAKL0F07282g Chr6 complement(554459..557971) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 94.7 bits (234), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 87/159 (54%), Gaps = 4/159 (2%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRAS-KMRQDRL 214
           +++L++  FKSYA   V+  +   F+A+ G NGSGKSN++DS+ FV G  +   +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDSICFVLGISSMVTVRASNL 62

Query: 215 SDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYING 274
            DLI+K      +   SV + F+   DK        +   K+ +TR+     TSKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNT-DKSSSPIGFESYP-KISVTRQIILGGTSKYLING 119

Query: 275 KESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP 313
             +   +V  L +   +++++  FLI+QG++  +  MKP
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 71.6 bits (174), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 43/141 (30%), Positives = 84/141 (59%), Gaps = 1/141 (0%)

Query: 1257 EREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVT 1316
            ++ K++E ++KL + + +  ++ +  +S+    ++  +     A+L   +  D  +EG+ 
Sbjct: 1010 DKTKIQETIEKLNEYKRDTLLKTWEKVSVDFGNIFGDLLPNSFAKLVPCEGKD-VTEGLE 1068

Query: 1317 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1376
              V        ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + +
Sbjct: 1069 VKVKLGSIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGH 1128

Query: 1377 YIKERTKNAQFIVISLRNNMF 1397
             IK R K +QFIV+SL+  MF
Sbjct: 1129 LIKTRFKGSQFIVVSLKEGMF 1149

>KLTH0E04774g Chr5 (426535..430047) [3513 bp, 1170 aa] {ON} similar
           to uniprot|P38989 Saccharomyces cerevisiae YFR031C SMC2
           Component of the condensin complex essential SMC
           chromosomal ATPase family member that forms a complex
           with Smc4p to form the active ATPase Smc2p/Smc4p complex
           binds DNA possibly in the cleft formed by the
           coiled-coil of the folded dimer
          Length = 1170

 Score = 94.4 bits (233), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 87/159 (54%), Gaps = 4/159 (2%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-SKMRQDRL 214
           +++L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 215 SDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYING 274
            DLI+K      +   SV + F    D    + I      K+ +TR+     TSKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFTN--DDKANSPIGFESYPKISVTRQIVLGGTSKYLING 119

Query: 275 KESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP 313
             +   +V  L +   +++++  FLI+QG++  +  MKP
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 70.5 bits (171), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 85/141 (60%), Gaps = 1/141 (0%)

Query: 1257 EREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVT 1316
            ++ K+++ + KL + + E  ++ +  +++   +++  +     A+L  ++  D  +EG+ 
Sbjct: 1010 DKTKIQDTIAKLNEYKRETLIKTWEKVTVDFGQVFSELLPNSFAKLVPLEGKD-VTEGLE 1068

Query: 1317 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1376
              +        ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + +
Sbjct: 1069 VKIQLGNIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGH 1128

Query: 1377 YIKERTKNAQFIVISLRNNMF 1397
             IK R K +QFIV+SL+  MF
Sbjct: 1129 LIKTRFKGSQFIVVSLKEGMF 1149

>Kwal_55.20421 s55 (391382..394894) [3513 bp, 1170 aa] {ON} YFR031C
           (SMC2) - SMC chromosomal ATPase family member [contig
           149] FULL
          Length = 1170

 Score = 94.0 bits (232), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 53/159 (33%), Positives = 88/159 (55%), Gaps = 4/159 (2%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-SKMRQDRL 214
           +++L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + S +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISNWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 215 SDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYING 274
            DLI+K      +   SV + F    DK +      +   K+ +TR+     TSKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFANS-DKNNSPIGFESYP-KISVTRQIVLGGTSKYLING 119

Query: 275 KESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP 313
             +   +V  L +   +++++  FLI+QG++  +  MKP
Sbjct: 120 HRAQQQTVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 69.3 bits (168), Expect = 6e-11,   Method: Compositional matrix adjust.
 Identities = 41/141 (29%), Positives = 83/141 (58%), Gaps = 1/141 (0%)

Query: 1257 EREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVT 1316
            ++ K++E + KL + + E  ++ +  +++    ++  +     A+L  ++     +EG+ 
Sbjct: 1010 DKRKIQETVAKLNEYKRETLIKTWEKVTVDFGNIFGDLLPNSFAKLVPIEG-KSVTEGLE 1068

Query: 1317 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1376
              +        ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + +
Sbjct: 1069 VKIRLGSIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGH 1128

Query: 1377 YIKERTKNAQFIVISLRNNMF 1397
             IK R K +QFIV+SL+  MF
Sbjct: 1129 LIKTRFKGSQFIVVSLKEGMF 1149

>Kpol_1063.20 s1063 (46233..49748) [3516 bp, 1171 aa] {ON}
           (46233..49748) [3516 nt, 1172 aa]
          Length = 1171

 Score = 93.2 bits (230), Expect = 3e-18,   Method: Compositional matrix adjust.
 Identities = 52/159 (32%), Positives = 88/159 (55%), Gaps = 4/159 (2%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-SKMRQDRL 214
           +++L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVISDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRASNL 62

Query: 215 SDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYING 274
            DLI+K      +   SV + F+   DK +      +    + +TR+     TSKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNS-DKSNAPIGFES-SPTISVTRQVALGGTSKYLING 119

Query: 275 KESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP 313
             +   SV  L +   +++++  FLI+QG++  +  MKP
Sbjct: 120 HRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 82.0 bits (201), Expect = 7e-15,   Method: Compositional matrix adjust.
 Identities = 32/73 (43%), Positives = 54/73 (73%), Gaps = 1/73 (1%)

Query: 1326 WR-NITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN 1384
            W+ ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK R K 
Sbjct: 1077 WKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIKTRFKG 1136

Query: 1385 AQFIVISLRNNMF 1397
            +QFIV+SL+  MF
Sbjct: 1137 SQFIVVSLKEGMF 1149

>KLTH0H09966g Chr8 complement(859362..863036) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1224

 Score = 92.8 bits (229), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 69/254 (27%), Positives = 122/254 (48%), Gaps = 36/254 (14%)

Query: 1203 DEFKNVDVEELEAQKLQLQDYID-TVNVNIDVLEEYARRVAEYKRRKLDLNNAVDE---- 1257
            D  +N+D EE+  +  ++ D I  T NVN   +E + +    +  ++ +L N  +E    
Sbjct: 963  DRHQNLDSEEVLRRLNEVNDKISKTSNVNRRAIENFRK----FNEKREELENRAEELARS 1018

Query: 1258 REKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELV------------ 1305
            +E + EL+D LKK + E     F  ++     +++ +   G  +L +             
Sbjct: 1019 KESIEELVDSLKKQKIEAVEATFSKVANNFTHIFEKLVPAGVGKLVIHRNESTRNASGGR 1078

Query: 1306 -------------DSLDPFSEGVTFSVMPPKKSWRN--ITNLSGGEKTLSSLALVFALHK 1350
                         DS++    GV+ SV    K+     +  LSGG+KT+ ++AL+ A+  
Sbjct: 1079 GPQQGSGASGNEDDSIETMYSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQM 1138

Query: 1351 YKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSN 1410
              P P Y+ DEIDAALD +  + VAN IKE + +AQFI  + R++M ++A+    +   N
Sbjct: 1139 VDPAPFYLFDEIDAALDKQYRTSVANVIKELSVHAQFICTTFRSDMLQVADSFYRVRFDN 1198

Query: 1411 NQTKSATLQNNDII 1424
              ++ + +   D I
Sbjct: 1199 KISEISAVSQQDAI 1212

 Score = 64.7 bits (156), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 74/165 (44%), Gaps = 10/165 (6%)

Query: 154 LCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDR 213
           + I  +V+  FK+Y  T  V      F+ ++G NGSGKSN   ++ FV     S ++++ 
Sbjct: 1   MYIKSVVIQGFKTYKNTTSVEGLSPRFNVIIGGNGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINT----VKEKLVITRKAFKNNTSK 269
              LIH+           +  + E +   P G  +I +     +E +V  R+       +
Sbjct: 61  RQGLIHQG------TGSVMSAYVEIIFHDPSGQMMITSGIPMTEEHIVRVRRTIGLKKDE 114

Query: 270 YYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPK 314
           Y +NGK  + + ++++ +  G    +   ++ QG +  +   K +
Sbjct: 115 YSVNGKTCHKSDISRMFESVGFSAVNPYNIVPQGRIVAVTNAKDR 159

>TPHA0C04440 Chr3 complement(958279..961791) [3513 bp, 1170 aa] {ON}
           Anc_7.186 YFR031C
          Length = 1170

 Score = 92.4 bits (228), Expect = 5e-18,   Method: Compositional matrix adjust.
 Identities = 56/162 (34%), Positives = 88/162 (54%), Gaps = 10/162 (6%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-SKMRQDRL 214
           + +L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + S +R   L
Sbjct: 3   VAELIIDGFKSYATRTVISEWDPQFNAITGLNGSGKSNILDAICFVLGISSMSTVRASNL 62

Query: 215 SDLIHKSENFPDLKSCSVEVHFEYVIDK---PDGTTIINTVKEKLVITRKAFKNNTSKYY 271
            DLI+K      +   SV + F+   DK   P G     T+     +TR+     TSKY 
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFDNS-DKSKAPIGFETSLTIS----VTRQIVLGGTSKYL 116

Query: 272 INGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP 313
           ING  +   SV  L +   +++++  FLI+QG++  +  MKP
Sbjct: 117 INGHRAPQQSVLHLFQSVQLNINNPNFLIMQGKITKVLNMKP 158

 Score = 82.8 bits (203), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 82/138 (59%), Gaps = 1/138 (0%)

Query: 1260 KVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVTFSV 1319
            K+++ + KL + + +  ++ +  +++    ++  +     A+L   +  D  +EG+   +
Sbjct: 1013 KIQDTITKLNEYKRDTLIKTWKKVTVDFGNIFADLLPNSFAKLVPSEGKD-ITEGLEVKI 1071

Query: 1320 MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIK 1379
               K    ++  LSGG+++L +L+L+ AL +++P P+Y++DE+DAALD  +   + + IK
Sbjct: 1072 KLGKLWKESLVELSGGQRSLIALSLIMALLQFRPAPMYILDEVDAALDLSHTQNIGHLIK 1131

Query: 1380 ERTKNAQFIVISLRNNMF 1397
             R K +QFIV+SL+  MF
Sbjct: 1132 TRFKGSQFIVVSLKEGMF 1149

>KLLA0D16005g Chr4 complement(1346492..1350004) [3513 bp, 1170 aa]
           {ON} similar to uniprot|P38989 Saccharomyces cerevisiae
           YFR031C SMC2 Component of the condensin complex
           essential SMC chromosomal ATPase family member that
           forms a complex with Smc4p to form the active ATPase
           Smc2p/Smc4p complex binds DNA possibly in the cleft
           formed by the coiled-coil of the folded dimer
          Length = 1170

 Score = 91.7 bits (226), Expect = 8e-18,   Method: Compositional matrix adjust.
 Identities = 51/160 (31%), Positives = 87/160 (54%), Gaps = 4/160 (2%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRA-SKMRQDRL 214
           +++L++  FKSYA   V+  +   F+A+ G NGSGKSN++D++ FV G  + + +R   L
Sbjct: 3   VEELIIDGFKSYATRTVITDWDPQFNAITGLNGSGKSNILDAICFVLGISSMATVRAQNL 62

Query: 215 SDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYING 274
            DLI+K      +   SV + F         + I      K+ ITR+      SKY ING
Sbjct: 63  QDLIYKRGQ-AGVTKASVTIVFNN--SDTSNSPIGFESHAKISITRQIILGGVSKYLING 119

Query: 275 KESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPK 314
             +   +V +L +   +++++  FLI+QG++  +  MKP+
Sbjct: 120 HRAQQQTVLQLFQSVQLNINNPNFLIMQGKITKVLNMKPQ 159

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 46/141 (32%), Positives = 87/141 (61%), Gaps = 1/141 (0%)

Query: 1257 EREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVT 1316
            +++K++E ++KL + + E  ++ +  +S+    ++  +     A+LE  +  D  +EG+ 
Sbjct: 1010 DKQKIQETIEKLNEYKRETLIKTWEKVSVDFGNIFGDLLPNSFAKLEPSEGKD-VTEGLE 1068

Query: 1317 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1376
              V   K    ++  LSGG+++L +L+L+ AL ++KP P+Y++DE+DAALD  +   + +
Sbjct: 1069 VKVKLGKIWKESLVELSGGQRSLIALSLILALLQFKPAPMYILDEVDAALDLSHTQNIGH 1128

Query: 1377 YIKERTKNAQFIVISLRNNMF 1397
             IK R K +QFIV+SL+  MF
Sbjct: 1129 LIKTRFKGSQFIVVSLKEGMF 1149

>Kwal_14.2435 s14 complement(756213..759956) [3744 bp, 1247 aa] {ON}
            YJL074C (SMC3) - SMC chromosomal ATPase family member
            [contig 224] FULL
          Length = 1247

 Score = 89.7 bits (221), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 64/235 (27%), Positives = 110/235 (46%), Gaps = 34/235 (14%)

Query: 1224 IDTVNVNIDVLEEYARRVAE----YKRRKLDLNNAVDE----REKVRELLDKLKKTRFEE 1275
            ++TVN  I  +    RR  E    +  ++ DL +  +E    +E + +L++ LKK + E 
Sbjct: 1001 LNTVNDKISKMSNINRRAIENFKKFNDKREDLESRAEELEQSKESIEKLVESLKKQKVEA 1060

Query: 1276 FMQGFGVISITLKEMYQMITMGGNAELEL------------------------VDSLDPF 1311
                F  ++     +++ +   G   L +                         D+LD  
Sbjct: 1061 VEATFSKVATNFTTIFEKLVPAGIGRLIIHRTTEKSNRGTGQRSPEYSPLNSNADTLDSM 1120

Query: 1312 SEGVTFSVMPPKKSWRN--ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1369
              GV+ SV    K+     +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +
Sbjct: 1121 YSGVSISVSFNSKNNEQLYVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQ 1180

Query: 1370 NVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDII 1424
              + VAN IKE + +AQFI  + R +M ++A+    +   N  ++ AT+   + I
Sbjct: 1181 YRTSVANTIKELSAHAQFICTTFRTDMLQVADSFYRVKFENKISEIATVSKQEAI 1235

 Score = 71.2 bits (173), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 42/166 (25%), Positives = 79/166 (47%), Gaps = 2/166 (1%)

Query: 149 KQIERLCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASK 208
           ++I  + I  +++  FK+Y     V  F   F+ V+G NGSGKSN   ++ FV     S 
Sbjct: 20  REIVEMYIQSVLIQGFKTYRNITAVEDFSPHFNVVIGGNGSGKSNFFAAVRFVLSDDYSS 79

Query: 209 MRQDRLSDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTS 268
           ++++    LIH+      + S  VE+ F    D+   T+ I   +E +V  R+       
Sbjct: 80  LKREERQGLIHQGTG--SIMSAYVEIVFHDPSDQMMMTSGIPVTEEHIVRVRRTIGLKKD 137

Query: 269 KYYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPK 314
           +Y +NGK  + + ++++ +  G    +   ++ QG +  +   K K
Sbjct: 138 EYSVNGKTCHKSDISRMFESVGFSASNPYNIVPQGRIVAVTNAKDK 183

>AGL023W Chr7 (670877..674545) [3669 bp, 1222 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YFL008W (SMC1)
          Length = 1222

 Score = 89.4 bits (220), Expect = 5e-17,   Method: Compositional matrix adjust.
 Identities = 57/160 (35%), Positives = 80/160 (50%), Gaps = 19/160 (11%)

Query: 159 LVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLI 218
           L + +FKSY G   VG    +F ++VGPNGSGKSN++D++ FV G R+S +R   L DLI
Sbjct: 7   LEVKNFKSYKGVHNVGFGGKNFISIVGPNGSGKSNMMDAISFVLGIRSSHLRSSALVDLI 66

Query: 219 HKS---------ENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSK 269
           ++          EN P  KS  V     YV     G       + ++  TR       S 
Sbjct: 67  YRGRMEEGGSAHENNP--KSAYVTAF--YVKQDASG------AERRMEFTRVIHNTGDST 116

Query: 270 YYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIA 309
           Y ++GK   Y     +L+ E I +    FL+ QG+VE IA
Sbjct: 117 YKLDGKTVGYKEYVDVLEGERILVKARNFLVFQGDVEQIA 156

>KAFR0A01610 Chr1 complement(326620..330303) [3684 bp, 1227 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1227

 Score = 87.8 bits (216), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 64/227 (28%), Positives = 114/227 (50%), Gaps = 34/227 (14%)

Query: 1227 VNVNIDVLEEYARRVAEY------KRRKLDLNNAVDEREKVRELLDKLKKTRFEEFMQGF 1280
            VNVN    E + RR  E       + R+L+L+     +  ++EL++KLK+ +     + F
Sbjct: 996  VNVNKRAFENF-RRFGEKQTELVERSRELELS-----KISIQELIEKLKEQKINAVDKTF 1049

Query: 1281 GVISITLKEMYQMITMGGNAELEL----------------VDSLD----PFSEGVTFSVM 1320
              +S    ++++ +   G  +L +                 + +D    P   GV+ SV 
Sbjct: 1050 RKVSENFVKVFETLVPRGTGKLVIHRTNQENSATPDLEDETNDMDIDAQPMYTGVSISVS 1109

Query: 1321 PPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1378
               K+    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VAN +
Sbjct: 1110 FNSKNDEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVANTL 1169

Query: 1379 KERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDIIN 1425
            KE +KNAQFI  + R +M ++A++   +   N  +    ++ ++ IN
Sbjct: 1170 KELSKNAQFICTTFRTDMLQVADKFFRVKYENKISSVLEIERDEAIN 1216

 Score = 62.8 bits (151), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 39/168 (23%), Positives = 78/168 (46%), Gaps = 11/168 (6%)

Query: 154 LCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDR 213
           + I ++++  FK+Y    ++  F    + ++G NGSGKSN+  ++ FV     S ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHHNIIIGSNGSGKSNLFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHK-SENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKL------VITRKAFKNN 266
              LIH+ +     + SCSVE+ F      PD   I+ +    +      V  R+     
Sbjct: 61  RQGLIHQGTSGGSSVMSCSVEIVFH----DPDNRMILASNASIVPRPNNEVFIRRTVGLK 116

Query: 267 TSKYYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPK 314
              Y IN +    + + ++L+  G  + +   ++ QG++  +   K K
Sbjct: 117 KDDYQINDRNVTKSDIVRILETAGFSMSNPYNIVPQGKIIALTNAKDK 164

>NCAS0C04000 Chr3 (807106..810777) [3672 bp, 1223 aa] {ON} Anc_8.68
           YFL008W
          Length = 1223

 Score = 86.3 bits (212), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 55/163 (33%), Positives = 83/163 (50%), Gaps = 25/163 (15%)

Query: 159 LVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLSDLI 218
           L L +FKSY G   +G   S+F++++GPNGSGKSN++D++ FV G R+S +R + L DLI
Sbjct: 7   LELSNFKSYRGVTKIGFGDSNFTSIIGPNGSGKSNMMDAISFVLGVRSSHLRSNILKDLI 66

Query: 219 HK------SENFPD------LKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNN 266
           ++      SE  P+        S  V+  +E      DG  +         + R    N 
Sbjct: 67  YRGVIRDFSEEDPEDGEEQHPTSAYVKAFYEM-----DGKVV--------ELMRTINING 113

Query: 267 TSKYYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIA 309
            + Y I+ K  +Y      L+ E I +    FL+ QG+VE IA
Sbjct: 114 DTTYKIDNKTVSYKQYAAFLEKENILIKAKNFLVFQGDVEQIA 156

>Kpol_1018.2 s1018 complement(5901..9536) [3636 bp, 1211 aa] {ON}
            complement(5901..9536) [3636 nt, 1212 aa]
          Length = 1211

 Score = 85.1 bits (209), Expect = 9e-16,   Method: Compositional matrix adjust.
 Identities = 58/224 (25%), Positives = 110/224 (49%), Gaps = 22/224 (9%)

Query: 1224 IDTVNVNIDVLEEYARRVAE----YKRRKLDLNNAV----DEREKVRELLDKLKKTRFEE 1275
            +++VN  +  L    +R +E    +  +K++LN       D +  ++ L++KLK+ +   
Sbjct: 977  LNSVNEEMSSLTNVNKRASENFRKFNEKKIELNERAAELDDSKVSIQNLIEKLKQQKVTA 1036

Query: 1276 FMQGFGVISITLKEMYQMITMGGNAELEL------------VDSLDPFSEGVTFSVM--P 1321
                F  +S     +++ +   G A+L +             +S +    G++ SV    
Sbjct: 1037 VDSTFKKVSENFSTVFEKLVPRGTAKLIIHRQEENKTRSKDKNSTESIYSGISISVSFNS 1096

Query: 1322 PKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER 1381
             K    ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VA+ IK  
Sbjct: 1097 KKNEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRAAVADVIKSL 1156

Query: 1382 TKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDIIN 1425
            + NAQFI  + R +M ++A++   +   N  +    ++  + IN
Sbjct: 1157 SGNAQFICTTFRTDMLQVADKFFRVKYENKISTVVEVERQEAIN 1200

 Score = 60.5 bits (145), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 79/164 (48%), Gaps = 8/164 (4%)

Query: 154 LCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDR 213
           + I ++V+  FK+Y    V+  F  +++ V+G NGSGKSN   ++ FV     S ++++ 
Sbjct: 1   MYIHRIVIKGFKTYRNETVIDFFSPNYNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSENFPDLKSCSVEVHFE---YVIDKPDGTTIINTVKEKLVITRKAFKNNTSKY 270
              LIH+      + S SVE+ F    + +  P G  ++    +++ I R+        Y
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFRDPGHRMILPSG--VVPRENDEIFI-RRTVGLKKDDY 115

Query: 271 YINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPK 314
            +N +    + V ++L+  G  + +   ++ QG +  +   K K
Sbjct: 116 QVNDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIIAVTNAKDK 159

>SAKL0D06116g Chr4 complement(503196..506885) [3690 bp, 1229 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
            also required with Rec8p for cohesion and recombination
            during meiosis phylogenetically conserved SMC chromosomal
            ATPase family member
          Length = 1229

 Score = 84.3 bits (207), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 44/114 (38%), Positives = 66/114 (57%), Gaps = 2/114 (1%)

Query: 1314 GVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1371
            GV+ SV     +    ++  LSGG+KT+ ++AL+ A+ K  P P Y+ DEIDAALD +  
Sbjct: 1103 GVSISVSFNSRQDEQLHVEQLSGGQKTVCAIALILAIQKVDPAPFYLFDEIDAALDKQYR 1162

Query: 1372 SIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDIIN 1425
            + VAN IKE + NAQFI  + R++M  +A+    +   N  +  A +   D IN
Sbjct: 1163 TSVANTIKELSANAQFICTTFRSDMLRVADVFYRVKYENKISTVAEVSQRDAIN 1216

 Score = 59.7 bits (143), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 39/157 (24%), Positives = 71/157 (45%), Gaps = 13/157 (8%)

Query: 154 LCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDR 213
           + I ++ +  FK+Y  T ++  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKRVTIQGFKTYKNTTLIDNFSPHHNVVIGSNGSGKSNFFAAIRFVLSDDYNNLKREE 60

Query: 214 LSDLIHKSENFPDLKSCSV-EVHFEYVIDKPDGTTIINTVKEKL----VITRKAFKNNTS 268
              LIH+        S SV   + E V D  DG  ++N          V+ R+       
Sbjct: 61  RQGLIHQG-------SGSVMSAYVEIVFDNSDG-RLLNAAASPSSPDEVVIRRTIGLKKD 112

Query: 269 KYYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEV 305
           +Y +N K  +   +  LL+  G    +  +++ QG +
Sbjct: 113 EYSLNSKSCSKIEIKNLLESAGFSTANPYYIVPQGRI 149

>ZYRO0G21296g Chr7 (1747217..1750900) [3684 bp, 1227 aa] {ON} similar
            to uniprot|P47037 Saccharomyces cerevisiae YJL074C SMC3
            Subunit of the multiprotein cohesin complex required for
            sister chromatid cohesion in mitotic cells also required
            with Rec8p for cohesion and recombination during meiosis
            phylogenetically conserved SMC chromosomal ATPase family
            member
          Length = 1227

 Score = 84.3 bits (207), Expect = 2e-15,   Method: Compositional matrix adjust.
 Identities = 41/106 (38%), Positives = 67/106 (63%), Gaps = 2/106 (1%)

Query: 1307 SLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDA 1364
            S++    GV+ SV     K   +++  LSGG+KT+ ++AL+ A+   +P P Y+ DEIDA
Sbjct: 1096 SVEAMYSGVSISVSFNSKKNEQQHVEQLSGGQKTVCAVALILAIQMVEPAPFYLFDEIDA 1155

Query: 1365 ALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSN 1410
            ALD +  + VA+ IKE ++NAQFI  + R++M E+A++   +   N
Sbjct: 1156 ALDKQYRTAVASTIKELSENAQFICTTFRSDMLEVADKFYRVKYEN 1201

 Score = 57.8 bits (138), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/164 (23%), Positives = 74/164 (45%), Gaps = 8/164 (4%)

Query: 154 LCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDR 213
           + I ++V+  FK+Y    ++  F    + V+G NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIRRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSNDYANLKREE 60

Query: 214 LSDLIHKSENFPDLKSCSVEVHFE---YVIDKPDGTTIINTVKEKLVITRKAFKNNTSKY 270
              LIH+      + S SVE+ F    + I  P G   I   +   V  R+        Y
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFHDPSHRIILPSG---IPPRENDEVFVRRTVGLKKDDY 115

Query: 271 YINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPK 314
            +N +    + V ++L+  G  + +   ++ QG +  +   K +
Sbjct: 116 QLNDRNVTKSDVVRMLESAGFSMSNPYNIVPQGRIVALTNAKDR 159

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 71/299 (23%), Positives = 127/299 (42%), Gaps = 40/299 (13%)

Query: 550 EISQHEKELEPWNLQLQGKKSQIQVKESEISLIKEGRVKLENDIENLNSLXXXXXXXXXX 609
           E+ + E++L    L  +GK +  + KE   S +++    L N ++NL  +          
Sbjct: 374 ELRERERDL----LLKKGKYADFRTKEERDSWVEQEIKDLRNKLDNLKEVKQNVELERSE 429

Query: 610 XXXXXXXLRNELNRIT---------KEVSIGDTEYTNAK----EKLREMKAVL-NQHRQK 655
                  +  +++ +T          E++  DTE  N K    +K+ E K +   + R +
Sbjct: 430 IRNKLAAIDEQIDELTDSIQGPGALAELNDLDTELNNTKHLYGQKIDERKELWRTEQRLQ 489

Query: 656 AIDARTSLSAEENKNQVLASLFRLQKSGRIS-------------GFYGRLGDLGAIDDRY 702
           ++   T+   + ++ +V  ++ R   +G  S               +G LG+L  ++D+Y
Sbjct: 490 SLLEATTNDVKRSEGEVTETMSRDLANGIKSVKEIAEKLKLPDGCVFGTLGELIKVNDKY 549

Query: 703 -DIAISTACPRLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKLRNFDMNKISTPNNV 761
              A       L  +VV+T E     I+ L + K G   F+ L ++ + D N    PN  
Sbjct: 550 KKCAEVVGGNSLFHIVVDTDETASLIIQELYRMKGGRVTFLPLNRVYS-DPNITYPPNEQ 608

Query: 762 PRLFDLV--ISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRFRV--VTLSGELID 816
                L+  I  D +F  A   V   T+VV +L    R+A   KRFR+  +TL G+  D
Sbjct: 609 ASCTPLIKKIRYDARFEKAVKQVFGKTIVVRDLSTGARLA---KRFRLNAITLDGDRAD 664

>AAL182W Chr1 (16155..19850) [3696 bp, 1231 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YJL074C (SMC3)
          Length = 1231

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 67/262 (25%), Positives = 119/262 (45%), Gaps = 46/262 (17%)

Query: 1197 IPRISEDEFKNVDVEELEAQKLQLQDYIDTV-NVNIDVLEEYAR---RVAEYKRRKLDLN 1252
            +P  S D++ N+   EL  +   + D I  + NVN   LE + +   +  +  +R  +L+
Sbjct: 954  LPDDSADKYHNMSSSELLKELSSINDKISKMTNVNKRALENFKKFDDKQKDVMKRAKELD 1013

Query: 1253 NAVDEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELV------- 1305
             +   +E + +L+DKLKK + E     F  +S    ++++ +   G  +L +        
Sbjct: 1014 ES---KESIEKLIDKLKKQKVEAVENTFKKVSENFTQLFEKMVPRGTGKLVIHRRENEPS 1070

Query: 1306 ---------------------------DSLDPFSEGVTFSVM--PPKKSWRNITNLSGGE 1336
                                        S D    GV+  V     K    ++  LSGG+
Sbjct: 1071 KPSKRQQKKRKRQETEDVHFNDDQDENSSQDSIYSGVSIEVSFNSKKDEQVHVEQLSGGQ 1130

Query: 1337 KTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNM 1396
            KT+ ++AL+ A+    P P Y+ DEIDAALD +  + VA  +K+ +  AQFI  + R +M
Sbjct: 1131 KTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATVKQLSSQAQFICTTFRGDM 1190

Query: 1397 FELAEQLVGIYKSNNQTKSATL 1418
              +A++    Y+ N + K +T+
Sbjct: 1191 IAVADRF---YRVNFENKISTV 1209

 Score = 55.8 bits (133), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/152 (23%), Positives = 69/152 (45%), Gaps = 6/152 (3%)

Query: 154 LCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDR 213
           + I K+++  FK+Y     +  F    + VVG NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIKKVIIRGFKTYKNKTEIDNFSPHHNVVVGFNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 214 LSDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYIN 273
              LI++        S  +  + E V    +  T++      ++  R+       +Y IN
Sbjct: 61  RRSLIYQG------TSSVMSGYVEIVFHGAENRTLLGAQDGGVIHIRRTVGLKKDEYMIN 114

Query: 274 GKESNYTSVTKLLKDEGIDLDHNRFLILQGEV 305
            K ++ + V +LL+  G    +   ++ QG +
Sbjct: 115 NKNASRSDVQRLLESAGFSTSNPYNIVPQGRI 146

 Score = 45.1 bits (105), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 63/133 (47%), Gaps = 9/133 (6%)

Query: 689 YGRLGDLGAIDDRYD-IAISTACPRLNDLVVETVECGQQCIEYLRKNKLGYARFILLEKL 747
           +G LG+L  I ++Y   A       L  +VV+T       ++ L  +K G   FI L ++
Sbjct: 532 FGPLGELIKISEKYKACAEVVGGTSLFHVVVDTENTAALLMQELYNSKGGRVTFIPLNRV 591

Query: 748 RNFDMNKISTPNNVPRLFDLV--ISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNKRF 805
            + D N +   N+      L+  I  DPKF  A   V   T+VV +L    ++A   K+F
Sbjct: 592 -HVDSNIVYPSNDEHHCTPLIKKIKYDPKFERAIKHVFGKTIVVKDLNQGTKLA---KQF 647

Query: 806 RV--VTLSGELID 816
           R+  +TL G+  D
Sbjct: 648 RLNAITLDGDKAD 660

>Ecym_6322 Chr6 (611978..615676) [3699 bp, 1232 aa] {ON} similar to
            Ashbya gossypii AAL182W
          Length = 1232

 Score = 82.0 bits (201), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 66/247 (26%), Positives = 115/247 (46%), Gaps = 34/247 (13%)

Query: 1197 IPRISEDEFKNVDVEELEAQKLQLQDYIDTV-NVNIDVLEEYARRVAEYKRRKLDLNNAV 1255
            +P  S D++KN+   EL  +  ++ D +  + NVN   LE + ++  E ++  +     +
Sbjct: 954  LPEDSSDKYKNLSSTELLTRLGKINDELSQMTNVNRRALENF-KKFDEKQKDVIKRAKEL 1012

Query: 1256 DEREK-VRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELV--------- 1305
            DE +K + EL++KLK  + E     F  +S    ++++ +   G   L +          
Sbjct: 1013 DESKKSIEELIEKLKGQKVEAVEVTFKKVSENFTKLFEKMVPRGTGRLVIHRRADEKQEP 1072

Query: 1306 --------------------DSLDPFSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLA 1343
                                D+ D    GV+  V     K    ++  LSGG+KT+ ++A
Sbjct: 1073 RSRNQKKRKQDQLYDFDNGDDNEDSVYSGVSIGVSFNSKKDEQLHVEQLSGGQKTVCAIA 1132

Query: 1344 LVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQL 1403
            L+ A+    P P Y+ DEIDAALD +  + VA  IKE +  AQFI  + R++M  +A++ 
Sbjct: 1133 LILAIQMVDPAPFYLFDEIDAALDKQYRTAVAATIKELSSEAQFICTTFRSDMIGIADKF 1192

Query: 1404 VGIYKSN 1410
              +   N
Sbjct: 1193 YRVKYEN 1199

 Score = 54.3 bits (129), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 75/166 (45%), Gaps = 15/166 (9%)

Query: 154 LCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDR 213
           + I K+++  FK+Y     +  F +  + VVG NGSGKSN   ++ FV     + ++++ 
Sbjct: 1   MYIRKVIISGFKTYKNKTEIDNFSAHHNVVVGLNGSGKSNFFAAIRFVLSDDYTNLKREE 60

Query: 214 LSDLIHKSENFPDLKSCSVEVHFE-----YVIDKPDGTTIINTVKEKLVITRKAFKNNTS 268
              LI++  +   + S  VE+ F       ++  PD    I          R+       
Sbjct: 61  RRSLIYQGTS--SVMSGYVEIVFHDAENRTLLGIPDSNGAIR--------IRRTVGLKKD 110

Query: 269 KYYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPK 314
           +Y IN K S+ + V +LL+  G    +   ++ QG + ++   K +
Sbjct: 111 EYMINNKNSSRSDVQRLLESAGFSTSNPYNIVPQGRIVSLTNAKDR 156

>TDEL0D01620 Chr4 complement(321963..325634) [3672 bp, 1223 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1223

 Score = 81.3 bits (199), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 69/253 (27%), Positives = 114/253 (45%), Gaps = 37/253 (14%)

Query: 1205 FKNVDVEELEAQKLQL--QDYIDTVNVNIDVLEEYARRVAEYKRRKLDLNNAVDE----R 1258
            F N+  EEL  +KL    +D     NVN    E + +    +  +KL+L +   E    +
Sbjct: 965  FSNLSSEEL-LRKLNAVNEDISGLKNVNKKAFENFKK----FHEKKLELEDRSKELDESK 1019

Query: 1259 EKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDP-------- 1310
              ++ L+ KLK+ +       F  +S    E+++ +   G A+L +  S D         
Sbjct: 1020 TSIQNLIVKLKQQKVAAVDSTFENVSRNFTEVFEQLVPRGKAKLVIHRSSDARDDDVDAE 1079

Query: 1311 ----------------FSEGVTFSVMPPKKSWR--NITNLSGGEKTLSSLALVFALHKYK 1352
                               GV+ SV    K  R  ++  LSGG+KT+ ++AL+ A+    
Sbjct: 1080 NDTAMTGDDDGTQTESMYTGVSISVSFNSKKTRQLHVEQLSGGQKTVCAVALILAIQMVD 1139

Query: 1353 PTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQ 1412
            P P Y+ DEIDAALD +  + VA  IK  + NAQFI  + R +M ++A++   +   N  
Sbjct: 1140 PAPFYLFDEIDAALDKQYRTAVAGIIKALSANAQFICTTFRTDMLQVADKFFRVKYENKI 1199

Query: 1413 TKSATLQNNDIIN 1425
            +    +   + IN
Sbjct: 1200 STVVEVDRQEAIN 1212

 Score = 58.9 bits (141), Expect = 8e-08,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 75/164 (45%), Gaps = 8/164 (4%)

Query: 154 LCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDR 213
           + I ++++  FK+Y    V+  F    + V+G NGSGKSN   ++ FV     S ++++ 
Sbjct: 1   MYIRRVIIKGFKTYRNETVIDDFSPHHNIVIGSNGSGKSNFFAAIRFVLSGDYSNLKREE 60

Query: 214 LSDLIHKSENFPDLKSCSVEVHF---EYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKY 270
              LIH+      + S SVE+ F   ++ I  P G   +       V+ R+        Y
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFHDPDHRIILPSG---VAPRSNDEVLVRRTVGLKKDDY 115

Query: 271 YINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPK 314
            +N +      V ++L+  G  +++   ++ QG +  +   K K
Sbjct: 116 QLNDRNVTKGDVVRMLESAGFSMNNPYNIVPQGRIIALTNAKDK 159

>NCAS0A09330 Chr1 (1844122..1847805) [3684 bp, 1227 aa] {ON} Anc_1.295
            YJL074C
          Length = 1227

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/125 (34%), Positives = 71/125 (56%), Gaps = 2/125 (1%)

Query: 1303 ELVDSLDPFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMD 1360
            E++++ +    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ D
Sbjct: 1092 EVINNNESIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFD 1151

Query: 1361 EIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATLQN 1420
            EIDAALD +  + VAN IK+ + NAQFI  + R +M ++A++   +   N  +    +  
Sbjct: 1152 EIDAALDKQYRTAVANIIKQLSVNAQFICTTFRTDMLQVADRFFRVKYENKISTVIEVDK 1211

Query: 1421 NDIIN 1425
             D IN
Sbjct: 1212 QDAIN 1216

 Score = 60.5 bits (145), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 76/164 (46%), Gaps = 6/164 (3%)

Query: 154 LCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDR 213
           + I ++V+  FK+Y    V+  F    + V+G NGSGKSN   ++ FV     S ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNQTVIDDFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSENFPDLKSCSVEVHF---EYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKY 270
              LIH+      + S SVE+ F   E+ +  P G  ++       +  R+        Y
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFHDPEHKMILPSG--VVPRENNDEICIRRTVGLKKDDY 117

Query: 271 YINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPK 314
            +N +      V ++L+  G  + +   ++ QG++ ++   K K
Sbjct: 118 QLNDRNVTKGDVVRMLESTGFSMSNPYNIVPQGKIISLTNAKDK 161

>KNAG0B05230 Chr2 complement(1005244..1008921) [3678 bp, 1225 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1225

 Score = 80.9 bits (198), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 69/230 (30%), Positives = 109/230 (47%), Gaps = 38/230 (16%)

Query: 1224 IDTVNVNIDVLEEYARRVAE-YKR-----RKLDLNNAVDEREKV--RELLDKLKKTRFEE 1275
            ++ VN NI  L    +R  E +KR     R+L    A  E  KV  ++L+++LK+ +   
Sbjct: 978  LNEVNKNIAGLSNVNKRAFENFKRFNEKQRELSQRAAELEESKVSIQDLIERLKQQKISA 1037

Query: 1276 FMQGFGVISITLKEMYQMITMGGNAEL---------------ELVD----------SLDP 1310
                F  +S     +++ +   G A L               E VD           L+ 
Sbjct: 1038 VDNTFKKVSDNFVTVFEQLVPKGTARLIIHKNTDKGDLAVRDEDVDEDVNMDGESQDLES 1097

Query: 1311 FSEGVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1368
               GV+ SV     K     +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD 
Sbjct: 1098 VYTGVSISVSFSSKKNEQLRVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDK 1157

Query: 1369 RNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSATL 1418
            +  + VAN IK+ +KNAQFI  + R +M  +A++    Y+   + K +T+
Sbjct: 1158 QYRTSVANAIKKLSKNAQFICTTFRTDMLAVADRF---YRVKYENKISTI 1204

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 73/165 (44%), Gaps = 10/165 (6%)

Query: 154 LCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDR 213
           + I ++V+  FK+Y    ++  F    + V+G NGSGKSN   ++ FV     S ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTV----KEKLVITRKAFKNNTSK 269
              LIH+      + S SVE+ F      PD   I+++         V  R+        
Sbjct: 61  RQGLIHQGSG--SVMSASVEIVFH----DPDHRIILSSGVIPRPNDEVFVRRTVGLKKDD 114

Query: 270 YYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPK 314
           Y IN +    + + ++L+  G  +     ++ QG +  +   K K
Sbjct: 115 YQINDRNVTKSDLVRMLESAGFSMGSPYNIVPQGRIIALTNAKDK 159

>TPHA0I01090 Chr9 complement(252902..256552) [3651 bp, 1216 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1216

 Score = 78.6 bits (192), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 50/189 (26%), Positives = 94/189 (49%), Gaps = 19/189 (10%)

Query: 1256 DEREKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAEL-------ELVDSL 1308
            D +  ++EL+ +LK+ +       F  +S    ++++ +   G A L       + + S+
Sbjct: 1017 DSKNSIQELITQLKEQKITAVDTTFKKVSENFTKVFEKLVPRGTANLIIHRRSDDSLASM 1076

Query: 1309 DPFSE----------GVTFSVM--PPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPL 1356
            D  ++          GV+ SV     +    ++  LSGG+KT+ ++A++ A+    P P 
Sbjct: 1077 DINTDSQNISELVYTGVSISVSFNSKRDEQLHVEQLSGGQKTVCAIAMILAIQMVDPAPF 1136

Query: 1357 YVMDEIDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSNNQTKSA 1416
            Y+ DEIDAALD +  + VA+ IK  + NAQFI  + R +M ++A++   +   N  +   
Sbjct: 1137 YLFDEIDAALDKQYRTAVADVIKSLSSNAQFICTTFRTDMLQVADKFFRVKYENKISTVV 1196

Query: 1417 TLQNNDIIN 1425
             +  +  IN
Sbjct: 1197 EINRDSAIN 1205

 Score = 60.1 bits (144), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 39/171 (22%), Positives = 73/171 (42%), Gaps = 22/171 (12%)

Query: 154 LCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDR 213
           + I K+++  FK+Y    ++  F   ++ ++G NGSGKSN   ++ FV     S ++++ 
Sbjct: 1   MYIQKVIIKGFKTYRNETIIDDFSPHYNIIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSENFPDLKSCSVEVHF----------EYVIDKPDGTTIINTVKEKLVITRKAF 263
              LIH+      + S SVE+ F            V   PD T  I          R+  
Sbjct: 61  RQGLIHQGSG--SVMSASVEIQFYDPGNSMILPSGVAVNPDSTVSI----------RRTV 108

Query: 264 KNNTSKYYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPK 314
                 Y IN +    + + ++++  G  + +   ++ QG +  +   K K
Sbjct: 109 GLKKDDYQINDRNVTKSDIVRMMESTGFSMSNPYNIVPQGRIVALTNAKDK 159

>NDAI0G05630 Chr7 complement(1393671..1397360) [3690 bp, 1229 aa] {ON}
            Anc_1.295 YJL074C
          Length = 1229

 Score = 78.2 bits (191), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 39/105 (37%), Positives = 61/105 (58%), Gaps = 2/105 (1%)

Query: 1308 LDPFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAA 1365
            ++P   GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAA
Sbjct: 1099 IEPIYTGVSISVSFNSKENEQLHVEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAA 1158

Query: 1366 LDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSN 1410
            LD +  + VA  I++ + NAQFI  + R +M E+A+    +   N
Sbjct: 1159 LDKQYRTSVAKLIEKLSANAQFICTTFRTDMLEVADTFFRVKYEN 1203

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 40/164 (24%), Positives = 78/164 (47%), Gaps = 7/164 (4%)

Query: 154 LCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDR 213
           + I ++V+  FK+Y    ++  F    + V+G NGSGKSN   ++ FV     S ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHHNIVIGSNGSGKSNFFSAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSENFPDLKSCSVEVHFE---YVIDKPDGTTIINTVKEKLVITRKAFKNNTSKY 270
              LIH+      + S SVE+ F    + I  P G  ++    +++ I R+        Y
Sbjct: 61  RQGLIHQGSGGA-VMSASVEIVFHDPNHKIILPSG--VVPRENDEVYI-RRTVGLKKDDY 116

Query: 271 YINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPK 314
            +N +      V ++L+  G  +++   ++ QG++  +   K K
Sbjct: 117 QLNDRNVTKGDVVRMLESTGFSMNNPYNIVPQGKIIALTNAKDK 160

>Suva_6.149 Chr6 (248275..251967) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 77.8 bits (190), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 61/229 (26%), Positives = 108/229 (47%), Gaps = 37/229 (16%)

Query: 1219 QLQDYIDTVNVNIDVLEEYARRVAE----YKRRKLDLNNAVDE----REKVRELLDKLKK 1270
            QL   ++ +N  I  L+   +R  E    +  ++ DL+    E    ++ +++L+ KLK+
Sbjct: 976  QLLQKLNDMNTEISSLKNVNKRAFENFKKFNEKRKDLSGRASELDESKDSIQDLIVKLKQ 1035

Query: 1271 TRFEEFMQGFGVISITLKEMYQMITMGGNAELELV----DSLDPFSE------------- 1313
             +       F  +S   K +++ +   G A+L +     DS+D  ++             
Sbjct: 1036 QKVSAVDSTFQKVSENFKTVFERLVPRGTAKLVIHRRNEDSIDQANDVDVDMDTGNNEDT 1095

Query: 1314 ----------GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDE 1361
                      GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DE
Sbjct: 1096 INKEGETVYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDE 1155

Query: 1362 IDAALDFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSN 1410
            IDAALD +  + VA  IKE + NAQFI  + R +M ++A++   +   N
Sbjct: 1156 IDAALDKQYRTAVATMIKELSTNAQFICTTFRTDMLQVADKFFRVKYEN 1204

 Score = 57.4 bits (137), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 76/165 (46%), Gaps = 9/165 (5%)

Query: 154 LCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDR 213
           + I ++V+  FK+Y    ++  F    + ++G NGSGKSN   ++ FV     S ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTV----KEKLVITRKAFKNNTSK 269
              LIH+      + S SVE+ F      PD + I+ +      +  V  R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFH----DPDHSMILPSGVLSRGDDEVTIRRTVGLKKDD 115

Query: 270 YYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPK 314
           Y +N +      + ++L+  G  +++   ++ QG++  +   K K
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDK 160

>TBLA0C02740 Chr3 (656941..660300) [3360 bp, 1119 aa] {ON} Anc_1.295
            YJL074C
          Length = 1119

 Score = 77.8 bits (190), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 48/155 (30%), Positives = 84/155 (54%), Gaps = 5/155 (3%)

Query: 1265 LDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKK 1324
            +D LK+ +     + F  +S    ++++ +   G  EL +      +S GV+  V    K
Sbjct: 952  IDNLKEQKVNAVERTFNQVSENFSDIFEQLVPRGTGELVIGRQGQEYS-GVSIQVSFNSK 1010

Query: 1325 S--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT 1382
            +     I  LSGG+KT+ ++AL+ A+ +  P P Y+ DEIDAALD      V+  IK  +
Sbjct: 1011 NDEQLQIEQLSGGQKTVCAIALILAIQQVDPAPFYLFDEIDAALDKEYRKSVSQVIKRLS 1070

Query: 1383 KNA-QFIVISLRNNMFELAEQLVGIYKSNNQTKSA 1416
            +N  QFI+ + R++M E+A+ ++ + K +N+  S 
Sbjct: 1071 QNGTQFILTTFRSDMIEIAD-MIYMVKYHNKVSSV 1104

 Score = 43.1 bits (100), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 68/292 (23%), Positives = 135/292 (46%), Gaps = 23/292 (7%)

Query: 686 SGFYGRLGDLGAIDDRYDIAIST-ACPRLNDLVVETVECGQQCIEYLRKNKLGYARFILL 744
           +  YG LG+L  + ++Y   +   A   L +++V+T E   Q +  L + + G   FI L
Sbjct: 459 TSIYGTLGELIKVSEKYKRCVEIIAGNSLFNIIVDTDETASQIMNELIRMQNGRVTFIPL 518

Query: 745 EKLRN-FDMNKISTPNNVPRLFDLVISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNK 803
            ++ N  ++N  S   +        I  D KF     +V   T+VV +L+  NR+    K
Sbjct: 519 NRIENGVNINYPSNEESNCTALIKKIKYDKKFEKVIRNVFGKTIVVKDLQLGNRLC---K 575

Query: 804 RFRV--VTLSGELIDVXXXXX-----XXXXXXXXXLMKLTKSGNSGFKSYTIEDVEKIEK 856
            F++  +TL G+ ID                    L +L +S N  +K+ T++++ +I+ 
Sbjct: 576 EFKLQAITLDGDRIDSKGVVSGGYFNINRRSRLDNLKELQRSRNV-YKN-TMKELAQIKD 633

Query: 857 ELAAREKNFEIANETFTEMETELRRLKDRKPDVELEISK-----FELEITSWVTEHELMQ 911
           E++  +   +  N    E+  +  R+  +  D  L++++     + LE T    +++  Q
Sbjct: 634 EISQIDDEIDKINAEIREVSGKRERVMIKNEDGRLKLNQSKTQLYNLEETMVNVKNKREQ 693

Query: 912 QQ----LNEKQQSLDECMSNNEELSTMEHELGTLQNDYKSLQLETKSKKDRI 959
            +    LNE +    E   N E ++  + ELG   ++ + + L+ KSK++++
Sbjct: 694 MEKNVLLNEAKLKEYELEMNKEFVNGNDGELGDGDDELRDISLQLKSKEEKM 745

>Smik_10.167 Chr10 complement(290936..294625) [3690 bp, 1229 aa] {ON}
            YJL074C (REAL)
          Length = 1229

 Score = 77.4 bits (189), Expect = 2e-13,   Method: Compositional matrix adjust.
 Identities = 40/104 (38%), Positives = 60/104 (57%), Gaps = 2/104 (1%)

Query: 1309 DPFSEGVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1366
            D    GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAAL
Sbjct: 1100 DIMYTGVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAAL 1159

Query: 1367 DFRNVSIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSN 1410
            D +  + VA  IKE +KNAQFI  + R +M ++A++   +   N
Sbjct: 1160 DKQYRTAVATLIKELSKNAQFICTTFRTDMLQVADKFFRVKYEN 1203

 Score = 57.0 bits (136), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 76/165 (46%), Gaps = 9/165 (5%)

Query: 154 LCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDR 213
           + I ++++  FK+Y    ++  F    + ++G NGSGKSN   ++ FV     S ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTV----KEKLVITRKAFKNNTSK 269
              LIH+      + S SVE+ F      PD + I+ +      +  V  R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFH----DPDHSMILPSGVLSRGDDEVTIRRTVGLKKDD 115

Query: 270 YYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPK 314
           Y +N +      + ++L+  G  +++   ++ QG++  +   K K
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDK 160

>YJL074C Chr10 complement(299157..302849) [3693 bp, 1230 aa] {ON}
            SMC3Subunit of the multiprotein cohesin complex required
            for sister chromatid cohesion in mitotic cells; also
            required, with Rec8p, for cohesion and recombination
            during meiosis; phylogenetically conserved SMC
            chromosomal ATPase family member
          Length = 1230

 Score = 75.9 bits (185), Expect = 6e-13,   Method: Compositional matrix adjust.
 Identities = 38/99 (38%), Positives = 59/99 (59%), Gaps = 2/99 (2%)

Query: 1314 GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1371
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1372 SIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSN 1410
            + VA  +KE +KNAQFI  + R +M ++A++   +   N
Sbjct: 1166 TAVATLLKELSKNAQFICTTFRTDMLQVADKFFRVKYEN 1204

 Score = 57.0 bits (136), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 37/165 (22%), Positives = 76/165 (46%), Gaps = 9/165 (5%)

Query: 154 LCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDR 213
           + I ++++  FK+Y    ++  F    + ++G NGSGKSN   ++ FV     S ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTV----KEKLVITRKAFKNNTSK 269
              LIH+      + S SVE+ F      PD + I+ +      +  V  R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFH----DPDHSMILPSGVLSRGDDEVTIRRTVGLKKDD 115

Query: 270 YYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPK 314
           Y +N +      + ++L+  G  +++   ++ QG++  +   K K
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMNNPYNIVPQGKIVALTNAKDK 160

>Skud_10.170 Chr10 (316063..319755) [3693 bp, 1230 aa] {ON} YJL074C
            (REAL)
          Length = 1230

 Score = 72.8 bits (177), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 37/99 (37%), Positives = 58/99 (58%), Gaps = 2/99 (2%)

Query: 1314 GVTFSVMPPKKS--WRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNV 1371
            GV+ SV    K     ++  LSGG+KT+ ++AL+ A+    P   Y+ DEIDAALD +  
Sbjct: 1106 GVSISVSFNSKQNEQLHVEQLSGGQKTVCAIALILAIQMVDPASFYLFDEIDAALDKQYR 1165

Query: 1372 SIVANYIKERTKNAQFIVISLRNNMFELAEQLVGIYKSN 1410
            + VA  IKE + +AQFI  + R +M ++A++   +   N
Sbjct: 1166 TAVATLIKELSNDAQFICTTFRTDMLQVADKFFRVKYEN 1204

 Score = 56.6 bits (135), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 38/165 (23%), Positives = 75/165 (45%), Gaps = 9/165 (5%)

Query: 154 LCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDR 213
           + I ++V+  FK+Y    ++  F    + ++G NGSGKSN   ++ FV     S ++++ 
Sbjct: 1   MYIKRVVIKGFKTYRNETIIDNFSPHQNVIIGSNGSGKSNFFAAIRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTV----KEKLVITRKAFKNNTSK 269
              LIH+      + S SVE+ F      PD + I+ +      +  V  R+        
Sbjct: 61  RQGLIHQGSG-GSVMSASVEIVFH----DPDHSMILPSGVLSRGDDEVTIRRTVGLKKDD 115

Query: 270 YYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPK 314
           Y +N +      + ++L+  G  + +   ++ QG++  +   K K
Sbjct: 116 YQLNDRNVTKGDIVRMLETAGFSMTNPYNIVPQGKIVALTNAKDK 160

>KLLA0A00286g Chr1 complement(22024..25698) [3675 bp, 1224 aa] {ON}
            similar to uniprot|P47037 Saccharomyces cerevisiae
            YJL074C SMC3 Subunit of the multiprotein cohesin complex
            required for sister chromatid cohesion in mitotic cells
          Length = 1224

 Score = 69.7 bits (169), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 34/97 (35%), Positives = 52/97 (53%)

Query: 1329 ITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFI 1388
            +  LSGG+KT+ ++AL+ A+    P P Y+ DEIDAALD +    VA  IK  +  AQFI
Sbjct: 1117 VEQLSGGQKTVCAIALILAIQMVDPAPFYLFDEIDAALDKQYRIAVARTIKNLSDTAQFI 1176

Query: 1389 VISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDIIN 1425
              + R +M  +A+    +   N  +    +   D +N
Sbjct: 1177 CTTFRTDMINVADTFFRVKFENKVSTVTEVSRQDAVN 1213

 Score = 52.0 bits (123), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 71/160 (44%), Gaps = 11/160 (6%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLS 215
           I  +++  FK+Y    VV  F    + VVG NGSGKSN   ++ FV     S ++++   
Sbjct: 4   IKTVIISGFKTYKNRTVVENFSPHHNVVVGSNGSGKSNFFAAIRFVLSEENSNLKREDRK 63

Query: 216 DLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTII---NTVKEKLVITRKAFKNNTSKYYI 272
             I++      + S  VE+ F    D P+   +    N   E  V  R+       +Y I
Sbjct: 64  GFIYQGAG--QVMSAFVEIIF----DDPENLMLAPLRNDTGE--VRIRRTVGLKKDEYMI 115

Query: 273 NGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMK 312
           N K S    V ++L++ G    +   ++ QG + ++   K
Sbjct: 116 NDKNSTRQDVRRVLENVGFSTSNPYNIVPQGRIISLTNAK 155

>CAGL0H02805g Chr8 complement(256682..260341) [3660 bp, 1219 aa]
           {ON} similar to uniprot|P47037 Saccharomyces cerevisiae
           YJL074c SMC3 required for structural maintenance of
           chromosomes
          Length = 1219

 Score = 63.9 bits (154), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 41/164 (25%), Positives = 76/164 (46%), Gaps = 6/164 (3%)

Query: 154 LCIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDR 213
           + I ++++  FK+Y    ++G F    + V+G NGSGKSN   ++ FV     S ++++ 
Sbjct: 1   MYIKRVIIKGFKTYRNETIIGDFSPHHNVVIGANGSGKSNFFAAVRFVLSDDYSNLKREE 60

Query: 214 LSDLIHKSENFPDLKSCSVEVHF---EYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKY 270
              LIH+      + S SVE+ F   E+ I  P G     +  E  V  R+        Y
Sbjct: 61  RQGLIHQGAG-ASVMSASVEIVFHDPEHSIIAPTGINSNGSSDE--VRIRRTVGLKKDDY 117

Query: 271 YINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKPK 314
            +N +      + ++L+  G  + +   ++ QG + ++   K K
Sbjct: 118 QVNDRNVTKGDLVRMLESAGFYMSNPYNIVPQGRIVSLTNAKDK 161

>YFL008W Chr6 (119429..123106) [3678 bp, 1225 aa] {ON}  SMC1Subunit
           of the multiprotein cohesin complex, essential protein
           involved in chromosome segregation and in double-strand
           DNA break repair; SMC chromosomal ATPase family member,
           binds DNA with a preference for DNA with secondary
           structure
          Length = 1225

 Score = 55.5 bits (132), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 70/133 (52%), Gaps = 5/133 (3%)

Query: 687 GFYGRLGDLG-AIDDRYDIAISTACPR-LNDLVVETVECGQQCIEYLRKNKLGYARFILL 744
           G  G + DL     ++Y +A+ST   +  + ++VE +   Q+CI +L+K + G A FI L
Sbjct: 528 GVKGLVHDLCHPKKEKYGLAVSTILGKNFDSVIVENLTVAQECIAFLKKQRAGTASFIPL 587

Query: 745 EKLRNFDMNKISTPNNVPRLFDL-VISSDPKFLPAFYSVLRDTLVVNNLKDANRVAYGNK 803
           + +   ++  +S P++   +  +  I  +P++  A   V  D+++ N L  A  + +   
Sbjct: 588 DTIET-ELPTLSLPDSQDYILSINAIDYEPEYEKAMQYVCGDSIICNTLNIAKDLKWKKG 646

Query: 804 -RFRVVTLSGELI 815
            R ++VT+ G LI
Sbjct: 647 IRGKLVTIEGALI 659

>KNAG0L00630 Chr12 complement(93928..97254) [3327 bp, 1108 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1108

 Score = 54.7 bits (130), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 47/159 (29%), Positives = 81/159 (50%), Gaps = 16/159 (10%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDRLS 215
           + +L LH+F +Y+  +    F  S + VVGPNGSGKS ++ ++      R   + + + S
Sbjct: 57  VVRLRLHNFVTYSLAEF--EFSPSLNMVVGPNGSGKSTLVCALCLGLAGRTEYLGRMKRS 114

Query: 216 DLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGK 275
           D   K  N  D  S  ++V   ++  +  GTT+    K   V+TR   K   S YY++G 
Sbjct: 115 DSFIK--NGAD--SARIDV---WLAGEDPGTTL----KVSRVLTRNHKK--ASLYYVDGV 161

Query: 276 ESNYTSVTKLLKDE-GIDLDHNRFLILQGEVENIAQMKP 313
           E++   V +L+  +  I LD+    + Q  V+  A+++P
Sbjct: 162 ETSEQRVRQLVATQHNIQLDNLCQFLSQERVQEFARLRP 200

 Score = 42.7 bits (99), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 43/165 (26%), Positives = 70/165 (42%), Gaps = 42/165 (25%)

Query: 1230 NIDVLEEYARRVAEYKRR------KLDLNNAV--DEREKVRELLDKLKKTRFEEFMQGF- 1280
            +I +L+E  R++A+ K R      KLD   A     + ++   LD + +   E F   F 
Sbjct: 902  SIAILQEVERKLADVKARLPAMVRKLDAATASMSTMQAELEPRLDTIVEKISERFTNLFT 961

Query: 1281 -----GVISITLKEMYQ------MITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNI 1329
                 G I ++   +YQ      M+    NA L+ +DS                      
Sbjct: 962  NVGSAGAIQLSKPHLYQEWEMKIMVKFRDNAPLKRLDS---------------------- 999

Query: 1330 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIV 1374
               SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV
Sbjct: 1000 HTQSGGERAVSTVLYIIALQEFTSAPFRVVDEINQGMDQRNERIV 1044

>KLTH0D02816g Chr4 complement(272310..275594) [3285 bp, 1094 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034W SMC5 Structural maintenance of chromosomes (SMC)
           protein interacts with Rhc18p and Nse1p to form a large
           complex S. pombe homolog forms a heterodimer with S.
           pombe Rad18p that is involved in DNA repair
          Length = 1094

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 47/163 (28%), Positives = 78/163 (47%), Gaps = 20/163 (12%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFH--SSFSAVVGPNGSGKSNVIDSMLFVFGFRASKM-RQD 212
           I  L L +F +YA T+    FH   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 47  IVTLRLENFVTYALTE----FHMSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRST 102

Query: 213 RLSDLIHKSENFPDLKSC---SVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSK 269
           ++ D I   E+   ++       E    YV    DGTT +  V  +    RKA     S+
Sbjct: 103 KIEDYIKNGEDRSVIEVTLKRDPEAEDRYVAS--DGTTKVTRVLHR---NRKA-----SE 152

Query: 270 YYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMK 312
           Y++NG+    ++V +L+ +  I LD+    + Q  VE  A++K
Sbjct: 153 YFLNGQSVTESAVKRLVSELNIQLDNLCQFLSQERVEEFARLK 195

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1333 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1389
            SGGE+ +S++  + AL      P  V+DEI+  +D RN  IV   + E      N+Q+I+
Sbjct: 989  SGGERAVSTVLYMIALQDVTSAPFRVVDEINQGMDSRNERIVHKSMVESACSQNNSQYIL 1048

Query: 1390 IS 1391
            ++
Sbjct: 1049 VT 1050

>SAKL0B09526g Chr2 (805816..809115) [3300 bp, 1099 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1099

 Score = 49.7 bits (117), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 44/161 (27%), Positives = 76/161 (47%), Gaps = 14/161 (8%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFH--SSFSAVVGPNGSGKSNVIDSMLFVFGFRASKM-RQD 212
           I K+ L +F +YA T+    FH   S + ++GPNGSGKS  + ++      R   + R  
Sbjct: 48  IIKIRLKNFVTYALTE----FHLSPSLNMIIGPNGSGKSTFVCAICLGLAGRPEYIGRSK 103

Query: 213 RLSDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNN-TSKYY 271
           R+ D I   E+      C +E+  +    K  G   + +  + + ITR   ++   S Y+
Sbjct: 104 RVEDFIKNGED-----ECEIEITLKNN-SKIQGIANVLSSDDVIKITRVLIRHRKKSDYF 157

Query: 272 INGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMK 312
           IN + ++   V  ++    I LD+    + Q  VE  A++K
Sbjct: 158 INDRPASEGVVKSMILQLNIQLDNLCQFLSQERVEEFARLK 198

 Score = 41.2 bits (95), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1333 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1389
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 994  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDTRNERIVHKAMVENACAENTSQYFL 1053

Query: 1390 IS 1391
            I+
Sbjct: 1054 IT 1055

>KLLA0F07997g Chr6 complement(748561..751920) [3360 bp, 1119 aa]
           {ON} similar to uniprot|Q08204 YOL034W Saccharomyces
           cerevisiae YOL034W SMC5 Structural maintenance of
           chromosomes (SMC) protein, interacts with Rhc18p and
           Nse1p to form a large complex
          Length = 1119

 Score = 48.1 bits (113), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 48/169 (28%), Positives = 79/169 (46%), Gaps = 24/169 (14%)

Query: 155 CIDKLVLHDFKSYAGTQVVGPFH--SSFSAVVGPNGSGKSNVIDSMLFVFGFRASKM-RQ 211
            + KL L +F +YA T+    FH   S + ++GPNGSGKS  + ++      +   + R 
Sbjct: 59  AVVKLKLTNFVTYALTE----FHLSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRS 114

Query: 212 DRLSDLIHKSENFPD-------LKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFK 264
            ++ + I   +N  D       LK+ S  +H ++ +   D   +   VK  L + +K   
Sbjct: 115 KKVEEYI---KNGTDEGVIEITLKNSSALLHSDFNMINTDDDVV--HVKRVLSMEKKK-- 167

Query: 265 NNTSKYYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP 313
              SKYYIN K      V  +++   I LD+    + Q  VE  A++KP
Sbjct: 168 ---SKYYINNKVVTEEVVKSMVRVLNIQLDNLCQFLSQERVEEFARLKP 213

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 33/128 (25%), Positives = 55/128 (42%), Gaps = 20/128 (15%)

Query: 1283 ISITLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNL--------SG 1334
            IS     ++  +   G  EL+  DS + +        +  K  +R+ + L        SG
Sbjct: 963  ISKKFSHLFAYVGSAGQVELKKPDSFNDW-------CIEIKVKFRDNSELQQLNPHVQSG 1015

Query: 1335 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVA-----NYIKERTKNAQFIV 1389
            GE+ +S++  + AL ++  +P  V+DEI+  +D  N  IV      N   E T     I 
Sbjct: 1016 GERAVSTVLYMIALQQFTSSPFRVVDEINQGMDQTNERIVHRIMVENACAENTSQYFLIT 1075

Query: 1390 ISLRNNMF 1397
              L  N+F
Sbjct: 1076 PKLLTNLF 1083

>Skud_15.121 Chr15 (218825..222106) [3282 bp, 1093 aa] {ON} YOL034W
           (REAL)
          Length = 1093

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 76/163 (46%), Gaps = 16/163 (9%)

Query: 155 CIDKLVLHDFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKM-RQD 212
           CI K+ L DF +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 41  CITKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSK 97

Query: 213 RLSDLIHKSENFPDLKSC---SVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSK 269
           ++ D I   ++   ++     S +VH    I+  D      T+K   +ITR   +   S 
Sbjct: 98  KVEDFIKNGQDVSRIEITLKNSPKVHDIENINAHD-----ETIKITRIITRSKRR---SD 149

Query: 270 YYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMK 312
           Y IN  + +  +V  L+    I LD+    + Q  VE  A++K
Sbjct: 150 YLINDGQVSENTVKTLVTQLNIQLDNLCQFLSQERVEEFARLK 192

 Score = 41.2 bits (95), Expect = 0.025,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1333 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1389
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1390 IS 1391
            I+
Sbjct: 1047 IT 1048

>Kwal_26.7204 s26 complement(263266..266619) [3354 bp, 1117 aa] {ON}
           YOL034W - Protein required for cell viability [contig
           47] FULL
          Length = 1117

 Score = 47.8 bits (112), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 44/166 (26%), Positives = 74/166 (44%), Gaps = 15/166 (9%)

Query: 150 QIERLCIDKLVLHDFKSYAGTQVVGPFH--SSFSAVVGPNGSGKSNVIDSMLFVFGFRAS 207
           Q +   I KL L +F +Y+ T+    FH   S + ++GPNGSGKS  + ++      +  
Sbjct: 63  QFQPGSIVKLRLENFVTYSLTE----FHLSPSLNMIIGPNGSGKSTFVCAVCLGLAGKPE 118

Query: 208 KM-RQDRLSDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNN 266
            + R  R+   I   EN        +EV  +     P  T     V     ++R  +   
Sbjct: 119 YIGRGKRVDSFIKNGEN-----RGLIEVTLK---RDPGRTGSFVAVDGTTKVSRVLWVGK 170

Query: 267 TSKYYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMK 312
            S+YY+N +  +  +V  L+ +  I LD+    + Q  VE  A++K
Sbjct: 171 KSEYYLNDEPVSELTVKNLMGELNIQLDNLCQFLSQERVEEFARLK 216

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 37/62 (59%), Gaps = 3/62 (4%)

Query: 1333 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1389
            SGGE+ +S++  + AL ++   P  ++DEI+  +D RN  IV   + E     K +Q+I+
Sbjct: 1012 SGGERAVSTVLYMIALQEFTSAPFRIVDEINQGMDTRNERIVHKAMVENACAEKTSQYIL 1071

Query: 1390 IS 1391
            ++
Sbjct: 1072 VT 1073

>TDEL0E01340 Chr5 complement(265681..269001) [3321 bp, 1106 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1106

 Score = 47.0 bits (110), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/85 (31%), Positives = 44/85 (51%), Gaps = 3/85 (3%)

Query: 1310 PFSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR 1369
            P  + + +++ P     RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  
Sbjct: 987  PAKQLMIYTLTPNDNRPRNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQV 1046

Query: 1370 NVSIVANYIKERTKN---AQFIVIS 1391
            N  +    I E+ KN    Q I+I+
Sbjct: 1047 NRKMGTRLILEKLKNNSRTQTIIIT 1071

>TBLA0E02190 Chr5 complement(534078..537347) [3270 bp, 1089 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1089

 Score = 46.2 bits (108), Expect = 7e-04,   Method: Compositional matrix adjust.
 Identities = 49/191 (25%), Positives = 83/191 (43%), Gaps = 20/191 (10%)

Query: 129 LSPVKNSRIALQKIYESK------NEKQIERLCIDKLVLHDFKSYAGTQVVGPFHSSFSA 182
           +SP K+ +I+  K    +      + +Q +   I K+ L +F +Y+  +       S + 
Sbjct: 11  VSPTKDRQISTSKPARKRLKITAIDTEQFQPGSIIKIKLWNFVTYSLAEFT--LSPSLNM 68

Query: 183 VVGPNGSGKSNVIDSMLFVFGFRASKM-RQDRLSDLIHKSENFPDLKSCSVEVHFEYVID 241
           ++GPNGSGKS  + ++      +   + R  +L D I   E+        VEV  + V  
Sbjct: 69  IIGPNGSGKSTFVCAVCLGLAGKPEYIGRSSKLEDYIKNGED-----QSVVEVTLKNV-- 121

Query: 242 KPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDHNRFLIL 301
            P+     +T+  K  I R   K    +Y ING     T +   +K   I LD+    + 
Sbjct: 122 -PESDFNTDTILIKTTINRGKKK---PEYAINGSTVTETYIRAFVKKLNIQLDNLCQFLS 177

Query: 302 QGEVENIAQMK 312
           Q  VE  A++K
Sbjct: 178 QERVEEFARLK 188

 Score = 40.4 bits (93), Expect = 0.038,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1333 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1389
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  I+   + E       +Q+ +
Sbjct: 984  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIIHKAMVENACAENTSQYFL 1043

Query: 1390 IS 1391
            I+
Sbjct: 1044 IT 1045

>ZYRO0G01584g Chr7 (120582..123848) [3267 bp, 1088 aa] {ON} similar
           to uniprot|Q08204 Saccharomyces cerevisiae YOL034W SMC5
           Structural maintenance of chromosomes (SMC) protein
           interacts with Rhc18p and Nse1p to form a large complex
           S. pombe homolog forms a heterodimer with S. pombe
           Rad18p that is involved in DNA repair
          Length = 1088

 Score = 46.2 bits (108), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 43/161 (26%), Positives = 78/161 (48%), Gaps = 12/161 (7%)

Query: 155 CIDKLVLHDFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKM-RQD 212
            I K+ L +F +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  
Sbjct: 35  AIVKMRLENFVTYTLTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEFIKRSK 91

Query: 213 RLSDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNT-SKYY 271
           R+ D I   E+       S+E+  +    K +G   +++  + + ITR+  K+ + S+Y 
Sbjct: 92  RVEDFIKNGED-----RGSIEITLKNS-PKVEGMPGVDSEADTIKITRELIKSKSKSRYM 145

Query: 272 INGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMK 312
           IN +  +   V  L+    I LD+    + Q  VE  A++K
Sbjct: 146 INDRVVSEEDVRLLVSKLNIQLDNLCQFLSQERVEEFARLK 186

 Score = 41.2 bits (95), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 37/64 (57%), Gaps = 7/64 (10%)

Query: 1333 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1387
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN      S+V N   E T  +Q+
Sbjct: 981  SGGERAVSTVLYMIALQEFTTAPFRVVDEINQGMDSRNERIVHKSMVENACAENT--SQY 1038

Query: 1388 IVIS 1391
             +I+
Sbjct: 1039 FLIT 1042

>KAFR0D01330 Chr4 complement(263879..267121) [3243 bp, 1080 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1080

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/159 (27%), Positives = 73/159 (45%), Gaps = 20/159 (12%)

Query: 156 IDKLVLHDFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKM-RQDR 213
           I KL L +  +Y+ T+  + P   S + +VGPNGSGKS  + ++      +   + R  +
Sbjct: 37  IVKLRLQNVMTYSITEFNLSP---SLNMLVGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 93

Query: 214 LSDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYIN 273
           + + I   EN     +  ++           G      +K   ++TR   K   S+YYI+
Sbjct: 94  IDNFIKNGEN-----TAQIDTFLR-------GHMPNEVIKITRIMTRNKKK---SEYYID 138

Query: 274 GKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMK 312
              S  T+V KL  +  I LD+    + Q  VE+ A++K
Sbjct: 139 DSPSTETAVRKLASELNIQLDNLCQFLSQEHVEDFAKLK 177

 Score = 40.8 bits (94), Expect = 0.030,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1333 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1389
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 975  SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDQRNERIVHRAMVENACAENTSQYFL 1034

Query: 1390 IS 1391
            I+
Sbjct: 1035 IT 1036

>ZYRO0B12122g Chr2 (972611..975940) [3330 bp, 1109 aa] {ON} similar to
            uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1109

 Score = 43.9 bits (102), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 40/78 (51%), Gaps = 3/78 (3%)

Query: 1317 FSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVAN 1376
            F + P  +  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I   
Sbjct: 997  FILTPNDEKARNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRQIGTK 1056

Query: 1377 YIKERTKN---AQFIVIS 1391
             I  + K+    Q I+I+
Sbjct: 1057 LILNKLKDIARTQTIIIT 1074

 Score = 37.4 bits (85), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 34/126 (26%), Positives = 58/126 (46%), Gaps = 16/126 (12%)

Query: 156 IDKLVLHDFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKM-RQDR 213
           I K+VL +F  +   ++ +GP     + +VG NGSGKS ++ ++    G RA    R + 
Sbjct: 75  IKKVVLWNFMCHEHFELELGP---RLNFIVGNNGSGKSAILTAITVGLGARAMDTNRGNS 131

Query: 214 LSDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYI- 272
           L DLI +        S  + +H + +     G     T   +++I R    + TS + + 
Sbjct: 132 LKDLIREG-----CHSTKIRLHLDNL---NHGAYYQGTFGNEIIIERVIKNDGTSSFSLK 183

Query: 273 --NGKE 276
              GKE
Sbjct: 184 SETGKE 189

>YOL034W Chr15 (259923..263204) [3282 bp, 1093 aa] {ON}
           SMC5Component of the SMC5-SMC6 complex; this complex
           plays a key role in the removal of X-shaped DNA
           structures that arise between sister chromatids during
           DNA replication and repair; binds single-stranded DNA
           and has ATPase activity; S. pombe homolog forms a
           heterodimer with S. pombe Rad18p that is involved in DNA
           repair
          Length = 1093

 Score = 43.9 bits (102), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 46/163 (28%), Positives = 74/163 (45%), Gaps = 18/163 (11%)

Query: 156 IDKLVLHDFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKM-RQDR 213
           I K+ L DF +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  IIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 214 LSDLIHKSENFP----DLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSK 269
           + D I   ++       LK+       EY ID  D      T+K   +ITR   +   S 
Sbjct: 99  VEDFIKNGQDVSKIEITLKNSPNVTDIEY-IDARD-----ETIKITRIITRSKRR---SD 149

Query: 270 YYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMK 312
           Y IN  + + + V  L+    I LD+    + Q  VE  A++K
Sbjct: 150 YLINDYQVSESVVKTLVAQLNIQLDNLCQFLSQERVEEFARLK 192

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1333 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1389
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1390 IS 1391
            I+
Sbjct: 1047 IT 1048

>NDAI0J02180 Chr10 (529566..532892) [3327 bp, 1108 aa] {ON} Anc_4.237
            YLR383W
          Length = 1108

 Score = 42.7 bits (99), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 40/160 (25%), Positives = 73/160 (45%), Gaps = 28/160 (17%)

Query: 1259 EKVRELLDKLKKTRFEEFMQGFGVISITLKEMYQMITMGGN------------AELELVD 1306
            +KV +L +K  + ++++  + FG +   L+++   I +               A+L+   
Sbjct: 917  DKVVDLFEK-SRDKYKDAEKKFGSVDRALRQLQHSIEVRSQNYTNIQNNTCLEADLDFRA 975

Query: 1307 SLD--PFSEGVTFSVMPPK----------KSWRNITNLSGGEKTLSSLALVFALHKYKPT 1354
            SL    F+  +TF +   K          +  RN+  LSGGEK+ S LAL+ A  K   +
Sbjct: 976  SLKVRKFTGNLTFQIAERKLDMLILTANDEKARNVDTLSGGEKSFSQLALLLATWKPMRS 1035

Query: 1355 PLYVMDEIDAALDFRNVSIVANYIKERTKN---AQFIVIS 1391
             +  +DE D  +D  N  I    + ++ K+    Q I+I+
Sbjct: 1036 RIIALDEFDVFMDQVNRRIGTTLVVKKLKDLLRTQTIIIT 1075

>CAGL0F01155g Chr6 complement(116762..120079) [3318 bp, 1105 aa]
           {ON} similar to uniprot|Q08204 Saccharomyces cerevisiae
           YOL034w SMC5
          Length = 1105

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 81/173 (46%), Gaps = 18/173 (10%)

Query: 156 IDKLVLHDFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKM-RQDR 213
           I K+ L +F +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 38  IVKIRLENFVTYNYTEFNLSP---SLNMIIGPNGSGKSTYVCAVCLGLAGKPEYIGRSKQ 94

Query: 214 LSDLIHKSENFPDLKSC-----SVEVHF---EYVIDKPDGT-----TIINTVKEKLVITR 260
           + D I   ++   ++       ++++ F    +   + +G      TI   ++++  I R
Sbjct: 95  VEDFIKNGQDTSKIEIVLKDDPNIDIEFLGSSFHRIRNNGNYKGLLTITRNLEKRTKIGR 154

Query: 261 KAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP 313
              K  T +Y ING  +  ++V  L+    I LD+    + Q  VE  A+++P
Sbjct: 155 NLEKRRTQEYSINGLPTTESNVRNLVSKFHIQLDNLCQFLSQERVEEFAKLRP 207

 Score = 38.9 bits (89), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 50/206 (24%), Positives = 98/206 (47%), Gaps = 30/206 (14%)

Query: 1202 EDEFKNVDVEELEAQ---KLQLQDYIDTVNVNIDVLEEYARRVAEYKRRKLDLNNAVDER 1258
            ED+F  + VE++  +   K+QL ++  +    + +LE+   ++A+ + +   L   V + 
Sbjct: 870  EDKFNLIYVEQIVNKLESKIQLSNHDRSA---VALLEQTKAKIADLEDK---LPTQVRKC 923

Query: 1259 EKVR-ELLDKLK--KTRFEEFMQGFGVISITLKEMYQMITMGGNAELELVDSLDPFSEGV 1315
              +R E+ DK K  + R E  + G G       E+++ +   G   L     L  FS+  
Sbjct: 924  NTIRKEMSDKQKVLEPRLESIVSGIGR---KFSELFKDVGTAGGVTLNRKSKL--FSDW- 977

Query: 1316 TFSVMPPKKSWRNITNL-----SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALD--- 1367
               +M   +    ++ L     SGGE+ +S++  + AL K+   P  V+DEI+  +D   
Sbjct: 978  KLEIMVQFRDEGKLSGLDSHTQSGGERAVSTVLYMIALQKFTQAPFRVVDEINQGMDTNF 1037

Query: 1368 --FRNVSIVANYIKERTKNAQFIVIS 1391
                + ++V N  +E T  +Q+ +I+
Sbjct: 1038 ERLVHKAMVQNACEEGT--SQYFLIT 1061

>Suva_15.133 Chr15 (232441..235719) [3279 bp, 1092 aa] {ON} YOL034W
           (REAL)
          Length = 1092

 Score = 42.7 bits (99), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 42/160 (26%), Positives = 74/160 (46%), Gaps = 12/160 (7%)

Query: 156 IDKLVLHDFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKM-RQDR 213
           I K+ L DF +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  +
Sbjct: 42  IIKIRLQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKK 98

Query: 214 LSDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKN-NTSKYYI 272
           + D I   ++     +  +E+  +    K      INT  E + +TR   ++   S Y I
Sbjct: 99  VEDFIKNGQD-----TSRIEITLKNS-PKIHDIEFINTHDETIKVTRIITRSKRRSDYLI 152

Query: 273 NGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMK 312
           N ++ +   V  L+    I LD+    + Q  VE  A++K
Sbjct: 153 NDEQVSENVVKTLVAQLNIQLDNLCQFLSQERVEEFARLK 192

 Score = 41.2 bits (95), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1333 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1389
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1390 IS 1391
            I+
Sbjct: 1047 IT 1048

>CAGL0H05071g Chr8 (486899..490231) [3333 bp, 1110 aa] {ON} similar
           to uniprot|Q12749 Saccharomyces cerevisiae YLR383w RHC18
          Length = 1110

 Score = 42.0 bits (97), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 36/65 (55%), Gaps = 5/65 (7%)

Query: 156 IDKLVLHDFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKM-RQDR 213
           I KL LH+F  +    V +GP     + +VG NGSGKS ++ ++    G +AS+  R   
Sbjct: 80  IKKLTLHNFMCHRNFDVELGP---GLNFIVGKNGSGKSAILTAITIGLGAKASETNRGSS 136

Query: 214 LSDLI 218
           L DLI
Sbjct: 137 LKDLI 141

 Score = 41.6 bits (96), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 40/76 (52%), Gaps = 3/76 (3%)

Query: 1319 VMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1378
            + P    +R ++  SGGEK+ S +AL+ A  +   + +  +DE D  +D  N  I +  I
Sbjct: 1007 LTPNDDRYREVSTFSGGEKSYSQMALLLATWRPMRSRIIALDEFDVFMDQVNRKIGSKLI 1066

Query: 1379 KERTK---NAQFIVIS 1391
             ++ K   N Q I+I+
Sbjct: 1067 VKKLKDIPNTQTIIIT 1082

>TPHA0L00600 Chr12 complement(102317..105670) [3354 bp, 1117 aa]
           {ON} Anc_7.101 YOL034W
          Length = 1117

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 45/163 (27%), Positives = 76/163 (46%), Gaps = 18/163 (11%)

Query: 156 IDKLVLHDFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQDR- 213
           I K+ LH+F +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + + R 
Sbjct: 66  IIKIKLHNFVTYEFTEFDLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSRN 122

Query: 214 LSDLIHKSENFPDLKSC---SVEVH-FEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSK 269
           + D I   E   +++     S  +H  E V++  D  TI        ++TR   K   S+
Sbjct: 123 VDDYIKNDEEHGEIEITLKNSEAIHDVEGVLEGSDTITITR------ILTRSKKK---SE 173

Query: 270 YYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMK 312
           Y IN       +V +L+    I LD+    + Q  VE  A++K
Sbjct: 174 YKINDSLVTEATVKELVSLLNIQLDNLCQFLSQERVEEFARLK 216

 Score = 40.8 bits (94), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 21/62 (33%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1333 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1389
            SGGEK +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1012 SGGEKAVSTVFYMIALQEFTIAPFRVVDEINQGMDPRNEKIVHQSMVENACADNTSQYFL 1071

Query: 1390 IS 1391
            I+
Sbjct: 1072 IT 1073

>NCAS0I00570 Chr9 complement(90806..94093) [3288 bp, 1095 aa] {ON}
           Anc_7.101 YOL034W
          Length = 1095

 Score = 42.0 bits (97), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 78/173 (45%), Gaps = 18/173 (10%)

Query: 150 QIERLCIDKLVLHDFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASK 208
           Q +   I K+ L +F +Y  T+  + P   S + ++GPNGSGKS  + ++      +   
Sbjct: 32  QFQPGSIVKIKLQNFVTYRLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEF 88

Query: 209 M-RQDRLSDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIIN-----TVKEKLVITRKA 262
           + R  R+ D I   E+     +  +E+  +   D  +  + +N       K+ L +TR  
Sbjct: 89  IGRAKRVDDFIKNGED-----TSRIEIFLKNYEDPTELQSSLNLKFNLAGKDLLKVTRLI 143

Query: 263 FKNNT---SKYYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMK 312
            ++     S Y+IN K      +  L+K   I LD+    + Q  VE  A++K
Sbjct: 144 QRDGNKCKSDYFINDKPVTENVIKNLVKFLNIQLDNLCQFLSQERVEEFARLK 196

 Score = 41.6 bits (96), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1333 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1389
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 990  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDARNERIVHKAMVENACAENTSQYFL 1049

Query: 1390 IS 1391
            I+
Sbjct: 1050 IT 1051

>NCAS0J01390 Chr10 (242118..245408) [3291 bp, 1096 aa] {ON} Anc_4.237
          Length = 1096

 Score = 42.0 bits (97), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1327 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1384
            RN+  LSGGEK+ S LAL+ A  K   + +  +DE D  +D  N  I    + ++ K+  
Sbjct: 992  RNVDTLSGGEKSFSQLALLLATWKPMRSRIIALDEFDVFMDQVNRRIGTTLVVKKLKDLA 1051

Query: 1385 -AQFIVIS 1391
              Q I+I+
Sbjct: 1052 RTQTIIIT 1059

>TPHA0B00840 Chr2 complement(194812..198171) [3360 bp, 1119 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1119

 Score = 41.6 bits (96), Expect = 0.016,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1327 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1384
            R I NLSGGEK+ + +AL+ A  K   + +  +DE D  +D  N  I    + ++ KN  
Sbjct: 1019 RTIDNLSGGEKSFAQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTGLLVKKLKNQT 1078

Query: 1385 -AQFIVIS 1391
              Q I+I+
Sbjct: 1079 RTQTIIIT 1086

 Score = 35.8 bits (81), Expect = 0.93,   Method: Compositional matrix adjust.
 Identities = 28/85 (32%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 143 YESKNEKQIERL---CIDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSML 199
           YE  N + IE      I K+ L +F  +   ++   F    + +VG NGSGKS V+ ++ 
Sbjct: 69  YEGINTEYIEESPSGYIKKIKLRNFMCHENFEM--EFGPRLNFIVGNNGSGKSAVLTAIT 126

Query: 200 FVFGFRASKM-RQDRLSDLIHKSEN 223
              G +AS   R + L DLI +  N
Sbjct: 127 IGLGAKASDTNRGNSLKDLIREGCN 151

>NDAI0A08450 Chr1 (1947452..1950811) [3360 bp, 1119 aa] {ON} Anc_7.101
            YOL034W
          Length = 1119

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1333 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1389
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 1014 SGGERAVSTVLYMIALQEFTAAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1073

Query: 1390 IS 1391
            I+
Sbjct: 1074 IT 1075

 Score = 39.7 bits (91), Expect = 0.076,   Method: Compositional matrix adjust.
 Identities = 47/179 (26%), Positives = 78/179 (43%), Gaps = 33/179 (18%)

Query: 156 IDKLVLHDFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKM-RQDR 213
           I K+ L +F +Y  T+  + P   S + ++GPNGSGKS  + +       +   + R  R
Sbjct: 52  IVKIKLENFVTYKLTEFNLSP---SLNMIIGPNGSGKSTFVCAACLGLAGKPEYIGRSKR 108

Query: 214 LSDLIHKSENFPDLKSCSVEVHFEYV--IDK------------PDGTTI------INTVK 253
           + D I   E+        +E+  + V  +DK             +G  +      ++ +K
Sbjct: 109 VDDYIKNGED-----RSKIEIFLKNVESMDKLKNFNNNNNKNNNNGAQVDLKCGQLDLIK 163

Query: 254 EKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMK 312
              +I R   K   S YYIN K  +  +V  L+K   I LD+    + Q  VE  A++K
Sbjct: 164 FTRIIHRDKKK---SDYYINDKPVSELTVKNLVKALSIQLDNLCQFLSQERVEEFARLK 219

>Skud_12.468 Chr12 (825378..828740) [3363 bp, 1120 aa] {ON} YLR383W
            (REAL)
          Length = 1120

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1327 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1384
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1020 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1079

Query: 1385 -AQFIVIS 1391
              Q I+I+
Sbjct: 1080 RTQTIIIT 1087

 Score = 36.2 bits (82), Expect = 0.70,   Method: Compositional matrix adjust.
 Identities = 24/83 (28%), Positives = 41/83 (49%), Gaps = 8/83 (9%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKM-RQDRL 214
           I K++L +F  +   ++     S  + +VG NGSGKS ++ ++    G +AS+  R   L
Sbjct: 88  IKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSSL 145

Query: 215 SDLIHKSENFPDLKSCSVEVHFE 237
            DLI +        S  + +H E
Sbjct: 146 KDLIREG-----CYSAKITLHLE 163

>Smik_12.470 Chr12 (824001..827345) [3345 bp, 1114 aa] {ON} YLR383W
            (REAL)
          Length = 1114

 Score = 41.6 bits (96), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1327 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1384
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1385 -AQFIVIS 1391
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

>YLR383W Chr12 (885288..888632) [3345 bp, 1114 aa] {ON}  SMC6Component
            of the SMC5-SMC6 complex; this complex plays a key role
            in the removal of X-shaped DNA structures that arise
            between sister chromatids during DNA replication and
            repair; homologous to S. pombe rad18
          Length = 1114

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1327 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1384
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1014 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1073

Query: 1385 -AQFIVIS 1391
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

>Suva_10.500 Chr10 (850833..854180) [3348 bp, 1115 aa] {ON} YLR383W
            (REAL)
          Length = 1115

 Score = 41.2 bits (95), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1327 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1384
            RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ K+  
Sbjct: 1015 RNVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTTLIVKKLKDIA 1074

Query: 1385 -AQFIVIS 1391
              Q I+I+
Sbjct: 1075 RTQTIIIT 1082

 Score = 35.4 bits (80), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 58/125 (46%), Gaps = 14/125 (11%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKM-RQDRL 214
           I K++L +F  +   ++     S  + +VG NGSGKS ++ ++    G +AS+  R   L
Sbjct: 83  IKKVILRNFMCHEHFEL--ELGSRLNFIVGNNGSGKSAILTAITIGLGAKASETNRGSSL 140

Query: 215 SDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRKAFKNNTSKYYI-- 272
            DLI +        S  + +H +   +   G     T   ++++ R   ++  + + +  
Sbjct: 141 KDLIREG-----CYSAKITLHLD---NSKYGAYQQGTFGNEIIVERTIKRDGPASFSLKS 192

Query: 273 -NGKE 276
            NGKE
Sbjct: 193 ENGKE 197

>Smik_15.131 Chr15 (226115..229396) [3282 bp, 1093 aa] {ON} YOL034W
           (REAL)
          Length = 1093

 Score = 41.2 bits (95), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 42/157 (26%), Positives = 71/157 (45%), Gaps = 16/157 (10%)

Query: 161 LHDFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKM-RQDRLSDLI 218
           L DF +Y  T+  + P   S + ++GPNGSGKS  + ++      +   + R  R+ D I
Sbjct: 47  LQDFVTYTLTEFNLSP---SLNMIIGPNGSGKSTFVCAVCLGLAGKPEYIGRSKRVEDFI 103

Query: 219 HKSENFPDLKSCSVEVHFEYVIDKPDGTTI--INTVKEKLVITRKAFKN-NTSKYYINGK 275
              ++        +E+  +   + P    I  +N   E + ITR   ++   S Y IN  
Sbjct: 104 KNGQDV-----SRIEITLK---NSPKVNDIENVNAHDETIKITRIITRSKRRSDYLINDC 155

Query: 276 ESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMK 312
           E + + V  L+    I LD+    + Q  VE  A++K
Sbjct: 156 EVSESVVKALVAQLNIQLDNLCQFLSQERVEEFARLK 192

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 20/62 (32%), Positives = 35/62 (56%), Gaps = 3/62 (4%)

Query: 1333 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1389
            SGGE+ +S++  + AL ++   P  V+DEI+  +D RN  IV   + E       +Q+ +
Sbjct: 987  SGGERAVSTVLYMIALQEFTSAPFRVVDEINQGMDSRNERIVHKAMVENACAENTSQYFL 1046

Query: 1390 IS 1391
            I+
Sbjct: 1047 IT 1048

>Kpol_1044.13 s1044 complement(23616..26927) [3312 bp, 1103 aa] {ON}
            complement(23616..26927) [3312 nt, 1104 aa]
          Length = 1103

 Score = 41.2 bits (95), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 19/62 (30%), Positives = 34/62 (54%), Gaps = 3/62 (4%)

Query: 1333 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERT---KNAQFIV 1389
            SGGEK +S+   + +L  +   P  V+DEI+  +D RN  I+   + E       +Q+I+
Sbjct: 995  SGGEKAVSTALYIISLQNFTKAPFRVVDEINQGMDSRNEKIIHRIMVENACEDNTSQYIL 1054

Query: 1390 IS 1391
            ++
Sbjct: 1055 VT 1056

 Score = 40.0 bits (92), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 74/162 (45%), Gaps = 16/162 (9%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKM----RQ 211
           I K+ + +F +Y   +       SF+ ++GPNGSGKS V+ ++       ASK+    R 
Sbjct: 51  IIKIKMKNFMTYGLVEY--QLCPSFNMIIGPNGSGKSTVVCALGLGL---ASKLDITGRG 105

Query: 212 DRLSDLIHKSENFPDLKSCSVEVHFEYVIDKPDGTTIINTVKEKLVITRK-AFKNNTSKY 270
           D ++  I   +      S  +E+  +Y  D+      +N  +E + I R+ +     S Y
Sbjct: 106 DIVTQYIQNGKT-----SGKIEITLKYS-DRIKNVKGVNPNRETVTIKREISIDAKKSNY 159

Query: 271 YINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMK 312
            IN    N   V  ++    I LD+    + Q  +++ A++K
Sbjct: 160 KINNTVVNEKDVRDIVSKLNIQLDNLCQYLPQERLKDFARLK 201

>KNAG0B06010 Chr2 (1178430..1181783) [3354 bp, 1117 aa] {ON} Anc_4.237
            YLR383W
          Length = 1117

 Score = 40.8 bits (94), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 3/68 (4%)

Query: 1327 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1384
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N  I    I ++ KN  
Sbjct: 1014 RDVDTLSGGEKSFSQMALLLATWKPMRSRIIALDEFDVFMDQVNRKIGTALIVKKLKNES 1073

Query: 1385 -AQFIVIS 1391
              Q I+I+
Sbjct: 1074 RTQTIIIT 1081

>TDEL0H03490 Chr8 (578645..581956) [3312 bp, 1103 aa] {ON} Anc_7.101
            YOL034W
          Length = 1103

 Score = 40.4 bits (93), Expect = 0.040,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 36/64 (56%), Gaps = 7/64 (10%)

Query: 1333 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN-----VSIVANYIKERTKNAQF 1387
            SGGE+ +S++  + AL +Y   P  ++DEI+  +D  N      S+V N   E T  +Q+
Sbjct: 998  SGGERAVSTVLYMIALQQYTTAPFRIVDEINQGMDSHNERIVHKSMVINACAENT--SQY 1055

Query: 1388 IVIS 1391
             +I+
Sbjct: 1056 FLIT 1059

 Score = 34.7 bits (78), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 69/161 (42%), Gaps = 16/161 (9%)

Query: 158 KLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKM-RQDRLSD 216
           KL + +F +Y   +       S + ++GPNGSGKS  + ++      +   + R  +L D
Sbjct: 48  KLRMENFVTYKVAEF--DLSPSLNMIIGPNGSGKSTFVCAVCIGLAGKPRFIGRSSKLED 105

Query: 217 LIHKSENFPDLKSCSVEVHFEYVIDKP---DGTTIINTVKEKLVITRKAFKNNT-SKYYI 272
            I   E     +   VEV     + KP   + + I+ +  + + ITR   ++   S Y I
Sbjct: 106 FIKNGE-----EKGLVEV----TLKKPAEVEHSPIVKSHDQVIKITRHLSRSKRDSDYQI 156

Query: 273 NGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMKP 313
           N  E   + V  ++    I LD+    + Q  V + A   P
Sbjct: 157 NDIEVPESLVKSIISQLNIQLDNLCQFLSQERVASFAGQSP 197

>TBLA0A05300 Chr1 (1297764..1299887) [2124 bp, 707 aa] {ON} Anc_1.67
            YLR188W
          Length = 707

 Score = 40.4 bits (93), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 29/63 (46%), Positives = 38/63 (60%), Gaps = 5/63 (7%)

Query: 1330 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1389
            T LSGG+K   +LA  F L   +PT L V+DE  +ALD R+ SIVA  +K+R     F  
Sbjct: 600  TQLSGGQKQRVALARAFLL---EPT-LLVLDEATSALDPRSESIVAQTLKQRCAKG-FTT 654

Query: 1390 ISL 1392
            IS+
Sbjct: 655  ISI 657

>KLLA0E05303g Chr5 complement(472583..475879) [3297 bp, 1098 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1098

 Score = 40.0 bits (92), Expect = 0.048,   Method: Compositional matrix adjust.
 Identities = 28/92 (30%), Positives = 46/92 (50%), Gaps = 7/92 (7%)

Query: 1327 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI-----KER 1381
            RN+  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I  N I     K+ 
Sbjct: 997  RNVDTLSGGEKSFSQIALLLATWLTMRSRIIALDEFDVFMDQVNRKIGTNLIIRRLGKDV 1056

Query: 1382 TKNAQFIVISLRN--NMFELAEQLVGIYKSNN 1411
              + Q I+I+ ++   M  + ++   I+K  N
Sbjct: 1057 KSDTQTIIITPQDIGKMANIDDKYFNIHKMKN 1088

>Ecym_2625 Chr2 (1208550..1211843) [3294 bp, 1097 aa] {ON} similar to
            Ashbya gossypii AEL337
          Length = 1097

 Score = 39.7 bits (91), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 33/120 (27%), Positives = 61/120 (50%), Gaps = 18/120 (15%)

Query: 1283 ISITLKEMYQMITMGGNAELELVDSLDPFSEGVTFSVMPPKKSWRNITNL--------SG 1334
            IS   ++++  + +G   E+ LV   D +SE      +  K  +R++  L        SG
Sbjct: 941  ISTRFRKLF--LNVGSAGEVCLVKP-DLYSEWK----IEIKVKFRDVAELKKLDSHIQSG 993

Query: 1335 GEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKER--TKN-AQFIVIS 1391
            GE+ +S++  + +L ++   P  V+DEI+  +D RN  IV   + E    KN +Q+ +I+
Sbjct: 994  GERAVSTVLYMISLQEFTNAPFRVVDEINQGMDARNERIVHKAMVENACAKNTSQYFLIT 1053

 Score = 39.3 bits (90), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 44/164 (26%), Positives = 73/164 (44%), Gaps = 18/164 (10%)

Query: 155 CIDKLVLHDFKSYAGTQVVGPFH--SSFSAVVGPNGSGKSNVIDSMLFVFGFRASKMRQD 212
            I KL L +F +Y+ T+    FH   S + ++GPNGSGKS+ + ++      +   + + 
Sbjct: 45  AIIKLRLVNFVTYSLTE----FHLSPSLNMIIGPNGSGKSSFVCAICLGLAGKPEYIGRA 100

Query: 213 RLSDLIHKSENFPDLKSCSVEVHFEYVIDKP---DGTTIINTVKEKLVITRKAFK-NNTS 268
           +      K E+F  +K+ + E   E  +       G ++I    E + I     K     
Sbjct: 101 K------KVEDF--IKNGTEESVIELTVKNSKAVSGYSMIGGSDEVINIKTVIMKAKKKC 152

Query: 269 KYYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMK 312
            YYING+      V  L+    I LD+    + Q  VE  A++K
Sbjct: 153 IYYINGQSVGENQVKALVCLLNIQLDNLCQFLSQERVEEFARLK 196

>KLTH0D14080g Chr4 (1149555..1152863) [3309 bp, 1102 aa] {ON} similar
            to uniprot|Q12749 Saccharomyces cerevisiae YLR383W RHC18
            Protein involved in structural maintenance of chromosomes
            required for interchromosomal and sister chromatid
            recombination
          Length = 1102

 Score = 39.3 bits (90), Expect = 0.083,   Method: Compositional matrix adjust.
 Identities = 72/312 (23%), Positives = 126/312 (40%), Gaps = 66/312 (21%)

Query: 1127 QELDNGNIDQDEEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSP------DANN 1180
            +ELD   I+Q E D  +  NA+   A+ +L   E  E ++I   +  V P       ANN
Sbjct: 748  RELDTSAIEQAESDKQVYVNAL---ASYNLALDEVNEKIDIIRQK--VQPLKVRYEQANN 802

Query: 1181 DL---EMEIDEDNNEISKGIPRISEDE----FKNVDVEELEAQKLQL----QDYIDTVNV 1229
            +L      +D+  + ISKG  RI + +    F    VE+ + ++ +L     ++ D +  
Sbjct: 803  ELNSAACALDDLKHIISKGSSRIEKLQDDIGFSEKKVEKYQQKRTELLQKINEFSDGIGT 862

Query: 1230 NIDVLEEYARRVAEY-------------------KRRKLDLNNAVDEREKVRELLDKLKK 1270
             I   E Y  R   +                    R +L  N     ++++  L +   K
Sbjct: 863  QISNAETYCTRAVAFAGDMPETREDTKAEIDRITHRIQLAENRVGLSQDQIMSLFES-AK 921

Query: 1271 TRFEEFMQGFGVISI-------TLKEMYQMITMGGN-----AELELVDSLD--PFSEGVT 1316
             ++++  Q F  +         +LK  +Q +T         A+ +  +SL    FS G+ 
Sbjct: 922  LKYKDAEQKFANVDKAVFQLNESLKRRWQSLTYAKTDTCVTADTDFKESLRFRNFSGGLN 981

Query: 1317 FSV----------MPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAAL 1366
            F+            P  +  RN+   SGGEK+ S ++L+ A  +   + +  +DE D  +
Sbjct: 982  FNFSKETLNMLVKTPNDEKPRNVDTFSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFM 1041

Query: 1367 DFRNVSIVANYI 1378
            D  N  I    I
Sbjct: 1042 DQVNRQIGTKLI 1053

>TBLA0I02890 Chr9 (683688..686984) [3297 bp, 1098 aa] {ON} Anc_4.237
            YLR383W
          Length = 1098

 Score = 39.3 bits (90), Expect = 0.094,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 3/71 (4%)

Query: 1324 KSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTK 1383
            K  RN+  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N       I ++ K
Sbjct: 995  KEPRNVDTLSGGEKSFSQIALLLATWKPMRSRIIALDEYDVFMDQVNRKTSTQLIVQKLK 1054

Query: 1384 N---AQFIVIS 1391
            +    Q I+I+
Sbjct: 1055 DDSRTQTIIIT 1065

>Kpol_483.10 s483 (21646..25002) [3357 bp, 1118 aa] {ON}
           (21646..25002) [3357 nt, 1119 aa]
          Length = 1118

 Score = 38.9 bits (89), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 25/83 (30%), Positives = 42/83 (50%), Gaps = 8/83 (9%)

Query: 156 IDKLVLHDFKSYAGTQVVGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKM-RQDRL 214
           I K++L +F  +    V      + + +VG NGSGKS ++ +++   G +AS+  R   L
Sbjct: 73  IRKVILRNFMCHENFSV--ELTPNLNFIVGNNGSGKSAILTAIIVALGVKASETSRGSSL 130

Query: 215 SDLIHKSENFPDLKSCSVEVHFE 237
            +LI K  N     S  V +H +
Sbjct: 131 KELIRKGCN-----SSKVTLHLD 148

 Score = 37.7 bits (86), Expect = 0.29,   Method: Compositional matrix adjust.
 Identities = 17/47 (36%), Positives = 28/47 (59%)

Query: 1327 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSI 1373
            R++  LSGGEK+ S +AL+ A  K   + +  +DE D  +D  N ++
Sbjct: 1018 RSVDTLSGGEKSFSQMALLLATWKPMKSRIIALDEFDVFMDQVNRTV 1064

>AEL337C Chr5 complement(14613..17906) [3294 bp, 1097 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL034W
           (SMC5)
          Length = 1097

 Score = 37.7 bits (86), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 40/165 (24%), Positives = 69/165 (41%), Gaps = 20/165 (12%)

Query: 155 CIDKLVLHDFKSYAGTQVVGPFH--SSFSAVVGPNGSGKSNVIDSMLFVFGFRASKM-RQ 211
            I  + L +F +Y+    +  FH   S + ++GPNGSGKS  + ++      +   + R 
Sbjct: 45  AIVSIRLTNFVTYS----LAEFHMSPSLNMIIGPNGSGKSTFVCAICLGLAGKPEYIGRA 100

Query: 212 DRLSDLIHKSENFPDLKSCSVEVHFEYVIDKP---DGTTIINTVKEKLVITRKAFK-NNT 267
            R+ D I         K+ + E   E  +       G  +I+   E + +     K    
Sbjct: 101 KRVEDFI---------KNGTAESTIEIQLRNSRNVSGLPMISAEDEAINVRTVLMKARRK 151

Query: 268 SKYYINGKESNYTSVTKLLKDEGIDLDHNRFLILQGEVENIAQMK 312
             YYING+  +   +  L+    I LD+    + Q  VE  A++K
Sbjct: 152 CAYYINGEPVSENQMRALVSMLNIQLDNLCQFLSQERVEEFARLK 196

 Score = 37.7 bits (86), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 34/69 (49%), Gaps = 5/69 (7%)

Query: 1333 SGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFR-----NVSIVANYIKERTKNAQF 1387
            SGGE+ +S++  + AL  +   P  V+DEI+  +D R     + ++V N   E T     
Sbjct: 992  SGGERAVSTVLYMIALQHFTNAPFRVVDEINQGMDTRYERIVHKAMVENACAENTSQYFL 1051

Query: 1388 IVISLRNNM 1396
            I   L  N+
Sbjct: 1052 ITPKLLTNL 1060

>SAKL0H03322g Chr8 complement(314365..317700) [3336 bp, 1111 aa] {ON}
            similar to uniprot|Q12749 Saccharomyces cerevisiae
            YLR383W RHC18 Protein involved in structural maintenance
            of chromosomes required for interchromosomal and sister
            chromatid recombination
          Length = 1111

 Score = 37.7 bits (86), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 29/52 (55%)

Query: 1327 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1378
            RN+  LSGGEK+ S ++L+ A  +   + +  +DE D  +D  N +I    I
Sbjct: 1010 RNVDTLSGGEKSFSQISLLLATWRPMRSRIIALDEFDVFMDQVNRTIGTKLI 1061

>Kwal_26.9380 s26 (1189521..1192829) [3309 bp, 1102 aa] {ON} YLR383W
            (RHC18) - involved in recombination repair [contig 72]
            FULL
          Length = 1102

 Score = 37.4 bits (85), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 26/85 (30%), Positives = 42/85 (49%), Gaps = 6/85 (7%)

Query: 1311 FSEG-VTFSVMPPKKSW-RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDF 1368
            FS+G +T  V  P     RN+  LSGGEK+ S  +L+ A  +   + +  +DE D  +D 
Sbjct: 984  FSKGALTMLVKTPNDDQPRNVDTLSGGEKSFSQTSLLLATWRPMRSRIIALDEFDVFMDQ 1043

Query: 1369 RNVSI----VANYIKERTKNAQFIV 1389
             N  I    + N + + T+    I+
Sbjct: 1044 VNRQIGTKLIMNKLSKETRTQTIII 1068

>TDEL0G02810 Chr7 (540540..543824) [3285 bp, 1094 aa] {ON} Anc_2.351
            YDL102W
          Length = 1094

 Score = 37.4 bits (85), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 37/71 (52%), Gaps = 9/71 (12%)

Query: 1355 PLYVMD---EIDAALDFRN------VSIVANYIKERTKNAQFIVISLRNNMFELAEQLVG 1405
            PLYV++   +ID+     N      +SI+A  I E+  NA F+V S++ N  E+   L+G
Sbjct: 939  PLYVLEHNIQIDSRYYLTNQLQNPLISIIAPIIGEKQANAMFVVKSIKINTGEMKGGLMG 998

Query: 1406 IYKSNNQTKSA 1416
              K  +  KS 
Sbjct: 999  FIKKVDSCKSC 1009

>Ecym_5344 Chr5 (696147..699455) [3309 bp, 1102 aa] {ON} similar to
           Ashbya gossypii AER044W
          Length = 1102

 Score = 37.4 bits (85), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 38/74 (51%), Gaps = 5/74 (6%)

Query: 156 IDKLVLHDFKSYAGTQV-VGPFHSSFSAVVGPNGSGKSNVIDSMLFVFGFRASKM-RQDR 213
           I ++ L +F  +   ++  GP     + +VG NGSGKS ++ ++  VFG +AS   R   
Sbjct: 62  IKRITLKNFMCHEHFELEFGPM---LNFIVGSNGSGKSAILTAITIVFGAKASDTNRGTS 118

Query: 214 LSDLIHKSENFPDL 227
           L  LI +  N   +
Sbjct: 119 LKSLIREGCNIAKI 132

 Score = 34.3 bits (77), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 20/68 (29%), Positives = 34/68 (50%), Gaps = 3/68 (4%)

Query: 1327 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1384
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I ++  +  
Sbjct: 1001 RNVDTLSGGEKSFSQITLLLSTWSTMRARVIALDEFDVFMDQVNRTIGTKMIMKKLSSNI 1060

Query: 1385 -AQFIVIS 1391
              Q I+I+
Sbjct: 1061 RTQTIIIT 1068

>NCAS0B08700 Chr2 (1674262..1676409) [2148 bp, 715 aa] {ON} Anc_1.67
          Length = 715

 Score = 37.0 bits (84), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 28/72 (38%), Positives = 36/72 (50%), Gaps = 10/72 (13%)

Query: 1311 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1370
            F EGV   V P        T LSGG+K   +LA  F LH      L ++DE  +ALD ++
Sbjct: 572  FPEGVNTLVGPRG------TQLSGGQKQRIALARAFLLHP----ALLILDEATSALDSQS 621

Query: 1371 VSIVANYIKERT 1382
              IVA  + ER 
Sbjct: 622  EEIVAKNLSERV 633

>KAFR0A06040 Chr1 complement(1222239..1225547) [3309 bp, 1102 aa] {ON}
            Anc_4.237 YLR383W
          Length = 1102

 Score = 36.2 bits (82), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 22/68 (32%), Positives = 35/68 (51%), Gaps = 3/68 (4%)

Query: 1327 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKN-- 1384
            R++  LSGGEK+ S +AL+ A      + +  +DE D  +D  N  I    I +  K+  
Sbjct: 1002 RDVDTLSGGEKSFSQMALLLATWAPMRSRITALDEFDVFMDQVNRKIGTGLIVKTLKDNA 1061

Query: 1385 -AQFIVIS 1391
              Q I+I+
Sbjct: 1062 RTQTIIIT 1069

>AER044W Chr5 (714355..717666) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR383W (RHC18)
          Length = 1103

 Score = 34.7 bits (78), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 17/52 (32%), Positives = 26/52 (50%)

Query: 1327 RNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYI 1378
            RN+  LSGGEK+ S + L+ +        +  +DE D  +D  N +I    I
Sbjct: 1002 RNVDTLSGGEKSFSQITLLLSTWSTMRARIIALDEFDVFMDQVNRTIGTRMI 1053

>AFR683C Chr6 complement(1697786..1699819) [2034 bp, 677 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR188W
            (MDL1)
          Length = 677

 Score = 34.3 bits (77), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 30/110 (27%), Positives = 57/110 (51%), Gaps = 11/110 (10%)

Query: 1311 FSEGVTFSVMPPKKSWRNITNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRN 1370
            F EG+  +V P        T LSGG+K   +LA  F     +   + ++DE  +ALD ++
Sbjct: 555  FPEGLQTAVGPRG------TQLSGGQKQRVALARAF----LQDPAILILDEATSALDSKS 604

Query: 1371 VSIVANYIKERTKNAQF-IVISLRNNMFELAEQLVGIYKSNNQTKSATLQ 1419
              IVA+ + +R + A+  I I+ R +  + + +++ + K  +  ++ T Q
Sbjct: 605  EDIVASTLLQRCQEAKITISIAHRKSTIQHSTRVIVLDKLGHVLETGTYQ 654

>NCAS0E01930 Chr5 complement(372023..375166) [3144 bp, 1047 aa] {ON}
            Anc_7.185
          Length = 1047

 Score = 33.9 bits (76), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 17/48 (35%), Positives = 26/48 (54%)

Query: 241  DKPDGTTIINTVKEKLVITRKAFKNNTSKYYINGKESNYTSVTKLLKD 288
            D+P    I + +KE LV  +KAF +N   +Y+ G       +TK L+D
Sbjct: 967  DQPQKIYIQDRIKESLVDLKKAFIDNNGSFYLCGPTWPVPDITKALQD 1014

>Ecym_1072 Chr1 (137296..139347) [2052 bp, 683 aa] {ON} similar to
            Ashbya gossypii AFR683C
          Length = 683

 Score = 33.9 bits (76), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 30/97 (30%), Positives = 52/97 (53%), Gaps = 5/97 (5%)

Query: 1330 TNLSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIV 1389
            T LSGG+K   ++A  F L    P+ L ++DE  +ALD ++  I+A  ++ R+++ + I 
Sbjct: 567  TQLSGGQKQRIAIARAFIL---DPSIL-ILDEATSALDSQSEDIIAQALRARSESGK-IT 621

Query: 1390 ISLRNNMFELAEQLVGIYKSNNQTKSATLQNNDIINR 1426
            IS+ + +  +      I  S N   S T    D+IN+
Sbjct: 622  ISIAHRISTIEHSNRVIVLSRNGGVSETGAFCDLINQ 658

>AER045C Chr5 complement(717771..721649) [3879 bp, 1292 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL058W
           (USO1)
          Length = 1292

 Score = 33.5 bits (75), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 30/119 (25%), Positives = 58/119 (48%), Gaps = 5/119 (4%)

Query: 419 EEFEETKKKHSTTEIQMNEISKS----YHEMLKNIKASQEQEKKLNIQKRNYDTERVSLE 474
           E FEE +++ +T   ++ E+S S     H++  +++  QEQ K+L   K+  DT+   L+
Sbjct: 694 EAFEELQQRFTTVNKELCELSSSSMEEIHKLELDLRKCQEQYKQLMKAKQESDTQVSDLD 753

Query: 475 EQRKNIXXXXXXXXXXLEDCNKTISNTKIKIEDLGKNESEYESQLDEL-NAQLQIERGL 532
           E+   +          +ED +   +  +    D  K  + +E Q++ L N   Q+E+ L
Sbjct: 754 EKLAQLKTQLDEANSKVEDLSTKKTTLEAAKADCLKKLASHEGQVNSLKNRTTQLEKQL 812

>YNL250W Chr14 (175410..179348) [3939 bp, 1312 aa] {ON}  RAD50Subunit
            of MRX complex, with Mre11p and Xrs2p, involved in
            processing double-strand DNA breaks in vegetative cells,
            initiation of meiotic DSBs, telomere maintenance, and
            nonhomologous end joining
          Length = 1312

 Score = 33.5 bits (75), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 46/92 (50%), Gaps = 6/92 (6%)

Query: 1181 DLEMEIDEDNNEISKGIPRISEDEFKNVDVEELEAQKLQLQDYIDTVNVNIDVLEEYARR 1240
            DL+ME DE   E S+ I  I E E    ++E    QK  + D I +   NI+ ++    R
Sbjct: 856  DLQMEKDEKVRENSRMINLIKEKELTVSEIESSLTQKQNIDDSIRSKRENINDIDS---R 912

Query: 1241 VAEYKRRKLDLNNAVDEREKVRELLDKLKKTR 1272
            V E + R + L N  DE + V   LDK+K  R
Sbjct: 913  VKELEARIISLKNKKDEAQSV---LDKVKNER 941

>ZYRO0G14674g Chr7 (1176171..1177445) [1275 bp, 424 aa] {ON} similar
           to uniprot|P40088 Saccharomyces cerevisiae YER145C FTR1
           High affinity iron permease involved in the transport of
           iron across the plasma membrane forms complex with Fet3p
           expression is regulated by iron
          Length = 424

 Score = 33.1 bits (74), Expect = 5.8,   Method: Composition-based stats.
 Identities = 20/61 (32%), Positives = 36/61 (59%), Gaps = 7/61 (11%)

Query: 421 FEETKKKHSTTEIQMNEISKSYHEMLKNIKA---SQEQEKKL--NIQKRNYDTERVSLEE 475
           FEE K     T++QM +++  YH  +KN K    ++EQE++L   ++   YD ER  +++
Sbjct: 316 FEEKKGHLPFTKLQMRQLNPGYH--IKNKKKDELTKEQEQELFAKLEGLRYDKERGIIQD 373

Query: 476 Q 476
           +
Sbjct: 374 E 374

>Ecym_1076 Chr1 (147216..147420,147509..147987) [684 bp, 227 aa]
           {ON} similar to Ashbya gossypii AFR679C, 1-intron
          Length = 227

 Score = 32.7 bits (73), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 21/74 (28%), Positives = 43/74 (58%)

Query: 404 NKKLSTTLEKLSNIKEEFEETKKKHSTTEIQMNEISKSYHEMLKNIKASQEQEKKLNIQK 463
           N++ ST L+ L + KE+ E  + K  +   Q+N++ +   E+ + I++ QEQ ++ N + 
Sbjct: 25  NEQRSTLLQLLDSYKEDVENYRIKKDSINSQLNQLVEEERELTQEIRSIQEQTQQTNSKM 84

Query: 464 RNYDTERVSLEEQR 477
             Y+ ++  L E+R
Sbjct: 85  EAYEIKKQQLTEER 98

>ACR068W Chr3 (480141..485558) [5418 bp, 1805 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR023W (MYO1)
          Length = 1805

 Score = 33.5 bits (75), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 29/112 (25%), Positives = 65/112 (58%), Gaps = 11/112 (9%)

Query: 867 IANETFTEMETELRRLKDRKPDVELEISKFELEITSWVTEHELMQQQLNEKQQSLDECMS 926
           I NE + +++ EL++LK+ +     +I + E E ++       +Q+Q++  ++ +D   S
Sbjct: 889 INNEEYQKLQKELQQLKESREQSNTKIKELEREKSN-------LQKQIDSMKRQVD---S 938

Query: 927 NNEELSTMEHELGTLQNDYKSLQLETKSKKDRIKFLKDEIMKVG-GIKLQVQ 977
           + ++   M+ +   L++  + L+LE KSK+ R+K L+ ++   G  +KL++Q
Sbjct: 939 STKQAMAMKADKSDLESQLRKLKLELKSKEKRVKELEQKVDNSGEDLKLKLQ 990

>TPHA0A01550 Chr1 (310086..311321) [1236 bp, 411 aa] {ON} Anc_8.325
            YLR130C
          Length = 411

 Score = 32.7 bits (73), Expect = 6.4,   Method: Composition-based stats.
 Identities = 24/87 (27%), Positives = 41/87 (47%), Gaps = 5/87 (5%)

Query: 1121 DITHTLQELDNGNIDQDEEDVSMKDNAVSVSANNSLGNSENMEGVEIETNESDVSPDANN 1180
            D ++T   +D+   D  + DV    N  S   N+ L   +N +  +IE N  +VS +  N
Sbjct: 145  DTSYTASSIDDKEADSIDADVRKDANDDSYDINSILNFDKNKD-YDIEANHYEVSMEDRN 203

Query: 1181 DLEMEIDEDNNEISKGIPRISEDEFKN 1207
            + +M    DN +IS+      +D F +
Sbjct: 204  NTKM----DNYKISQTKSTPGQDHFSH 226

>ZYRO0F17050g Chr6 complement(1417445..1419589) [2145 bp, 714 aa] {ON}
            similar to uniprot|P33310 Saccharomyces cerevisiae
            YLR188W MDL1 Half-type ATP-binding cassette (ABC)
            transporter of the inner mitochondrial membrane mediates
            export of peptides generated upon proteolysis of
            mitochondrial proteins plays a role in the regulation of
            cellular resistance to oxidative stress
          Length = 714

 Score = 32.7 bits (73), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 37/70 (52%), Gaps = 5/70 (7%)

Query: 1332 LSGGEKTLSSLALVFALHKYKPTPLYVMDEIDAALDFRNVSIVANYIKERTKNAQFIVIS 1391
            LSGG+K   +LA  F L       L V+DE  +ALD ++  IVA  ++ER +      IS
Sbjct: 590  LSGGQKQRVALARAFLLDP----ALLVLDEATSALDSQSEEIVARTLQERVRRG-LTTIS 644

Query: 1392 LRNNMFELAE 1401
            + + +  +A 
Sbjct: 645  IAHRISTIAH 654

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.129    0.345 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 140,801,818
Number of extensions: 6281139
Number of successful extensions: 42947
Number of sequences better than 10.0: 1274
Number of HSP's gapped: 42350
Number of HSP's successfully gapped: 2637
Length of query: 1427
Length of database: 53,481,399
Length adjustment: 122
Effective length of query: 1305
Effective length of database: 39,492,147
Effective search space: 51537251835
Effective search space used: 51537251835
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 72 (32.3 bits)