Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_392.78.260ON29952995151510.0
YLR087C (CSF1)8.260ON2958302669800.0
Smik_12.1468.260ON2958302469600.0
Skud_12.1558.260ON2959303069260.0
Suva_10.1718.260ON2958302668720.0
NCAS0B050108.260ON2952301667940.0
KAFR0B027208.260ON2982304766360.0
TDEL0F038708.260ON2942302766090.0
NDAI0B019808.260ON2959302066030.0
CAGL0L12210g8.260ON2981305264390.0
TPHA0J007308.260ON3046310164280.0
KNAG0G020308.260ON2998306363000.0
ZYRO0C01694g8.260ON3006306860930.0
TBLA0E044208.260ON3148260456510.0
SAKL0H17072g8.260ON2997307951050.0
KLTH0G13728g8.260ON2966307544510.0
Kwal_YGOB_56.238088.260ON2941306842270.0
Kwal_56.23810singletonOFF2763284939200.0
Ecym_43108.260ON2943157122360.0
KLLA0F19096g8.260ON2923127019470.0
AGR088W8.260ON2887154419090.0
Kwal_56.23808singletonOFF62621275e-08
KLLA0C04862g6.86ON631126831.2
SAKL0D07480g1.344ON659162793.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_392.7
         (2995 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..1...  5840   0.0  
YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}...  2693   0.0  
Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] ...  2685   0.0  
Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] ...  2672   0.0  
Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] ...  2651   0.0  
NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {...  2621   0.0  
KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {...  2560   0.0  
TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {...  2550   0.0  
NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {...  2548   0.0  
CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 a...  2484   0.0  
TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] ...  2480   0.0  
KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {...  2431   0.0  
ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} simil...  2351   0.0  
TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa]...  2181   0.0  
SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} sim...  1971   0.0  
KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} sim...  1719   0.0  
Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp,...  1632   0.0  
Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR0...  1514   0.0  
Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar ...   865   0.0  
KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa...   754   0.0  
AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic h...   739   0.0  
Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C...    54   5e-08
KLLA0C04862g Chr3 (442167..444062) [1896 bp, 631 aa] {ON} highly...    37   1.2  
SAKL0D07480g Chr4 complement(615534..617513) [1980 bp, 659 aa] {...    35   3.7  

>Kpol_392.7 s392 (10369..19356) [8988 bp, 2995 aa] {ON} (10369..19356)
            [8988 nt, 2996 aa]
          Length = 2995

 Score = 5840 bits (15151), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 2873/2995 (95%), Positives = 2873/2995 (95%)

Query: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60
            MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY
Sbjct: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60

Query: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120
            KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS
Sbjct: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120

Query: 121  SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS 180
            SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS
Sbjct: 121  SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS 180

Query: 181  FLNEHDLGDIVSEDTNVNSMDKDYFXXXXXXXXXXXXXINDRTYKKNKDERKSILFNFLP 240
            FLNEHDLGDIVSEDTNVNSMDKDYF             INDRTYKKNKDERKSILFNFLP
Sbjct: 181  FLNEHDLGDIVSEDTNVNSMDKDYFESVTTENSSESTVINDRTYKKNKDERKSILFNFLP 240

Query: 241  IQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNISVK 300
            IQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNISVK
Sbjct: 241  IQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNISVK 300

Query: 301  PNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESMFVNK 360
            PNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESMFVNK
Sbjct: 301  PNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESMFVNK 360

Query: 361  WRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVPHGAH 420
            WRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVPHGAH
Sbjct: 361  WRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVPHGAH 420

Query: 421  QTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQIPIK 480
            QTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQIPIK
Sbjct: 421  QTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQIPIK 480

Query: 481  KLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDFNLN 540
            KLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDFNLN
Sbjct: 481  KLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDFNLN 540

Query: 541  KGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLGWNS 600
            KGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLGWNS
Sbjct: 541  KGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLGWNS 600

Query: 601  QADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGYSIY 660
            QADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGYSIY
Sbjct: 601  QADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGYSIY 660

Query: 661  LNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRLLLN 720
            LNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRLLLN
Sbjct: 661  LNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRLLLN 720

Query: 721  TPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYGVVI 780
            TPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYGVVI
Sbjct: 721  TPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYGVVI 780

Query: 781  RYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGSFXXXXXXXXXXXXXXXXXLY 840
            RYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGSF                 LY
Sbjct: 781  RYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGSFTYSTTSSVQNSSSDDTVLY 840

Query: 841  TKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLFSELMISF 900
            TKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLFSELMISF
Sbjct: 841  TKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLFSELMISF 900

Query: 901  RGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDVTIHAHRMFGL 960
            RGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDVTIHAHRMFGL
Sbjct: 901  RGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDVTIHAHRMFGL 960

Query: 961  PPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVESSDDMTL 1020
            PPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVESSDDMTL
Sbjct: 961  PPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVESSDDMTL 1020

Query: 1021 LTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFSISIFDVRN 1080
            LTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFSISIFDVRN
Sbjct: 1021 LTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFSISIFDVRN 1080

Query: 1081 PTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPTMYQESFLY 1140
            PTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPTMYQESFLY
Sbjct: 1081 PTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPTMYQESFLY 1140

Query: 1141 NELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLENPFLNIRSINNLDTSSLFN 1200
            NELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLENPFLNIRSINNLDTSSLFN
Sbjct: 1141 NELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLENPFLNIRSINNLDTSSLFN 1200

Query: 1201 EYRVDTYISEKAIFKAEEKNTVNYDPKYEYDNYILNVEYIRVDINPLFSDFIDSMSTKLY 1260
            EYRVDTYISEKAIFKAEEKNTVNYDPKYEYDNYILNVEYIRVDINPLFSDFIDSMSTKLY
Sbjct: 1201 EYRVDTYISEKAIFKAEEKNTVNYDPKYEYDNYILNVEYIRVDINPLFSDFIDSMSTKLY 1260

Query: 1261 SENXXXXXXXXXXXXXXXLGSPKKVLLRETNLKLKISYVDIFWGSRNSEGIEIYLDKLDF 1320
            SEN               LGSPKKVLLRETNLKLKISYVDIFWGSRNSEGIEIYLDKLDF
Sbjct: 1261 SENMVDIIDEIEMIIVRRLGSPKKVLLRETNLKLKISYVDIFWGSRNSEGIEIYLDKLDF 1320

Query: 1321 EMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEIEYERPPALSLTVEGLEVWSCT 1380
            EMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEIEYERPPALSLTVEGLEVWSCT
Sbjct: 1321 EMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEIEYERPPALSLTVEGLEVWSCT 1380

Query: 1381 NTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGSVDLLQKRDVTLQKSLISK 1440
            NTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGSVDLLQKRDVTLQKSLISK
Sbjct: 1381 NTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGSVDLLQKRDVTLQKSLISK 1440

Query: 1441 LTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLRHILNYLPEGWEKSSIA 1500
            LTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLRHILNYLPEGWEKSSIA
Sbjct: 1441 LTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLRHILNYLPEGWEKSSIA 1500

Query: 1501 FVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFLPDIEKNLINNTTKIGME 1560
            FVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFLPDIEKNLINNTTKIGME
Sbjct: 1501 FVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFLPDIEKNLINNTTKIGME 1560

Query: 1561 SFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPKAATANKNDKIYDITGTVGTFKGEL 1620
            SFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPKAATANKNDKIYDITGTVGTFKGEL
Sbjct: 1561 SFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPKAATANKNDKIYDITGTVGTFKGEL 1620

Query: 1621 GDQLIRLKKLYSEDKAKIRSEKSTDFSIPKFFKINIVLIVEKGELTLAAANTKLISRIKN 1680
            GDQLIRLKKLYSEDKAKIRSEKSTDFSIPKFFKINIVLIVEKGELTLAAANTKLISRIKN
Sbjct: 1621 GDQLIRLKKLYSEDKAKIRSEKSTDFSIPKFFKINIVLIVEKGELTLAAANTKLISRIKN 1680

Query: 1681 GKISGFFENARDVANASGSIVYYATRTELWLKHNELILLDAHLDDLFISVIAELLVKKPT 1740
            GKISGFFENARDVANASGSIVYYATRTELWLKHNELILLDAHLDDLFISVIAELLVKKPT
Sbjct: 1681 GKISGFFENARDVANASGSIVYYATRTELWLKHNELILLDAHLDDLFISVIAELLVKKPT 1740

Query: 1741 ILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRLTDKDNKKRHTSTSPIFSTKKX 1800
            ILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRLTDKDNKKRHTSTSPIFSTKK 
Sbjct: 1741 ILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRLTDKDNKKRHTSTSPIFSTKKI 1800

Query: 1801 XXXXXXXXXXXXXXXVILSPFTVKHSMKELKIVFNREGDNDTIFSILDADLYLTSYQNGV 1860
                           VILSPFTVKHSMKELKIVFNREGDNDTIFSILDADLYLTSYQNGV
Sbjct: 1801 DISFDINIFDISSEIVILSPFTVKHSMKELKIVFNREGDNDTIFSILDADLYLTSYQNGV 1860

Query: 1861 QYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKLTLADPKKITNSLLQDEKTFEQSLES 1920
            QYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKLTLADPKKITNSLLQDEKTFEQSLES
Sbjct: 1861 QYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKLTLADPKKITNSLLQDEKTFEQSLES 1920

Query: 1921 IKTLNTLFSSNREVRTSAVDNPYKFMVNFDLTYFGLLFPVDTSYFILELHSLLATFSNVY 1980
            IKTLNTLFSSNREVRTSAVDNPYKFMVNFDLTYFGLLFPVDTSYFILELHSLLATFSNVY
Sbjct: 1921 IKTLNTLFSSNREVRTSAVDNPYKFMVNFDLTYFGLLFPVDTSYFILELHSLLATFSNVY 1980

Query: 1981 MNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSKVLDFSVNLSTETKILNSKRSFEVESS 2040
            MNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSKVLDFSVNLSTETKILNSKRSFEVESS
Sbjct: 1981 MNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSKVLDFSVNLSTETKILNSKRSFEVESS 2040

Query: 2041 HFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQIFKTKKKASVVSENLIGAPLIEYSI 2100
            HFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQIFKTKKKASVVSENLIGAPLIEYSI
Sbjct: 2041 HFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQIFKTKKKASVVSENLIGAPLIEYSI 2100

Query: 2101 HFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAYEDSYGKLTVVDGFFSIANGFSSDTFY 2160
            HFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAYEDSYGKLTVVDGFFSIANGFSSDTFY
Sbjct: 2101 HFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAYEDSYGKLTVVDGFFSIANGFSSDTFY 2160

Query: 2161 SQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYGETIDVRFLSNFATIINLTIESV 2220
            SQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYGETIDVRFLSNFATIINLTIESV
Sbjct: 2161 SQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYGETIDVRFLSNFATIINLTIESV 2220

Query: 2221 QHFQMIKKETVREMNVEAEKKVGEDDISTKFSLFFSKVQRINCQCIYDGGVFTVYPVRGN 2280
            QHFQMIKKETVREMNVEAEKKVGEDDISTKFSLFFSKVQRINCQCIYDGGVFTVYPVRGN
Sbjct: 2221 QHFQMIKKETVREMNVEAEKKVGEDDISTKFSLFFSKVQRINCQCIYDGGVFTVYPVRGN 2280

Query: 2281 HIDTEHAIEITTPKVIIDVDYKYRIDMKKPHWIRSFINIEPTYNTLLSQFASFLTEFGES 2340
            HIDTEHAIEITTPKVIIDVDYKYRIDMKKPHWIRSFINIEPTYNTLLSQFASFLTEFGES
Sbjct: 2281 HIDTEHAIEITTPKVIIDVDYKYRIDMKKPHWIRSFINIEPTYNTLLSQFASFLTEFGES 2340

Query: 2341 VHEMVAKFSPKEQPPAPKTVSPPIDYKRILEDFDVSFSISAGKQKVSLSCEPVAKVHANV 2400
            VHEMVAKFSPKEQPPAPKTVSPPIDYKRILEDFDVSFSISAGKQKVSLSCEPVAKVHANV
Sbjct: 2341 VHEMVAKFSPKEQPPAPKTVSPPIDYKRILEDFDVSFSISAGKQKVSLSCEPVAKVHANV 2400

Query: 2401 GFESFVFSIITNDDDPTEPLSCSLTVNDIKTSINHEFSTEPTASFSVDFVDITTLFTHPD 2460
            GFESFVFSIITNDDDPTEPLSCSLTVNDIKTSINHEFSTEPTASFSVDFVDITTLFTHPD
Sbjct: 2401 GFESFVFSIITNDDDPTEPLSCSLTVNDIKTSINHEFSTEPTASFSVDFVDITTLFTHPD 2460

Query: 2461 IYGTTLISDVSLYFNIKQLQNLMVFLDIWNLKRLIKLRPQKSVPVKKPEXXXXXXXXXXX 2520
            IYGTTLISDVSLYFNIKQLQNLMVFLDIWNLKRLIKLRPQKSVPVKKPE           
Sbjct: 2461 IYGTTLISDVSLYFNIKQLQNLMVFLDIWNLKRLIKLRPQKSVPVKKPESRVSSSTKSSS 2520

Query: 2521 XXXIIPWSFTVIITDINGDIHXXXXXXXXXXXXXXXWISTNHFQDRRKALRFFTDSLSLT 2580
               IIPWSFTVIITDINGDIH               WISTNHFQDRRKALRFFTDSLSLT
Sbjct: 2521 NTTIIPWSFTVIITDINGDIHLGPSLGNLSLKLKKNWISTNHFQDRRKALRFFTDSLSLT 2580

Query: 2581 SVGRLGGLIDVANISWILNVRYVENEKLDQSPLVDITLNVENVAVKAAFDYHMFLIGRVH 2640
            SVGRLGGLIDVANISWILNVRYVENEKLDQSPLVDITLNVENVAVKAAFDYHMFLIGRVH
Sbjct: 2581 SVGRLGGLIDVANISWILNVRYVENEKLDQSPLVDITLNVENVAVKAAFDYHMFLIGRVH 2640

Query: 2641 NILFNLESEKDLIGNLPDLLKLHLVCDEIDICSTALVASNILDISNTISRTRQDSRNSYI 2700
            NILFNLESEKDLIGNLPDLLKLHLVCDEIDICSTALVASNILDISNTISRTRQDSRNSYI
Sbjct: 2641 NILFNLESEKDLIGNLPDLLKLHLVCDEIDICSTALVASNILDISNTISRTRQDSRNSYI 2700

Query: 2701 ETLLESNPPPQKSSISYTDILKSLNLLRTDVGIEIHKMQVQISPISLFDVEVIVTTVENV 2760
            ETLLESNPPPQKSSISYTDILKSLNLLRTDVGIEIHKMQVQISPISLFDVEVIVTTVENV
Sbjct: 2701 ETLLESNPPPQKSSISYTDILKSLNLLRTDVGIEIHKMQVQISPISLFDVEVIVTTVENV 2760

Query: 2761 SARSVTQSGEKLMTDLQMKIYKATLSLSKSNEELDEEAVSEISVDDYMIYAMKLSGGKIL 2820
            SARSVTQSGEKLMTDLQMKIYKATLSLSKSNEELDEEAVSEISVDDYMIYAMKLSGGKIL
Sbjct: 2761 SARSVTQSGEKLMTDLQMKIYKATLSLSKSNEELDEEAVSEISVDDYMIYAMKLSGGKIL 2820

Query: 2821 SIPKLFVGMTTWQLENSKIIEYLFACKFHDKISVRWNLGPVNFIKEVWATHVKSLAVRRA 2880
            SIPKLFVGMTTWQLENSKIIEYLFACKFHDKISVRWNLGPVNFIKEVWATHVKSLAVRRA
Sbjct: 2821 SIPKLFVGMTTWQLENSKIIEYLFACKFHDKISVRWNLGPVNFIKEVWATHVKSLAVRRA 2880

Query: 2881 QLKGDKEPQLVPGIIGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKFIYVPLKEPQI 2940
            QLKGDKEPQLVPGIIG                                KFIYVPLKEPQI
Sbjct: 2881 QLKGDKEPQLVPGIIGEPSPLVSSEELEMLRSESSNADNDNNEYSEEDKFIYVPLKEPQI 2940

Query: 2941 EMPKIKDLEDATPPLEWFGVNRKKFPRVTHQTAIILIQKIVHVAQKEYAKVLGDS 2995
            EMPKIKDLEDATPPLEWFGVNRKKFPRVTHQTAIILIQKIVHVAQKEYAKVLGDS
Sbjct: 2941 EMPKIKDLEDATPPLEWFGVNRKKFPRVTHQTAIILIQKIVHVAQKEYAKVLGDS 2995

>YLR087C Chr12 complement(306855..315731) [8877 bp, 2958 aa] {ON}
            CSF1Protein required for fermentation at low temperature;
            the authentic, non-tagged protein is detected in highly
            purified mitochondria in high-throughput studies
          Length = 2958

 Score = 2693 bits (6980), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1377/3026 (45%), Positives = 1935/3026 (63%), Gaps = 100/3026 (3%)

Query: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60
            ME  SQ   + L  +K FSWVFL  W+LT +  LT+IFY+ R++  + +FIL W +WK+ 
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVVCLTMIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120
            K+KIN+E++RVS LGG +  KN+S+I++D+T+S LE  + W+YWLLN R+ E  ++ N S
Sbjct: 61   KIKINVETLRVSLLGGRIHFKNLSVIHKDYTISVLEGSLTWKYWLLNCRKAEL-IENNKS 119

Query: 121  SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS 180
            S               K +KLPC I +EC+G E+F+YNR  AY+NV+ L +K+ER+KF  
Sbjct: 120  SSG-------------KKAKLPCKISVECEGLEIFIYNRTVAYDNVINLLSKDERDKFEK 166

Query: 181  FLNEHDLGDIVSEDTNVNSMDKDYFXXXXXXXXXXXXXINDRTYKKNKDERKSILFNFLP 240
            +LNEH   +  S+ ++ + +D+D               +NDR Y++    +   L  FLP
Sbjct: 167  YLNEHSFPEPFSDGSSADKLDED-LSESAYTTNSDASIVNDRDYQETDIGKHPKLLMFLP 225

Query: 241  IQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNISVK 300
            I+L+   G++ LGN+FTPS+++ SYE+  G++DV    E++DLY++K  M+F++  IS+K
Sbjct: 226  IELKFSRGSLLLGNKFTPSVMILSYESGKGIIDVLPPKERLDLYRNKTQMEFKNFEISIK 285

Query: 301  PNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESMFVNK 360
             N+ YD     +  ID+GK+S++W TF+ +  ++  P      K       D    F +K
Sbjct: 286  QNIGYDDAIGLKFKIDRGKVSKLWKTFVRVFQIVTKPVVPKKTKKSAGTSDD---NFYHK 342

Query: 361  WRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVPHGAH 420
            W+GLSLYK +  DA    LD+  +D  N EYAKF+SILKCP  T++Y +D PG+VPHGAH
Sbjct: 343  WKGLSLYKASAGDAKASDLDDVEFDLTNHEYAKFTSILKCPKVTIAYDVDVPGVVPHGAH 402

Query: 421  QTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQIPIK 480
             T    DGPD+GN+G+PP+F +D+Q+   SI YGPW  RQVS+L R+LSPVVS+   PIK
Sbjct: 403  PTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIK 462

Query: 481  KLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDFNLN 540
            KL PGSRRI+T+F+M++ I+++++WRIPTRE SKD EF+K + +TN+++RPFGW+D    
Sbjct: 463  KLPPGSRRIYTLFRMNISIMEDTTWRIPTRESSKDPEFLKHYKETNEEYRPFGWMDLRFC 522

Query: 541  KGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLGWNS 600
            K T A FN S+ PT+ G  NNF +HFL+ E+ +SVNHDILLKSK FD+  DIGYPLGWNS
Sbjct: 523  KDTYANFNISVCPTVQGFQNNFHVHFLETEIRSSVNHDILLKSKVFDIDGDIGYPLGWNS 582

Query: 601  QADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGYSIY 660
            +A W  ++ ++QLE FLL+EHI+L +D  SDF++ DPTPYELFRPF Y +NW++EGYSIY
Sbjct: 583  KAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIY 642

Query: 661  LNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRLLLN 720
            LNVND NIVNNPLDFNENCYLSLHGD+L ID  +P   I   YT++++ I TPMFR++LN
Sbjct: 643  LNVNDHNIVNNPLDFNENCYLSLHGDKLSIDVTVPRESILGTYTDMSYEISTPMFRMMLN 702

Query: 721  TPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYGVVI 780
            TPPWNTL+EFMK KEVGRA+DF I+GSYL+YS+LDIDNVDT+ +EC S+ST L CYG V+
Sbjct: 703  TPPWNTLNEFMKHKEVGRAYDFTIKGSYLLYSELDIDNVDTLVIECNSKSTVLHCYGFVM 762

Query: 781  RYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGSFXXXXXXXXXXXXXXXXXLY 840
            RYL NV+ NYFG+F +F+TSEEY+ +L    +   D                      L 
Sbjct: 763  RYLTNVKMNYFGEFFNFVTSEEYTGVL--GAREVGDVTTKSSVADLASTVDSGYQNSSLK 820

Query: 841  TKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLFSELMISF 900
             + +D  K  ++R+D+ RT NE DIWFTF VWDGALILPE +Y+ + C +L F+EL++ F
Sbjct: 821  NESED--KGPMKRSDLKRTTNETDIWFTFSVWDGALILPETIYSFDPCIALHFAELVVDF 878

Query: 901  RGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDVTIHAHRMFGL 960
            R  NYYMD +  L    I R ++   +E+F ++R  +      HG LSD+TIH HRM+GL
Sbjct: 879  RSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGLLSDLTIHGHRMYGL 938

Query: 961  PPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVESSDDMTL 1020
            PP + TYFCQW I+ G L IDS+IEF+  FF  F K+GFGY++LEN L+Y  E+ +DMT 
Sbjct: 939  PPTEPTYFCQWDINLGDLCIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETINDMTS 998

Query: 1021 LTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFSISIFDVRN 1080
            LT++ EK+ I + D V + Q+ +    +    IDF+NE+YS+RI++KIP+ +IS+  V  
Sbjct: 999  LTVHVEKIRIGLKDPVMKSQSVISAESILFTLIDFENEKYSQRIDVKIPKLTISLNCVMG 1058

Query: 1081 PTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPTMYQESFLY 1140
              +    L F+TK+ FTNF   +D     + QR YIT+HDSPYHRC F+LP  YQ+S  Y
Sbjct: 1059 DGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITIHDSPYHRCPFLLPLFYQDSDTY 1118

Query: 1141 NELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLE--NPFLNIRSINNLDTSSL 1198
              LYG I PS SIP LP+P LP+TID+++ED + EY+ LLE  NPF NI +    +T S 
Sbjct: 1119 QNLYGAIAPSSSIPTLPLPTLPDTIDYIIEDIVGEYATLLETTNPFKNIFA----ETPST 1174

Query: 1199 FNEYRVDTYISEKAIFKAEEKNTVNYDP-------KYEYDNYILNVEYIRVDINPLFSDF 1251
                R     SE      EE +  ++ P        +E DNY+++V YI +D++PL   F
Sbjct: 1175 MEPSRAS--FSEDD--NDEEADPSSFKPVAFTEDRNHERDNYVVDVSYILLDVDPLLFIF 1230

Query: 1252 IDSMSTKLYSENXXXXXXXXXXXXXXXLGSPKKVLLRETNLKLKISYVDIFWGSRNSEGI 1311
              S+  +LYSEN               L + ++ +   +N+ + I+Y+++ W     EG 
Sbjct: 1231 AKSLLEQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGF 1290

Query: 1312 EIYLDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEIEYERPPALSLTV 1371
            E+YLD++D++M ++  +      L E   L+K+K++R + ++ +  ++  +RPPALSL +
Sbjct: 1291 ELYLDRIDYQMSEKSLEKNRTNKLLEVAALAKVKTVRVTVNQKKNPDLSEDRPPALSLGI 1350

Query: 1372 EGLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGSVDLLQKRDV 1431
            EG EVWS T   Q NS+N+ S+DIT+D SQ  WL +Y + Q      +  S + +Q    
Sbjct: 1351 EGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVCTSFNSIQNTRS 1410

Query: 1432 TLQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLRHILNYLP 1491
              +  LISKLT ASEYYQI HDPYVITKPA IMRLS  HVRENRSW+I+TRLRHIL YLP
Sbjct: 1411 NSKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLP 1470

Query: 1492 EGWEKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFLPDIEK--- 1548
            + W+ +    ++ +   S  D KN+F+SVFS WRNWE SDVARSYIY ++F  + EK   
Sbjct: 1471 DDWQSNIDEVLKEKKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFTAENEKHKQ 1530

Query: 1549 NLINNTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPKAATANKNDKIYD 1608
            NLI    K  M SFY T+Y + Y V+HN VV   N+++D       P  +  +  ++  +
Sbjct: 1531 NLIKKLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLT----PPVTSLPSNREETIE 1586

Query: 1609 ITGTVGTFKGELGDQLIRLKKLYSEDKAKIRSEKS-TDFSIPKFFKINIVLIVEKGELTL 1667
            ITG VG+ KG+  D+L++L+ L     A    +KS     + K FK+N VL+V+K EL L
Sbjct: 1587 ITGRVGSVKGKFSDRLLKLQDLIPLIAAVGEDDKSDPKKELSKQFKMNTVLLVDKSELQL 1646

Query: 1668 AAANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNELILLDAHLDDLF 1727
                TKL+SR   G++S  +EN +D  + +GS+V ++ ++E+WLKH  +IL +A L D  
Sbjct: 1647 VMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHTSVILGEAQLRDFS 1706

Query: 1728 ISVIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRLTDKDNKKR 1787
            +    E    KPTIL+N + + L F+A+ +T+ LV  + E    +  I  R+  K   K+
Sbjct: 1707 VLATTEAWSHKPTILINNQCADLHFRAMSSTEQLVTAITEIRESLMMIKERIKFKPKSKK 1766

Query: 1788 HTSTSPIFSTKKXXXXXXXXXXXXXXXXVILSPFTVKHSMKELKIVFNREGDNDTIFSIL 1847
             +     F  +K                + LSPF ++H  K+L I FN+ G N+ + SI 
Sbjct: 1767 KSQ----FVDQKINTVLSCYFSNVSSEVMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIW 1822

Query: 1848 DADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKLTLADPKKITNSL 1907
            D D ++TS+Q   QY R S+ DI ++  ++     LI ++I  S+IKLT ++P++I NS 
Sbjct: 1823 DTDFFMTSHQTKEQYLRFSFGDIEIKGGISREGYSLINVDISISMIKLTFSEPRRIVNSF 1882

Query: 1908 LQDEKTFEQSLESIKTLNTL-FSSNREVRTSAVDNPYKFMVNFDL----TYFGLLFPVDT 1962
            LQDEK   Q +  + +L  L FSSN   +     +    M+N+ L    TYFG+L PV +
Sbjct: 1883 LQDEKLASQGINLLYSLKPLFFSSNLPKKEKQAPS---IMINWTLDTSITYFGVLVPVAS 1939

Query: 1963 SYFILELHSLLATFSNVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSKVLDFSVNL 2022
            +YF+ ELH LL + +N        + K+T   +++N LF+IK   +   +SK+LDFS+ +
Sbjct: 1940 TYFVFELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKLLDFSIKV 1999

Query: 2023 STETKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQIFKTKKK 2082
            ST  + +++++SF+VESSHFRVCL+P+SLL+++ G  +      YY       I+ TK  
Sbjct: 2000 STLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLSHYYSRRHAPNIWNTKMF 2059

Query: 2083 ASVVSENLIGAPLIEYSIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAYEDSYGKLT 2142
                S+     P+   SIH LSY FCIGWIF+    S PGL++GY+RLFSAYE  +GK T
Sbjct: 2060 TG-KSDKSKEMPINFRSIHILSYKFCIGWIFQYGAGSNPGLMLGYNRLFSAYEKDFGKFT 2118

Query: 2143 VVDGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYGETID 2202
            VVD FFS+ANG +S TF+S+GNEK+KYNRS+LPN+QI YW K    +K  F RF+GE +D
Sbjct: 2119 VVDAFFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALD 2178

Query: 2203 VRFLSNFATIINLTIESVQHFQMIKK------ETVREMNVEAEKKVGEDDISTKFSLFFS 2256
            V F+ +F  +I  T++S++ FQ +KK      E++R  N  +      +  S+  + F  
Sbjct: 2179 VNFVPSFMDVIESTLQSMRAFQELKKNILDVSESLRAENDNSYASTSVESASSSLAPFLD 2238

Query: 2257 KVQRINCQCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDMKKPHWIRSF 2316
             ++ +N    YDGGVF VY        +E + EI +P V I+  YK+  D  KPH  R+ 
Sbjct: 2239 NIRSVNSNFKYDGGVFRVYTYEDIETKSEPSFEIKSPVVTINCTYKHDEDKVKPHKFRTL 2298

Query: 2317 INIEPTYNTLLSQFASFLTEFGESVHEMVAKFSPKEQPPAPKTVSPPIDYKRILEDFDVS 2376
            I ++PT+NTL +  A  L EF ES+ +M+ K S  E+P   K  S  +DYKR+L+ FDV+
Sbjct: 2299 ITVDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTKPSSQNVDYKRLLDQFDVA 2358

Query: 2377 FSISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDIKTSINHE 2436
              +++ KQ++SLSCEP AKV A+VGFESF+FS+ TN+ D  +PL  SLT+   K SI H 
Sbjct: 2359 VKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMATNEFDSEQPLEFSLTLEHTKASIKHI 2418

Query: 2437 FSTEPTASFSVDFVDITTLFTHPDI---YGTTLISDVSLYFNIKQLQNLMVFLDIWNLKR 2493
            FS E + SF V F+D+T LFTHPD+   YGT L+SD+S++FN+KQLQNL +FLDIW    
Sbjct: 2419 FSREVSTSFEVGFMDLTLLFTHPDVISMYGTGLVSDLSVFFNVKQLQNLYLFLDIWRFSS 2478

Query: 2494 LIKLRPQKSVPVKKPEXXXXXXXXXXXXXXIIPWSFTVIITDINGDIHXXXXXXXXXXXX 2553
            ++  RP +    K+ E               IPW FT+I T+++GD+             
Sbjct: 2479 ILHTRPVQRTVNKEIEMSSLTSTNYADAGTEIPWCFTLIFTNVSGDVDLGPSLGMISLRT 2538

Query: 2554 XXXWISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRYVENEKLDQSPL 2613
               W++T+H+ ++R+ L  FTD +SLTS GRL GL +VAN SW+  V++   +  +  PL
Sbjct: 2539 QRTWLATDHYNEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWPPEKSKNTHPL 2598

Query: 2614 VDITLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLHLVCDEIDICS 2673
            V  +LN++++AVKAAFDYHMFLIG + NI F+L +EKD  G LPDLL++    DEI + S
Sbjct: 2599 VSTSLNIDDIAVKAAFDYHMFLIGTISNIHFHLHNEKDAKGVLPDLLQVSFSSDEIILSS 2658

Query: 2674 TALVASNILDISNTISRTRQDSRNSYIETLLESNPPPQKSSISYTDILKSLNLLRTDVGI 2733
            TALV +NILDI NTI R RQD++ SY+ETL +SNP   +  I Y DIL+SL LLRTD+ +
Sbjct: 2659 TALVVANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPILYKDILRSLKLLRTDLSV 2718

Query: 2734 EIHKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKATLSLSKSNEE 2793
             I   +VQISPISLFDVEV+V  ++ VS RS T SG+KL TDLQ+++   + +LS S EE
Sbjct: 2719 NISSSKVQISPISLFDVEVLVIRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEE 2778

Query: 2794 LDEEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYLFACKFHDKIS 2853
            LDEE  + I++DDYM YA K+ GG I+ IPKL V MTT Q E +  +EYLFAC F DKIS
Sbjct: 2779 LDEEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKIS 2838

Query: 2854 VRWNLGPVNFIKEVWATHVKSLAVRRAQLK----GDKEPQLVPGIIGXXXXXXXXXXXXX 2909
            VRWNLGPV+FIKE+W THVK+LAVRR+Q+     G  E +L   I               
Sbjct: 2839 VRWNLGPVDFIKEMWTTHVKALAVRRSQVANISFGQTEEELEESI--------------- 2883

Query: 2910 XXXXXXXXXXXXXXXXXXXKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFPRVT 2969
                               KF Y+ L+EPQIE+P+I+DL DATPP+EWFGVNRKKFP+ T
Sbjct: 2884 ------------KKEEAASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKKFPKFT 2931

Query: 2970 HQTAIILIQKIVHVAQKEYAKVLGDS 2995
            HQTA+I +QK+V++A+K+Y K+L D+
Sbjct: 2932 HQTAVIPVQKLVYLAEKQYVKILDDT 2957

>Smik_12.146 Chr12 complement(286690..295566) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 2685 bits (6960), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1361/3024 (45%), Positives = 1932/3024 (63%), Gaps = 96/3024 (3%)

Query: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60
            ME  SQ   + L  +K FSWVFL  W+LT +A LT++FY+ R++  + +FIL W +WK+ 
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTIVACLTMVFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120
            KVKIN+E++RVS LGG +  K++S+I++D+T+S LE  I W+YWLLN R+ E  +  N S
Sbjct: 61   KVKINVETLRVSLLGGRIHFKHLSVIHKDYTISILEGSITWKYWLLNCRKAEL-IDNNKS 119

Query: 121  SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS 180
              ++             N KLPC   +EC+G E+F+YNR  AY+NV+ L +K+ER+KF  
Sbjct: 120  PSKN-------------NVKLPCKFCLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEK 166

Query: 181  FLNEHDLGDIVSEDTNVNSMDKDYFXXXXXXXXXXXXXINDRTYKKNKDERKSILFNFLP 240
            +LNEH   +  S+ ++ + +D+D               INDR Y++    +      FLP
Sbjct: 167  YLNEHSFPEPFSDGSSADKLDED-LSESAYTTNSDASIINDRDYQETDIGKHPQFLKFLP 225

Query: 241  IQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNISVK 300
            I+L    G++ LGN+FTPS+++ SYE+  G++DV    E++DLY++K  M+F++  IS+K
Sbjct: 226  IELNFSRGSLLLGNKFTPSVMILSYESGEGIVDVLPPKERVDLYRNKTQMEFKNFEISIK 285

Query: 301  PNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESMFVNK 360
             N+ YD     +  +D GK+S++W  FI ++ ++  P   +  K  KK        F  K
Sbjct: 286  QNIGYDDAIGLKFKLDTGKVSKLWKAFIRVLQLVSKP---VVSKRTKKNTRSSNDSFYQK 342

Query: 361  WRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVPHGAH 420
            W+GLSLYK    +A    LD+  +D  N EYAKF+SILKCP  T+SY +D PG+VPHGAH
Sbjct: 343  WKGLSLYKATSGEAKANDLDDIEFDLTNHEYAKFTSILKCPKVTISYDVDVPGVVPHGAH 402

Query: 421  QTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQIPIK 480
             T    DGPD+GN+G+PP+F +D+Q+   SI YGPW  RQVS+L R+LSPVVS+   PIK
Sbjct: 403  PTISDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIK 462

Query: 481  KLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDFNLN 540
            KL PGSRR++T+F+M++ I ++++WRIPTRE SKD EF++ + +T++++RPFGW+D    
Sbjct: 463  KLPPGSRRVYTLFRMNISITEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFC 522

Query: 541  KGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLGWNS 600
            K T A FN S+ PT++G  NNF +HF++ E+ +SVNHDILLKSK F++  DIGYPLGWNS
Sbjct: 523  KDTYANFNISVCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNIDGDIGYPLGWNS 582

Query: 601  QADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGYSIY 660
            +A W  ++ ++QLE FLL+EHI+L +D  SDF++ DPTPYELFRPF Y +NW++EGYSIY
Sbjct: 583  KAIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKVNWEMEGYSIY 642

Query: 661  LNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRLLLN 720
            LNVND NIVNNPLDFNENCYLSLHGD+L ID  +P   I   YT+I++ I TPMFR++LN
Sbjct: 643  LNVNDHNIVNNPLDFNENCYLSLHGDKLAIDVTVPRESILGTYTDISYEISTPMFRMMLN 702

Query: 721  TPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYGVVI 780
            TPPWNTL+EFMK KEVGRA+DF I+G+YL+YS+LDIDNVDT+ +ECTS ST L CYG V+
Sbjct: 703  TPPWNTLNEFMKHKEVGRAYDFTIKGTYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVM 762

Query: 781  RYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGSFXXXXXXXXXXXXXXXXXLY 840
            RYL NV+ NYFG+F +F+TSEEY+ +L   +      + S                    
Sbjct: 763  RYLTNVKMNYFGEFFNFVTSEEYTGVLGARDVGDVTTKSSVVDLASTVDSGYQNSS---- 818

Query: 841  TKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLFSELMISF 900
             K    +K  ++R+D+ RT NE DIWFTF VW+GALILPE +Y+ + C +L FSEL++ F
Sbjct: 819  VKNNSEAKGPMKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFSELVVDF 878

Query: 901  RGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDVTIHAHRMFGL 960
            R  NYYMD +  L    I R ++   +E+F ++R  +      HG+LSD+TIH HRM+GL
Sbjct: 879  RSCNYYMDIMAVLDGTSIKRHVSKQINEVFDFIRRNNGADEQEHGSLSDLTIHGHRMYGL 938

Query: 961  PPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVESSDDMTL 1020
            PP + TYFCQW I+ G L IDS++EF+  FF  F K+GFGY++LEN L+Y  E+ DDMT 
Sbjct: 939  PPTEPTYFCQWDINLGDLSIDSDVEFIKGFFSSFYKIGFGYNDLENILLYDTETIDDMTS 998

Query: 1021 LTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFSISIFDVRN 1080
            LT++ E++ I + D V + Q+ +    +    IDF+NE YS+RI++K+P+  IS+  V  
Sbjct: 999  LTVHAERIRISLEDPVMKSQSVISAESILFTLIDFENENYSQRIDVKVPKLKISLNCVMG 1058

Query: 1081 PTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPTMYQESFLY 1140
              +    L F+TK+ FTNF   +D     + QR YIT HDSPYHRC F+LP  YQ+S  Y
Sbjct: 1059 DGVDMSFLKFETKLRFTNFEQYKDIDKKRSEQRKYITFHDSPYHRCSFLLPLFYQDSDTY 1118

Query: 1141 NELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLE--NPFLN--IRSINNLDTS 1196
             +LYG I PS SIP LP+P LP+TIDF++ED + EY+ LLE  NPF +    + + ++ S
Sbjct: 1119 QKLYGAIAPSSSIPTLPLPTLPDTIDFIIEDIVGEYATLLEAANPFKDSFAETPSTVEPS 1178

Query: 1197 -SLFNEYRVDTYISEKAIFKAEEKNTVNYDPKYEYDNYILNVEYIRVDINPLFSDFIDSM 1255
             + F E   D    E+A     +      D   E DNY+++V YI +DI+PL   F  S+
Sbjct: 1179 KASFTEDDND----EEASSSGFKPGAFTEDGDDEKDNYVVDVSYILLDIDPLLFVFTKSL 1234

Query: 1256 STKLYSENXXXXXXXXXXXXXXXLGSPKKVLLRETNLKLKISYVDIFWGSRNSEGIEIYL 1315
              +LYSEN               L + ++ +   +N+ + I+Y+++ W     EG E+YL
Sbjct: 1235 LEQLYSENMVQVLDDIEIGIVKRLSNLQEGITSISNIDIHIAYLNLIWQETGEEGFELYL 1294

Query: 1316 DKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEIEYERPPALSLTVEGLE 1375
            D++D++MR++  +      L E   L+++K++R + ++ +  ++  +RPPALSL +EG E
Sbjct: 1295 DRIDYQMREKSLEKNRTTKLLEVAALARVKTVRVTVNQKKNPDLSEDRPPALSLGLEGFE 1354

Query: 1376 VWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGSVDLLQKRDVTLQK 1435
            +WS T   Q NS+N+ S+DIT+D SQ  WL +Y + Q      +  S   +Q    + + 
Sbjct: 1355 IWSSTEGRQVNSLNLTSSDITIDESQMEWLFQYCSDQANLLQEVATSFHSIQDTRTSSKT 1414

Query: 1436 SLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLRHILNYLPEGWE 1495
             LIS+LT ASEYYQI HDPYVITKPA IMRLS  HVRENRSW+I+TRLRHIL YLP+ W+
Sbjct: 1415 ELISELTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQ 1474

Query: 1496 KSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFLPDIEK---NLIN 1552
             +    ++ R   S +D KN+F+SVFS WRNWE SDVARSYIY ++F  D EK   NLI 
Sbjct: 1475 NNIDKVLKERKYTSANDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSTDNEKHKQNLIK 1534

Query: 1553 NTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPKAATANKNDKIYDITGT 1612
               K  M SFY T+Y + Y V+HN VV   N+++D       P  + +   ++  +ITG 
Sbjct: 1535 KLLKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLT----PPVTSLSLNREETIEITGR 1590

Query: 1613 VGTFKGELGDQLIRLKKLYSEDKAKIRSEKS-TDFSIPKFFKINIVLIVEKGELTLAAAN 1671
            +G+ KG+  D+L++L+ L     A    +KS     + K F++N VL+V+K EL L    
Sbjct: 1591 IGSVKGKFSDRLLKLQDLIPLVAAVGEDDKSDPKTELSKQFRMNTVLLVDKSELQLVMDE 1650

Query: 1672 TKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNELILLDAHLDDLFISVI 1731
            TKL+SR   G++S  +EN +D  + +GS+V ++ ++E+WLKH  +IL +A L D  I   
Sbjct: 1651 TKLMSRTVGGRVSLLWENLKDSTSQAGSVVIFSQKSEVWLKHASIILGEAQLRDFSILAT 1710

Query: 1732 AELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRLTDKDNKKRHTST 1791
             E    KPTIL+N + + L F+A+ +T+  V  + E      KI  R+  K   K+ +  
Sbjct: 1711 TEAWSHKPTILINNQCADLHFRAMSSTEQTVTAITEIRESALKIKERIKFKPKSKKKSQ- 1769

Query: 1792 SPIFSTKKXXXXXXXXXXXXXXXXVILSPFTVKHSMKELKIVFNREGDNDTIFSILDADL 1851
               F  +K                + LSPF ++H  K+L I FN+ G N+ + SI D D 
Sbjct: 1770 ---FVGQKINTVLTCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILISIWDTDF 1826

Query: 1852 YLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKLTLADPKKITNSLLQDE 1911
            ++TS+Q   QY R S+ DI ++  ++     LI ++I  S+IKLT ++P++I NS LQDE
Sbjct: 1827 FMTSHQTKEQYLRFSFGDIEIKGGVSKEGYSLINVDISISMIKLTFSEPRRIVNSFLQDE 1886

Query: 1912 KTFEQSLESIKTLNTL-FSSNREVRTSAVDNPYKFMVNFDL----TYFGLLFPVDTSYFI 1966
            K   Q +  + +L +L FSSN   +   V      M+N+ L    +YFG+L PV ++YF+
Sbjct: 1887 KLASQGINLLCSLKSLFFSSNIPKKEKQVP---ALMINWTLDTSISYFGILIPVASTYFV 1943

Query: 1967 LELHSLLATFSNVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSKVLDFSVNLSTET 2026
             ELH LL + +N        + K+T   +++N LF+IK   +   +SKVLDFS+ +ST  
Sbjct: 1944 FELHMLLLSLTNTNNGMLPEETKVTGQFSIENILFLIKERSLPIGLSKVLDFSIKVSTLQ 2003

Query: 2027 KILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQIFKTKKKASVV 2086
            + +++++SF+VESSHFRVCL+P+SLL+++ G  +      YY +H    I+  K      
Sbjct: 2004 RTIDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYTKHHAPNIWNIKMFTG-K 2062

Query: 2087 SENLIGAPLIEYSIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAYEDSYGKLTVVDG 2146
            S+     PL   SIH LSY FCIGW+F+    S PGL++GY+RLFSAYE  +GK TVVD 
Sbjct: 2063 SDKPKEIPLNFRSIHILSYKFCIGWLFQYGTGSDPGLMLGYNRLFSAYERDFGKFTVVDS 2122

Query: 2147 FFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYGETIDVRFL 2206
            FFS+ANG +S TF+S+GNEK+KYNRS+LPN+QI YW K    +K  F RF+GE +DV F+
Sbjct: 2123 FFSVANGNTSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVNFV 2182

Query: 2207 SNFATIINLTIESVQHFQMIKKETV--------REMNVEAEKKVGEDDISTKFSLFFSKV 2258
             +F  +I+ T++S++ FQ +K+  +         + N+ A   V  ++  +  + F + +
Sbjct: 2183 PSFMDVIDSTLQSMRAFQELKRNILDVSENSHSEDSNIYAASSV--ENAPSSLAPFLNNI 2240

Query: 2259 QRINCQCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDMKKPHWIRSFIN 2318
            + +N    YDGGVF VY        +E + EI +P V I+  YK+  D  +PH IR+ I 
Sbjct: 2241 RSVNSNFKYDGGVFRVYTYEDIEAKSEPSFEIKSPVVTINCTYKHDEDKVRPHKIRTLIT 2300

Query: 2319 IEPTYNTLLSQFASFLTEFGESVHEMVAKFSPKEQPPAPKTVSPPIDYKRILEDFDVSFS 2378
            ++PT+NTL +  A  L EF ES+ +M+ K S  E+P   K     +DYKR+L+ FDV+  
Sbjct: 2301 VDPTHNTLYAGCAPLLMEFSESLQKMIKKHSTDEKPNFTKPSPQNVDYKRLLDQFDVAVK 2360

Query: 2379 ISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDIKTSINHEFS 2438
            +++ KQ++SLSCEP AKV A+VGFESF+FS+ TN+ D   PL  SLT+   K SI H FS
Sbjct: 2361 LTSAKQQLSLSCEPKAKVQADVGFESFLFSVTTNEFDSEHPLEFSLTLEHTKASIKHIFS 2420

Query: 2439 TEPTASFSVDFVDITTLFTHPDI---YGTTLISDVSLYFNIKQLQNLMVFLDIWNLKRLI 2495
             E + SF V F+D+T LFTHPD+   YG  L+SD++++FN+KQLQNL +FLDIW    ++
Sbjct: 2421 REVSTSFEVGFMDLTILFTHPDVISMYGIGLVSDLNVFFNVKQLQNLYLFLDIWRFSSIL 2480

Query: 2496 KLRPQKSVPVKKPEXXXXXXXXXXXXXXIIPWSFTVIITDINGDIHXXXXXXXXXXXXXX 2555
              RP +    K  +               IPW FT+I T+++GD+               
Sbjct: 2481 HTRPAQRSVNKGIDMHSLTSTSHVDLGTEIPWCFTLIFTNVSGDVDLGPSLGVISLRTQR 2540

Query: 2556 XWISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRYVENEKLDQSPLVD 2615
             W++T+H+ ++R+ L  FTD +SLTS GRL GL +VAN SW+  V++   +  +  PLV 
Sbjct: 2541 TWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWLSEVKWSPEKGKNTHPLVS 2600

Query: 2616 ITLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLHLVCDEIDICSTA 2675
             +LN++++A+KAAFDYHMFLIG ++NI F L +EKD  G LPDLL++    DEI + STA
Sbjct: 2601 TSLNIDDMAIKAAFDYHMFLIGTINNIHFQLHNEKDAKGVLPDLLQVSFSSDEIILSSTA 2660

Query: 2676 LVASNILDISNTISRTRQDSRNSYIETLLESNPPPQKSSISYTDILKSLNLLRTDVGIEI 2735
            LVA+NILDI NTI R RQD++ SY+ETL +SNP   +  + Y DIL+SL LLRTD+ + I
Sbjct: 2661 LVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESRQPVLYKDILRSLKLLRTDLSVSI 2720

Query: 2736 HKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKATLSLSKSNEELD 2795
              ++VQISPISLFDVEV+V  ++ VS RS T SG+KL TDLQ+++   + +LS S EELD
Sbjct: 2721 SSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEELD 2780

Query: 2796 EEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYLFACKFHDKISVR 2855
            EE  + I++DDYM YA K+ GG I+ IPKL V MTT Q E +  +EYLFAC F DKISVR
Sbjct: 2781 EEVGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKISVR 2840

Query: 2856 WNLGPVNFIKEVWATHVKSLAVRRAQLK----GDKEPQLVPGIIGXXXXXXXXXXXXXXX 2911
            WNLGPVNFIKE+W THVK+LAVRR+Q+     G  E +L   I                 
Sbjct: 2841 WNLGPVNFIKEMWTTHVKALAVRRSQIANISFGQTEEELEESI----------------- 2883

Query: 2912 XXXXXXXXXXXXXXXXXKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFPRVTHQ 2971
                             KF Y+ L+EPQIE+P+I+DL DATPP+EWFGVNRK+FP+ THQ
Sbjct: 2884 ----------NKEETASKFNYIALEEPQIEVPQIRDLGDATPPMEWFGVNRKRFPKFTHQ 2933

Query: 2972 TAIILIQKIVHVAQKEYAKVLGDS 2995
            TA+I +QK+V++A+K+Y K+L D+
Sbjct: 2934 TAVIPVQKLVYLAEKQYVKILDDT 2957

>Skud_12.155 Chr12 complement(290039..298918) [8880 bp, 2959 aa] {ON}
            YLR087C (REAL)
          Length = 2959

 Score = 2672 bits (6926), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1363/3030 (44%), Positives = 1924/3030 (63%), Gaps = 113/3030 (3%)

Query: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60
            ME  SQ   + L  +K FSWVFL  W+LT +  LT+IFY+ R++  + TFIL W +WK+ 
Sbjct: 1    MEAISQLRGVPLTHQKDFSWVFLVDWILTVVICLTMIFYMGRIYAYLVTFILEWLLWKRA 60

Query: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120
             +KIN+E++RVS LGG +  K++S+I++D+T+S LE  + W+YWLLN R+ E        
Sbjct: 61   NIKINVETLRVSLLGGRIHFKHLSVIHKDYTISVLEGSLTWKYWLLNCRKAELI------ 114

Query: 121  SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS 180
                     +N  ++ KN KLPC   +EC+G E+F+YNR  AY+NV+ L +K+ER+KF  
Sbjct: 115  --------ENNKDSLSKNVKLPCKFSLECEGLEIFIYNRTVAYDNVINLLSKDERDKFEK 166

Query: 181  FLNEHDLGDIVSEDTNVNSMDKDYFXXXXXXXXXXXXXINDRTYKKNKDERKSILFNFLP 240
            +LNEH   +  S+ ++ + +D+D               INDR Y++    +      FLP
Sbjct: 167  YLNEHSFPESFSDGSSADKLDED-LSESAYTTNSDASIINDRDYQETDIGKLPKFLKFLP 225

Query: 241  IQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNISVK 300
            I+L+   G++ LGN+FTPS+++ SYEN  GV+DV    E++DLY++K  M+F++  IS+K
Sbjct: 226  IELKFNRGSLLLGNKFTPSVMILSYENGEGVIDVLPPKERLDLYRNKTQMEFKNFEISIK 285

Query: 301  PNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESMFVNK 360
             N+ YD     +  +D GK+S++W TF+ ++ ++  P   I  K  KKK    +  F  K
Sbjct: 286  QNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRIVTKP---IISKKNKKKTGPSDDSFFQK 342

Query: 361  WRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVPHGAH 420
            W+GLSLYK    DA    LD+  +DF N EYAKF+SILKCP  T++Y +D  G VPHGAH
Sbjct: 343  WKGLSLYKAAPGDAKPSDLDDIEFDFTNHEYAKFTSILKCPKLTIAYDVDVSGFVPHGAH 402

Query: 421  QTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQIPIK 480
             T    DGPD+GN+G+PP+F +D+Q+   SI YGPW  RQVS+L R+LSPVVS+   P+K
Sbjct: 403  PTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTSKPVK 462

Query: 481  KLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDFNLN 540
            KL PGSRRI+T+F+M+V I+++++WRIPTRE SKD EF++ + +T++++RPFGW+D    
Sbjct: 463  KLPPGSRRIYTLFRMNVLIMEDTTWRIPTRETSKDAEFLQHYKETSEEYRPFGWMDLRFC 522

Query: 541  KGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLGWNS 600
            K T A FN  L PT++G  NNF +HF++ E+ +SVNHDILLKSK F++  DIGYPLGWNS
Sbjct: 523  KDTYANFNVVLCPTVEGFQNNFHVHFVETEIRSSVNHDILLKSKVFNLDGDIGYPLGWNS 582

Query: 601  QADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGYSIY 660
            +A W  ++ ++QLE FLL+EHI+L +D  SDF++ +PTPYELFRPF Y +NW++EGYSIY
Sbjct: 583  KAIWIINMKSQQLEAFLLREHITLVADTLSDFSAGEPTPYELFRPFVYKVNWEMEGYSIY 642

Query: 661  LNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRLLLN 720
            LNVND NIVNNPLDFNENCYLSLHGD L+ID  +P   I   YT+I++ I TPMFR++LN
Sbjct: 643  LNVNDHNIVNNPLDFNENCYLSLHGDRLYIDITVPRESILGTYTDISYEISTPMFRMMLN 702

Query: 721  TPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYGVVI 780
            TPPWNTL+EFMK KEVGRA+DF ++GSYL+YS+LDIDNVDT+ +ECTS ST L CYG V+
Sbjct: 703  TPPWNTLNEFMKHKEVGRAYDFTVKGSYLLYSELDIDNVDTLVIECTSNSTVLHCYGFVM 762

Query: 781  RYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGSFXXXXXXXXXXXXXXXXXLY 840
            RYL NV+ NYFG+F +F+TSEEY+ +L          + S                    
Sbjct: 763  RYLTNVKMNYFGEFFNFVTSEEYTGVLGAREVGEIITKSSVLDLASTLDSGYQNSSL--- 819

Query: 841  TKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLFSELMISF 900
             K +   K  V+R+D+ RT NE DIWFTF VW+GALILPE +Y+ + C +L F+EL++ F
Sbjct: 820  -KNESEDKDPVKRSDLKRTTNETDIWFTFSVWNGALILPETIYSLDPCIALHFTELVVDF 878

Query: 901  RGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDVTIHAHRMFGL 960
            R  NYYMD +  L    I R ++   +E+F ++R  +      HGTLSD+TIH HRMFGL
Sbjct: 879  RSCNYYMDIMAVLNGTSIKRHVSKPINEVFDFIRRNNGANEQEHGTLSDLTIHGHRMFGL 938

Query: 961  PPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVESSDDMTL 1020
            PP + TYFCQW I+ G L IDS+IEF+  FF  F K+GFGY++LEN L+Y  E+ DDMT 
Sbjct: 939  PPTEPTYFCQWDINLGDLTIDSDIEFIKGFFNSFYKIGFGYNDLENILLYDTETVDDMTS 998

Query: 1021 LTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFSISIFDVRN 1080
            LT++ E++ I  +D V + Q+ +    L    IDF+NERYS+RI++KIP+  IS+  V  
Sbjct: 999  LTVHAERIKISFNDPVMKSQSVVTAESLLFTLIDFENERYSQRIDVKIPKLIISLSCVMG 1058

Query: 1081 PTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPTMYQESFLY 1140
              +    L F+TK+ FTNF   +D     + QR YIT HDSPYHRC F+LP  YQ+S  Y
Sbjct: 1059 DGVDTSFLKFETKLRFTNFEQYKDIDKKRSEQRRYITAHDSPYHRCPFLLPLFYQDSDTY 1118

Query: 1141 NELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLE--NPFLNIRSINNLDTSSL 1198
             +LYG I PS SIP LP+P LP+TIDF++ED + EY+ LLE  NPF +I +    +T S 
Sbjct: 1119 QKLYGAIAPSSSIPTLPLPTLPDTIDFIIEDIVGEYATLLETTNPFKDIFA----ETPST 1174

Query: 1199 FNEYRVDTYISEKAIFKAEEKNTVNYDP------------KYEYDNYILNVEYIRVDINP 1246
                R  +          E+ N    DP             ++  NY+++V YI +D++P
Sbjct: 1175 VEPSRASS---------TEDDNDERADPLEFKPIAFTEGRNHQRGNYVIDVSYILLDVDP 1225

Query: 1247 LFSDFIDSMSTKLYSENXXXXXXXXXXXXXXXLGSPKKVLLRETNLKLKISYVDIFWGSR 1306
            L   F  S+  + YSE+               L + ++ +   +N+ + I+Y+++ W   
Sbjct: 1226 LLFVFTKSLLKEFYSEDMVQVLDDIEIGIVKQLSNLQEGITSISNIDVHIAYMNLIWQET 1285

Query: 1307 NSEGIEIYLDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEIEYERPPA 1366
              EG E+YLD++D++M ++  +      L E   L+++K++R + ++ +  ++  +RPPA
Sbjct: 1286 GEEGFELYLDRIDYQMSEKSLEKNRTSKLLEVATLARIKTVRVTVNQKRNPDLSEDRPPA 1345

Query: 1367 LSLTVEGLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGSVDLL 1426
            LSL +EG EVWS T   Q NS+N+ S+DIT+D SQ  WL +Y + Q         S   +
Sbjct: 1346 LSLGLEGFEVWSSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEALNSFHSI 1405

Query: 1427 QKRDVTLQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLRHI 1486
            Q   ++ +  LISKLT ASEYYQI HDPYVITKPA IMRLS  HVRENRSW+I+TRLRHI
Sbjct: 1406 QSTRISSKTELISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHI 1465

Query: 1487 LNYLPEGWEKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFLPD- 1545
            L YLP+ W+ +    ++ R   S  D KN+F+SVFS WRNWE SDVARSYIY ++F  D 
Sbjct: 1466 LTYLPDDWQDNIEKVLKERKYTSAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFSVDN 1525

Query: 1546 --IEKNLINNTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPKAATANKN 1603
               ++NL+    K  M SFY T+Y + Y V+HN V+   N+++D       P  + +   
Sbjct: 1526 AEHKQNLMKKLLKCTMGSFYLTVYGEGYEVEHNFVIADANLVVDLT----PPVTSLSLNR 1581

Query: 1604 DKIYDITGTVGTFKGELGDQLIRLKKLYSEDKAKIRSEKS-TDFSIPKFFKINIVLIVEK 1662
            ++  +ITG VG+ KG+  D+L++L+ L     A    +KS     + K FK+N VL+V+K
Sbjct: 1582 EETIEITGRVGSVKGKFSDRLLKLQDLIPLVAAVGGGDKSDAKAELSKQFKMNTVLLVDK 1641

Query: 1663 GELTLAAANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNELILLDAH 1722
             E+ L    TKL+SR   G++S  +EN +D  + +GS+V ++ ++E+WLKH  +IL +A 
Sbjct: 1642 SEIQLVMDQTKLMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHASIILCEAQ 1701

Query: 1723 LDDLFISVIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRLTDK 1782
            L D  I    E    KPTIL+N + + L F+A+  T+  V  + E    + KI  R+  K
Sbjct: 1702 LRDFSILATTEAWSHKPTILINNQCADLHFRAMSTTEQTVTVITEIRESVLKIKDRIKFK 1761

Query: 1783 DNKKRHTSTSPIFSTKKXXXXXXXXXXXXXXXXVILSPFTVKHSMKELKIVFNREGDNDT 1842
               K+ +     F   K                + LSPF ++H  K+L I FN+ G N+ 
Sbjct: 1762 PKSKKRSQ----FVGPKINIVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEV 1817

Query: 1843 IFSILDADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKLTLADPKK 1902
            + SI D D ++TS+Q   QY R S+ DI ++  ++     LI ++I  S+IKLT ++P++
Sbjct: 1818 LLSIWDTDFFMTSHQTKEQYLRFSFGDIEIKGGISKEDYSLINVDISISMIKLTFSEPRR 1877

Query: 1903 ITNSLLQDEKTFEQSLESIKTLNTLFSSNREVRTSAVDNPYKFMVNFDL----TYFGLLF 1958
            I NS LQDEK   Q +  + +L +L  ++   +      P + M+N+ L    TYFG+L 
Sbjct: 1878 IVNSFLQDEKLASQGINLLSSLKSLLFTSGLPKKKKKKAPAR-MINWTLDTSITYFGILV 1936

Query: 1959 PVDTSYFILELHSLLATFSNVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSKVLDF 2018
            PV ++YF+ ELH LL + +N        + K+T   +++N LF+IK   +   +SK+LDF
Sbjct: 1937 PVASTYFVFELHMLLLSLTNTNNGMLPEEAKVTGQFSIENILFLIKERSLPIGLSKLLDF 1996

Query: 2019 SVNLSTETKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQIFK 2078
            S+ +ST  + +++++SF+VESSHFRVCL+P+SLL+++ G  +      YY       I+ 
Sbjct: 1997 SIKVSTLQRTVDTEQSFQVESSHFRVCLSPDSLLRLMWGAHKLLDLGHYYSRRHAPNIWD 2056

Query: 2079 TKKKASVVSENLIGAPLIEYSIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAYEDSY 2138
             K      S+     P+   SIH LSY FCIGW+F+    S PGL++GY+RLFSAYE  +
Sbjct: 2057 IKMFTG-KSDKPKEIPINFRSIHILSYKFCIGWLFQYGAGSDPGLMLGYNRLFSAYEKDF 2115

Query: 2139 GKLTVVDGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYG 2198
            GK TVVD FFS+ANG  S TF+S+GNEK+KYNRS+LPN+QI YW K    +K  F RF+G
Sbjct: 2116 GKFTVVDAFFSVANGNKSSTFFSEGNEKDKYNRSFLPNMQISYWFKRCGELKDWFFRFHG 2175

Query: 2199 ETIDVRFLSNFATIINLTIESVQHFQMIKKETVREMNVEAEKKVGEDD---------IST 2249
            E +DV F+ +F  +I+ T++SV+ FQ +KK     ++V  +  + +D+          S 
Sbjct: 2176 EALDVNFVPSFMDVIDSTLQSVRAFQELKKNI---LDVSEDSHMEDDNPYATSSMESASN 2232

Query: 2250 KFSLFFSKVQRINCQCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDMKK 2309
              + F   ++ +N    YDGGVF VY        +E + EI +P V I+  YK+  +  K
Sbjct: 2233 SLAPFLDNIRSVNSNFKYDGGVFRVYTYDDIEAKSEPSFEIKSPVVTINCTYKHNENEAK 2292

Query: 2310 PHWIRSFINIEPTYNTLLSQFASFLTEFGESVHEMVAKFSPKEQPPAPKTVSPPIDYKRI 2369
            PH IR  I ++PT NTL +  A  L EF ES+ +M+ K S  ++P   K  S  +DYKR+
Sbjct: 2293 PHRIRILIAVDPTLNTLYAGCAPLLMEFSESLQKMIKKHSTDDKPSFTKPSSQNVDYKRL 2352

Query: 2370 LEDFDVSFSISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDI 2429
            L+ FDV+  +++ KQ++SLSCEP AKV A+VGFESF+FS+ TN+ D  +PL  SLT+   
Sbjct: 2353 LDQFDVAVKLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLEFSLTLQQT 2412

Query: 2430 KTSINHEFSTEPTASFSVDFVDITTLFTHPDI---YGTTLISDVSLYFNIKQLQNLMVFL 2486
            K SI H FS E + SF V F+D+T LFTHPD+   YGT+L+SD+S++FN+KQLQNL +FL
Sbjct: 2413 KASIRHIFSREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDLSVFFNVKQLQNLYLFL 2472

Query: 2487 DIWNLKRLIKLRPQKSVPVKKPEXXXXXXXXXXXXXXIIPWSFTVIITDINGDIHXXXXX 2546
            DIW    ++  RP +    K+ +               IPW FT+I T+++GD+      
Sbjct: 2473 DIWRFSSILHTRPVQGSISKEIDMSSLTSTNYVDVGAEIPWCFTLIFTNVSGDVDLGPSL 2532

Query: 2547 XXXXXXXXXXWISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRYVENE 2606
                      W++T+H+ ++R+ L  FTD +SLTS GRL GL +VAN SWI  V++   +
Sbjct: 2533 GVISLRTQRTWLATDHYSEKRQLLHAFTDGVSLTSEGRLSGLFEVANASWISEVKWSLEK 2592

Query: 2607 KLDQSPLVDITLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLHLVC 2666
              +  PLV  +LN+++VAVKAAFDYHMFLIG ++NI F L +EKD  G LPDLL++    
Sbjct: 2593 SKNSHPLVSTSLNIDDVAVKAAFDYHMFLIGTINNIQFQLHNEKDAKGILPDLLQVSFSS 2652

Query: 2667 DEIDICSTALVASNILDISNTISRTRQDSRNSYIETLLESNPPPQKSSISYTDILKSLNL 2726
            DEI + STALVA+NILDI NTI R RQD++ SY+ETL +SNP   K  I Y DIL+SL L
Sbjct: 2653 DEITLSSTALVAANILDIYNTIVRMRQDNKISYMETLRDSNPGESKQPILYKDILRSLKL 2712

Query: 2727 LRTDVGIEIHKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKATLS 2786
            LRTD+ + I  ++VQISPISLFDVEV+V  ++NVS RS T SG+KL TDLQ+++   + +
Sbjct: 2713 LRTDLSLNISSLKVQISPISLFDVEVLVVRIKNVSIRSETHSGKKLKTDLQLQVLDVSAA 2772

Query: 2787 LSKSNEELDEEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYLFAC 2846
            LS S EELDEE  + I++DDY+ YA K+ GG I+ IPKL V MTT Q E +  IEYLFAC
Sbjct: 2773 LSTSKEELDEEIGASIAIDDYIHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNIEYLFAC 2832

Query: 2847 KFHDKISVRWNLGPVNFIKEVWATHVKSLAVRRAQLK----GDKEPQLVPGIIGXXXXXX 2902
             F DKISV+WNLGPVNFIKE+W THVK+LAVR++Q+     G  E +L   I        
Sbjct: 2833 SFSDKISVKWNLGPVNFIKEMWTTHVKALAVRQSQIANVSFGQTEEELEESI-------- 2884

Query: 2903 XXXXXXXXXXXXXXXXXXXXXXXXXXKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNR 2962
                                      KF Y+ L+EPQI++P+I+DL DATPP+EWFGVNR
Sbjct: 2885 -------------------KTKETTSKFNYIALEEPQIQVPQIRDLGDATPPMEWFGVNR 2925

Query: 2963 KKFPRVTHQTAIILIQKIVHVAQKEYAKVL 2992
            K+FP+ THQTA+I +QK+V++A+K+Y K+L
Sbjct: 2926 KRFPKFTHQTAVIPVQKLVYLAEKQYVKIL 2955

>Suva_10.171 Chr10 complement(311672..320548) [8877 bp, 2958 aa] {ON}
            YLR087C (REAL)
          Length = 2958

 Score = 2651 bits (6872), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1352/3026 (44%), Positives = 1940/3026 (64%), Gaps = 100/3026 (3%)

Query: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60
            ME  SQ   + L  +K FSWVFL  W+LT IA LT IFY+ R++  + +FIL W +WK+ 
Sbjct: 1    MEAVSQLRGVPLTHQKDFSWVFLVDWILTVIACLTTIFYMGRIYAYLVSFILEWLLWKRA 60

Query: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120
            K+KIN+E++R+S LGG ++ K++S+I++D+T+S LE  + W+YWLLN R+ E      + 
Sbjct: 61   KIKINVETLRISLLGGRIYFKHLSVIHKDYTISILEGSLTWKYWLLNCRKAEL-----IE 115

Query: 121  SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS 180
            +E++            KN +LPC  L+EC+G E F+YNR  AY+NV+ L +K+ER+KF  
Sbjct: 116  NEKNSSG---------KNIELPCKFLLECEGLEYFIYNRTLAYDNVINLLSKDERDKFEK 166

Query: 181  FLNEHDLGDIVSEDTNVNSMDKDYFXXXXXXXXXXXXXINDRTYKKNKDERKSILFNFLP 240
            +LNEH   +  S+ ++ + +D+D               INDR Y++    +     +F P
Sbjct: 167  YLNEHSFPEPFSDGSSADKLDED-LSESAYTTNSDSSIINDRDYQETNIGKYPKGLSFFP 225

Query: 241  IQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNISVK 300
            I+L+L  G++ LGN+FTPS+++ SYEN  G++DV    E++DLY++K  ++ ++  IS+K
Sbjct: 226  IELKLNRGSLLLGNKFTPSVMILSYENGEGIIDVLPPKERLDLYRNKTHLELKNFEISIK 285

Query: 301  PNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESMFVNK 360
             N+ YD     +  +D GK+S++W TF+ ++ ++  P          KK    +  F  K
Sbjct: 286  QNIGYDDAIGLKFKLDTGKVSKLWKTFVRVLRVVTKPVIP----RRGKKAGPSDDAFFQK 341

Query: 361  WRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVPHGAH 420
            W+GLSLYK +  DA    LD+  +DF + EYAKF+SILKCP  TLSY +D PG+VPHGAH
Sbjct: 342  WKGLSLYKASAGDAKTSDLDDIEFDFTSHEYAKFTSILKCPKVTLSYDVDVPGVVPHGAH 401

Query: 421  QTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQIPIK 480
             T    DGPD+GN+G+PP+F +D+Q+   SI YGPW  RQVS+L R+LSPVVS+   PIK
Sbjct: 402  PTIPDIDGPDVGNNGAPPDFALDVQIHGGSICYGPWAQRQVSHLQRVLSPVVSRTAKPIK 461

Query: 481  KLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDFNLN 540
            KL PGSRR++T+F+M++ I+++++WRIPTRE SKD EF++ + KT++++RPFGW+D    
Sbjct: 462  KLPPGSRRVYTLFRMNILIMEDTTWRIPTRESSKDAEFLQHYKKTSEEYRPFGWMDLRFC 521

Query: 541  KGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLGWNS 600
            K T A FN S+ PT++G  N+F +HF++ E+ +SVNHDILLKSK FD+  DIGYPLGWNS
Sbjct: 522  KDTYANFNISVCPTVEGFKNDFHVHFVETEIRSSVNHDILLKSKVFDLDGDIGYPLGWNS 581

Query: 601  QADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGYSIY 660
               W  ++ ++QLE FLL+EHI+L +D  SDF++ DPTPYELFRPF Y +NW+++GYSIY
Sbjct: 582  NTIWIINMKSEQLEAFLLREHITLVADTLSDFSAGDPTPYELFRPFVYKMNWEMDGYSIY 641

Query: 661  LNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRLLLN 720
            LNVND NIVNNPLDFNENCYLSLHGD+L ID  +P   I   YT++++ I TPMFR++LN
Sbjct: 642  LNVNDHNIVNNPLDFNENCYLSLHGDKLTIDITVPRESILGTYTDMSYEISTPMFRMMLN 701

Query: 721  TPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYGVVI 780
            TPPWNTL+EFMK KEVGR++DF I+G YL+YS+LDIDNVD++T+ CTS ST L CYG V+
Sbjct: 702  TPPWNTLNEFMKHKEVGRSYDFTIKGCYLLYSELDIDNVDSLTINCTSNSTVLHCYGFVM 761

Query: 781  RYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGSFXXXXXXXXXXXXXXXXXLY 840
            RYL+NV+ NYFG+F +F+TSEEY+ +L     R   E  +                    
Sbjct: 762  RYLINVKMNYFGEFFNFVTSEEYTGVL---GAREVGEVVTKSSVVDLASTLDSEYQNGSM 818

Query: 841  TKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLFSELMISF 900
              + + + P ++R+D+ RT NE DIWFTF VW+GALILPE +Y+ + C +L F+EL++ F
Sbjct: 819  KNDAEDNGP-MKRSDLKRTTNETDIWFTFSVWNGALILPETIYSFDPCIALHFTELVVDF 877

Query: 901  RGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDVTIHAHRMFGL 960
            R  NYYMD +  L    I R ++   +E+F ++R  +      HG LSD+TIH HRM+GL
Sbjct: 878  RSCNYYMDIMAVLNGTSIKRHVSKQINEVFDFIRRNNGADEQEHGVLSDLTIHGHRMYGL 937

Query: 961  PPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVESSDDMTL 1020
            PP + TYFCQW I+ G L I+S+IEFL  FF  F K+GFGY++LEN L+Y  E+ +DMT 
Sbjct: 938  PPTEPTYFCQWDINLGELNINSDIEFLKGFFTSFYKVGFGYNDLENILLYDTETINDMTS 997

Query: 1021 LTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFSISIFDVRN 1080
            LT++ E++ I ++D V + Q+ + +  L    IDF+NERYS+RI++K+P+ ++S+  V  
Sbjct: 998  LTVHAERINISLNDPVMKSQSIVSVESLLFTLIDFENERYSQRIDIKVPKLTVSLSCVMG 1057

Query: 1081 PTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPTMYQESFLY 1140
                   L F+TK+ FTNF   +D     + QR YI ++DSPYHRC F+LP  YQ+S  Y
Sbjct: 1058 DGTNTSFLNFETKLRFTNFGQYKDSDKKRSEQRRYIMMNDSPYHRCPFLLPLFYQDSDTY 1117

Query: 1141 NELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLE--NPFLNIRSINNLDTSSL 1198
             +LYG I PS SIP LP+P LP+TID+++ED + EY+ LLE  NPF ++ +        L
Sbjct: 1118 QKLYGAIAPSSSIPTLPLPTLPDTIDYIIEDIVGEYATLLEATNPFKDLFAETPSTVEPL 1177

Query: 1199 FNEYRVDTYISEKAIFKAEEKNTV-NYDPKYEYDNYILNVEYIRVDINPLFSDFIDSMST 1257
               +  D    E+A    E K      +  +E DNY+++V YI +DI+PL   F  S+  
Sbjct: 1178 RASFTEDD--DEEAADPLEFKPVAFTEEINHERDNYVIDVSYILLDIDPLLFVFTKSLLE 1235

Query: 1258 KLYSENXXXXXXXXXXXXXXXLGSPKKVLLRETNLKLKISYVDIFWGSRNSEGIEIYLDK 1317
            + YSE+               L + ++ ++  +N+ + ++Y+++ W     EG E+YLD+
Sbjct: 1236 QFYSEDMVQVLDDIEIGIVKRLSNLQEGIVSISNIDIHVAYLNLIWQETGEEGFELYLDR 1295

Query: 1318 LDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEIEYERPPALSLTVEGLEVW 1377
            ++++M ++  +        E  +L+K+K++R + ++ +  E+  +RPPALSL +EG EVW
Sbjct: 1296 INYQMSEKSLEKNRTSKSLEVAVLAKVKTVRATVNQKKNPELSEDRPPALSLGLEGFEVW 1355

Query: 1378 SCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGSVDLLQKRDVTLQKSL 1437
            S T   Q NS+N+ S+DIT+D SQ  WL +Y + Q      +  SV+ +Q    + +  L
Sbjct: 1356 SSTEDRQVNSLNLTSSDITIDESQMEWLFEYCSDQGNLIQEVFTSVNSIQNTRSSTKTEL 1415

Query: 1438 ISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLRHILNYLPEGWEKS 1497
            ISKLT ASEYYQI HDPYVITKPA IMRLS  HVRENRSW+I+TRLRHIL YLP+ W+ +
Sbjct: 1416 ISKLTAASEYYQISHDPYVITKPAFIMRLSKGHVRENRSWKIITRLRHILTYLPDDWQTN 1475

Query: 1498 SIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFLPDIEK---NLINNT 1554
                ++ R      D KN+F+SVFS WRNWE SDVARSYIY ++FL D  K   N I   
Sbjct: 1476 IDKVLKERKYSFAKDAKNIFMSVFSTWRNWEFSDVARSYIYGKLFLADHAKHKGNSIKKL 1535

Query: 1555 TKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPKAATANKNDKIYDITGTVG 1614
             K  M SFY T+Y + Y V+HN VV   N+++D       P  + ++  ++  +ITG VG
Sbjct: 1536 LKCTMGSFYLTVYGEGYEVEHNFVVADANLVVDLT----PPVTSLSSNREETIEITGKVG 1591

Query: 1615 TFKGELGDQLIRLKKLYSEDKAKIRSEKS-TDFSIPKFFKINIVLIVEKGELTLAAANTK 1673
            + KG+  D+L++L+ L     A    +KS     + K FK+N VL+V+K E+ +    TK
Sbjct: 1592 SVKGKFSDKLLKLQDLIPLVVAVTEDDKSDPKAELSKQFKMNTVLLVDKSEIQVVMDKTK 1651

Query: 1674 LISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNELILLDAHLDDLFISVIAE 1733
            ++SR   G++S  +EN +D  + +GS+V ++ ++E+WLKH   IL +A L D  I    E
Sbjct: 1652 VMSRTVGGRVSLLWENLKDSTSQAGSLVIFSQKSEVWLKHGSTILGEAQLCDFSILATTE 1711

Query: 1734 LLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRLTDKDNKKRHTSTSP 1793
                KPTILVN + + L F+A+  T+ +V  + E +  + K+  ++  K   K  +    
Sbjct: 1712 AWSHKPTILVNNQCADLHFRAMSTTEQMVNAITEIKESVLKVKEQIKFKPKSKNKSQ--- 1768

Query: 1794 IFSTKKXXXXXXXXXXXXXXXXVILSPFTVKHSMKELKIVFNREGDNDTIFSILDADLYL 1853
             F   +                + LSPF ++H  K+L I FN+ G N+ + SI D D ++
Sbjct: 1769 -FVGSRINTVLSCYFSNVSSEIMPLSPFYIRHEAKQLDIYFNKFGSNEILLSIWDTDFFM 1827

Query: 1854 TSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKLTLADPKKITNSLLQDEKT 1913
            TS+Q   QY R S+ DI ++   +     LI ++I  S+IKLT ++P++I NS LQDEK 
Sbjct: 1828 TSHQTKEQYLRFSFGDIEIKGGFSKEAYSLINVDISISMIKLTFSEPRRIVNSFLQDEKL 1887

Query: 1914 FEQSLESIKTLNTLFSSNREVRTSAVDNPYKFMVNFDL----TYFGLLFPVDTSYFILEL 1969
              Q +  + +LN+LF +   +     + P K M+N+ L    +YFG+L PV ++YF+ EL
Sbjct: 1888 ASQGINLLSSLNSLFLTTDPMNAKK-ETPAK-MINWTLDTNISYFGILVPVASTYFVFEL 1945

Query: 1970 HSLLATFSNVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSKVLDFSVNLSTETKIL 2029
            H LL + +N        + ++T  L+++N LF+IK   +   +SK+LDFS+ +ST  +  
Sbjct: 1946 HMLLLSLTNTNNGLLPEQTRLTGQLSIENILFLIKERSLPIGLSKLLDFSIKVSTLQRTA 2005

Query: 2030 NSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYY-KEHT----RLQIFKTKKKAS 2084
            ++++SF+VESSHFRVCL+P+SLL+++ G ++     +YY K H      +++F  K    
Sbjct: 2006 DTEQSFQVESSHFRVCLSPDSLLRLIWGAYKLLDMVQYYSKRHAPNIWNIRMFTGK---- 2061

Query: 2085 VVSENLIGAPLIEYSIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAYEDSYGKLTVV 2144
              S+     P+   SIH LSY FCIGW+F+      PGL+ GY+RLFSAYE  +GK T+V
Sbjct: 2062 --SDKPKEIPINFRSIHILSYKFCIGWLFQYGAGDDPGLMFGYNRLFSAYEKDFGKFTIV 2119

Query: 2145 DGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYGETIDVR 2204
            D FFS++NG +S TF+S+GNEKEKYNRS+LPN+QI YW K    +K  F RF+GE +DV 
Sbjct: 2120 DAFFSVSNGNTSSTFFSEGNEKEKYNRSFLPNMQISYWFKRCGELKDWFFRFHGEALDVN 2179

Query: 2205 FLSNFATIINLTIESVQHFQMIKKETV---REMNVE---AEKKVGEDDISTKFSLFFSKV 2258
            FL +F  +I+ T++S++ FQ +KK  +    E N+E    +     ++ S   + F   +
Sbjct: 2180 FLPSFMDVIDSTLQSIRAFQELKKNILDMPHESNMENSSPDAAPNTENASNSLAPFLDNI 2239

Query: 2259 QRINCQCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDMKKPHWIRSFIN 2318
            + +NC   YDGGVF VY        +E + E+ +P V I+  YK+     KPH IR+ I 
Sbjct: 2240 RSVNCNFKYDGGVFRVYTYDDIEAKSEPSFELKSPVVTINCTYKHDESKAKPHRIRTLIT 2299

Query: 2319 IEPTYNTLLSQFASFLTEFGESVHEMVAKFSPKEQPPA-PKTVSPPIDYKRILEDFDVSF 2377
            ++PT+NTL +  A  L EF ES+  M+ K S  E+ P   K  +  +DYKR+L+ FDV+ 
Sbjct: 2300 VDPTHNTLYAGCAPLLMEFSESLQNMIKKHSTGEKKPNFTKPSTQNVDYKRLLDQFDVAV 2359

Query: 2378 SISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDIKTSINHEF 2437
             +++ KQ++SLSCEP AKV A+VGFESF+FS+ TN+ D  +PL  SLT+   K SI H F
Sbjct: 2360 KLTSAKQQLSLSCEPKAKVQADVGFESFLFSMTTNEFDSEQPLGFSLTLEQTKASIKHIF 2419

Query: 2438 STEPTASFSVDFVDITTLFTHPDI---YGTTLISDVSLYFNIKQLQNLMVFLDIWNLKRL 2494
            S E + SF V F+D+T LFTHPD+   YGT+L+SDVS++FN+KQLQNL +FLDIW    +
Sbjct: 2420 SREVSTSFEVGFMDLTLLFTHPDVISMYGTSLVSDVSVFFNVKQLQNLYLFLDIWRFSSI 2479

Query: 2495 IKLRPQKSVPVKKPEXXXXXXXXXXXXXXIIPWSFTVIITDINGDIHXXXXXXXXXXXXX 2554
            +  RP +    K+                 IPW FT+I T+++GD+              
Sbjct: 2480 LHTRPTQRPNNKEVNMSTLSSNSNVDVGTEIPWCFTLIFTNLSGDVDLGPSLGVISLRSQ 2539

Query: 2555 XXWISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRY-VENEKLDQSPL 2613
              W++T+H+ ++R+ L  FTD +SLTS GRL GL +VAN SW+  V++ +EN K +  PL
Sbjct: 2540 RTWLATDHYDEKRQLLHAFTDGISLTSEGRLSGLFEVANASWVSEVKWPLENSK-NTHPL 2598

Query: 2614 VDITLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLHLVCDEIDICS 2673
            V  +LN+++VAVKAAFDYHMFLIG ++NI F+L +EKD  G LPDLL++    DEI + S
Sbjct: 2599 VSTSLNIDDVAVKAAFDYHMFLIGTINNIRFHLHNEKDSKGILPDLLQVSFSSDEITLSS 2658

Query: 2674 TALVASNILDISNTISRTRQDSRNSYIETLLESNPPPQKSSISYTDILKSLNLLRTDVGI 2733
            TALVA+NILDI NTI R RQD++ SY+ETL +SNP   K  I Y DIL+SL LLRTD+ +
Sbjct: 2659 TALVAANILDIYNTIVRMRQDNKISYMETLRDSNPSESKQPILYKDILRSLKLLRTDLSV 2718

Query: 2734 EIHKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKATLSLSKSNEE 2793
             I  ++VQISPISLFDVEV+V  ++ VS RS T SG+KL TDLQ+++   + +LS S EE
Sbjct: 2719 NISSLKVQISPISLFDVEVLVVRIDKVSIRSETHSGKKLKTDLQLQVLDVSAALSTSKEE 2778

Query: 2794 LDEEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYLFACKFHDKIS 2853
            LDEE  + I++DDYM YA K+ GG I+ IPKL V MTT Q E +  +EYLFAC F DKIS
Sbjct: 2779 LDEEIGASIAIDDYMHYASKIVGGTIIDIPKLAVHMTTLQEEKTNNLEYLFACSFSDKIS 2838

Query: 2854 VRWNLGPVNFIKEVWATHVKSLAVRRAQLK----GDKEPQLVPGIIGXXXXXXXXXXXXX 2909
            VRWNLGP+NFIKE+W THVK+LAVRR+Q      G  E +L   I               
Sbjct: 2839 VRWNLGPINFIKEMWTTHVKALAVRRSQTANISFGQTEEELEESI--------------- 2883

Query: 2910 XXXXXXXXXXXXXXXXXXXKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFPRVT 2969
                               KF Y+ L+EPQIE+P+I+DL +ATPP+EWFGVNRK+ P+ T
Sbjct: 2884 ------------KREENASKFNYIALEEPQIEVPQIRDLGEATPPMEWFGVNRKRLPKFT 2931

Query: 2970 HQTAIILIQKIVHVAQKEYAKVLGDS 2995
            HQTA+I +QK+V++A+K+Y K+L D+
Sbjct: 2932 HQTAVIPVQKLVYLAEKQYVKILDDT 2957

>NCAS0B05010 Chr2 complement(922165..931023) [8859 bp, 2952 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2952

 Score = 2621 bits (6794), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1348/3016 (44%), Positives = 1923/3016 (63%), Gaps = 85/3016 (2%)

Query: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60
            M+  SQF  + L R++ FSW+FL  W+LT I SL+ IFYL R    I TFIL W +WK  
Sbjct: 1    MDAVSQFQGVPLTRQRNFSWIFLVTWILTVILSLSFIFYLGRTIAYIITFILEWLLWKHA 60

Query: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120
            KVK+NI+S+R+S LGG +F KN++II++D T+S LE  I WRYWL N+R+ E++ +A++ 
Sbjct: 61   KVKVNIQSLRISLLGGRIFFKNVTIIHKDSTISILEGNITWRYWLFNTRKPEFQ-EASVD 119

Query: 121  SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS 180
              Q++ +         KN +LPC  ++  +G E+F+YN+  AY+N++++F+KEER +F  
Sbjct: 120  ETQTKPTSI-------KNWQLPCRFVVNLEGLEIFLYNKTVAYDNIIQMFSKEERFQFEK 172

Query: 181  FLNEHDLGDIVSEDTNVNSMDKDYFXXXXXXXX--XXXXXINDRTYKKNKDERKSILFNF 238
            FLNE     I+S+   V SMD   F                NDR +++ + +  S L  F
Sbjct: 173  FLNEQ----ILSDSATVKSMDDSQFDTSESTSTDKSESSATNDRVFQEEETDTSSFL-RF 227

Query: 239  LPIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNIS 298
            LPIQ  +  G++ LGN+FTPSL++ S ++ + ++D +   EK+DLYK K++ +  +   +
Sbjct: 228  LPIQFLVTRGSLILGNKFTPSLLIVSADSADALMDFAQPKEKLDLYKFKLSAELINTEAT 287

Query: 299  VKPNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESMFV 358
            +K N+ +D + + +  +D+GK+S +WN F  ++ ++  P  +  H H +K EH  E  F 
Sbjct: 288  LKQNIGFDEDVSMKFKLDRGKVSEVWNHFTRMLGILYKPL-RFTHMHRRKNEH--EDKFQ 344

Query: 359  NKWRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVPHG 418
             KWRGL+LYK       R  +D+  +DF N EYAKFSSILK P  T +   D PGIVPHG
Sbjct: 345  AKWRGLALYKGTGLGERRNDIDDIEFDFANHEYAKFSSILKSPKVTFTSQHDMPGIVPHG 404

Query: 419  AHQTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQIP 478
            AH T    DGPD+GNSG+PP++ +D+Q+   S+ +GPW  RQ  +L ++LSPVVS+   P
Sbjct: 405  AHPTISVLDGPDVGNSGAPPDYSLDIQIFGGSVCFGPWAQRQADHLWKLLSPVVSRTAKP 464

Query: 479  IKKLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDFN 538
            +K+L PG RRI+T  ++ V I+D+++WRIPTRE SKD EF++ + +TN ++RPFGW+D  
Sbjct: 465  VKRLTPGCRRIYTYGQVLVTIMDDATWRIPTRESSKDFEFLQHYRETNGEYRPFGWIDLK 524

Query: 539  LNKGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLGW 598
             +K T     F+L PT+DG  NN  IH  + E  +SVNHDILLK K FD   D  +PLGW
Sbjct: 525  FSKETTVNTTFALCPTVDGFKNNIKIHLTENETRSSVNHDILLKCKYFDFDIDTSFPLGW 584

Query: 599  NSQADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGYS 658
            N +A W  ++ + Q+E F+L+EHI+L +D  +DF+S +PTPYELFRPF YS+NW I+GYS
Sbjct: 585  NDEATWTINLNSSQMEAFILREHITLIADTLTDFSSGEPTPYELFRPFIYSINWKIDGYS 644

Query: 659  IYLNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRLL 718
            +YLNVND NIVNNPLDFNENCYLS HGDEL +D LIP   I+  +T+I++ I TPMFRLL
Sbjct: 645  LYLNVNDHNIVNNPLDFNENCYLSFHGDELSLDFLIPKTSITARHTDISYTIKTPMFRLL 704

Query: 719  LNTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYGV 778
            LNTPPWNTL+EFMK KEVGR++DF + GSYLIYSDLDIDNVDTI M+CTS+ TTL CYG 
Sbjct: 705  LNTPPWNTLNEFMKHKEVGRSYDFKVVGSYLIYSDLDIDNVDTIMMDCTSKGTTLQCYGF 764

Query: 779  VIRYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGSFXXXXXXXXXXXXXXXXX 838
            V+RYL+NV+ NYFGDF HF+TSEEY+  +     R+N++   +                 
Sbjct: 765  VVRYLINVKMNYFGDFFHFVTSEEYTGAI-----RANEDDMQYASESDDDRSSISSFDTM 819

Query: 839  LYTKEQDLSKPH--VRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLFSEL 896
                     + H  ++R+D+ RT NE D+WFTF VW+GAL+LPE +YN + C  L F EL
Sbjct: 820  QGNDAPGRRRLHTELQRSDLKRTTNETDLWFTFTVWEGALLLPETIYNCDPCVGLHFGEL 879

Query: 897  MISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDVTIHAHR 956
            +I  R  NYYMD L N+ D+ I R+++  P EIF  +   +      HG+LS +TIH HR
Sbjct: 880  VIDLRSCNYYMDLLANMNDVSIKRYVSKHPHEIFEAIHKNNGEEYHTHGSLSSLTIHGHR 939

Query: 957  MFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVESSD 1016
            M+GLPP + TYFCQW  D G+L I S+IEFL  FF  FT++GFGY +LEN L+Y+ E+ D
Sbjct: 940  MYGLPPMEPTYFCQWDFDLGTLDIASDIEFLRGFFSSFTRIGFGYVDLENILLYEKETYD 999

Query: 1017 DMTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFSISIF 1076
            DMT +T+  EK+ +++ +      AS ++  L    IDF+NE+YS R++L IP    S+F
Sbjct: 1000 DMTSVTVNLEKLSVMLQEPKLNMYASFDLNNLYFTFIDFENEKYSTRLDLIIPTLEFSLF 1059

Query: 1077 DVRNPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPTMYQE 1136
                      L   +TK+  TNFV  +DF      QR YI LHD+PYHRC FILP  YQ+
Sbjct: 1060 IKEEDGTTKKLFTLETKVKITNFVQSQDFDEHRKTQREYIKLHDAPYHRCSFILPQEYQD 1119

Query: 1137 SFLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLE--NPFLNIRSINNLD 1194
            +  Y EL+G I PS S+P LP+P++P+T DF++ED L E+ DLLE  +PF    S  +  
Sbjct: 1120 AEQYQELFGAIAPSSSLPPLPVPLIPSTTDFIIEDLLGEFQDLLETSSPFRMPFSDQDYA 1179

Query: 1195 TSSLFNEYRVDTYISEKAIFKAEEKNTVNYDPKYEYDNYILNVEYIRVDINPLFSDFIDS 1254
            T    +E   D    E   F    +   N   K E D++I++V +I ++I P   D +DS
Sbjct: 1180 TDVSDDETEEDIDPLE---FNTPSEAIQN--DKCERDSFIIDVSFISIEICP---DILDS 1231

Query: 1255 MSTKLY---SENXXXXXXXXXXXXXXXLGSPKKVLLRETNLKLKISYVDIFWGSRNSEGI 1311
            + T L    +EN               L + ++   + TN+K+ I Y+D+FWGSR   G+
Sbjct: 1232 IGTFLMLFSTENIVQIIDDIEIATVNRLSNLREGAFKLTNVKINILYLDLFWGSRTDTGV 1291

Query: 1312 EIYLDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEIEYERPPALSLTV 1371
             IYLD++DF M ++  ++  ++ L E T+L+K++S+R + ++T       ERPPALSL +
Sbjct: 1292 GIYLDRIDFAMCEKTVEENKEKKLIELTVLNKIRSVRGTVNQTAANSKNEERPPALSLVI 1351

Query: 1372 EGLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGSVDLLQKRDV 1431
            EG E+WS T   Q NS+NILSTDITVD +Q  WL  Y + Q     ++  + D +QKR +
Sbjct: 1352 EGWEIWSSTVEDQVNSLNILSTDITVDEAQLEWLFGYFDNQGLQIQDMIKTSDTIQKRKI 1411

Query: 1432 TLQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLRHILNYLP 1491
              +K LIS LT ASEYYQI HDPYVITKPA I RLS  HVRENRSW+I+TRLRHIL YLP
Sbjct: 1412 ESRKELISSLTAASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLP 1471

Query: 1492 EGWEKS-SIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFLPDIEKNL 1550
            E W  + + +  +++   +  D K +F+SVFSNWRNWE SD+ARSYIYR++FL       
Sbjct: 1472 EDWHSTINRSLTQSKTAATTQDAKGIFISVFSNWRNWEFSDIARSYIYRKLFLNQHSNQE 1531

Query: 1551 INNTTK---IGMESFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPKAATANKNDKIY 1607
            I+ T K   I + SF+ T+YS  Y V+HN ++TR N+    +L    P + ++   + I+
Sbjct: 1532 IHTTKKSITIKIASFFVTVYSAGYEVEHNFIITRTNL----LLETNSPTSDSSLSRETIF 1587

Query: 1608 DITGTVGTFKGELGDQLIRLKKLYSEDKAKIRSEKSTDFSIPKFFKINIVLIVEKGELTL 1667
            +ITGT+GT KG+L D++I +K L    K     +    F   K FK+N +++ E+GEL +
Sbjct: 1588 NITGTLGTAKGKLSDKIIMIKNLLPSLKITDGGKSKETFDFVKSFKLNTLILCERGELQI 1647

Query: 1668 AAANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNELILLDAHLDDLF 1727
               NT+L+SR+   ++S  +E+ +D+ + + S+  Y  R E+ LKH    L +  + D  
Sbjct: 1648 DIGNTRLVSRVFGARLSMLWESPKDLTSQAVSLAVYTQRAEIHLKHINATLAEIQIRDFS 1707

Query: 1728 ISVIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRLTDKDNKKR 1787
            + V  E    KPTILVN + S L   A+  T  LV  ++E    I +I   L      ++
Sbjct: 1708 LIVTTESWSYKPTILVNSQCSDLHLMAMTATDILVASIKEIMENIHRIEQDLLAGTRAEK 1767

Query: 1788 HTSTSPIFSTKKXXXXXXXXXXXXXXXXVILSPFTVKHSMKELKIVFNREGDNDTIFSIL 1847
             T         K                + +SPF ++H  K+L I FNR G N+ + S+ 
Sbjct: 1768 ITKVESHGPKPKVNTILTCFFTNISFELMPISPFFIRHEAKQLDIYFNRFGSNEILLSVW 1827

Query: 1848 DADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKLTLADPKKITNSL 1907
            DAD+YLTS+    QYFR S+ D+ L+  + +     I + +  S++KLT++D +K+  S 
Sbjct: 1828 DADIYLTSHLTKQQYFRFSFGDLQLKGNMVNDPYH-INLYLSASILKLTVSDVQKLIPSF 1886

Query: 1908 LQDEKTFEQSLESIKTLNTL-FSSNREVRTSAVDNPYKFMVNFDLTYFGLLFPVDTSYFI 1966
            LQDEK   +S+E   TL+    S N++ +    +N + + ++ ++ YFGLL P+ ++YF+
Sbjct: 1887 LQDEKILTESIEDFITLDLFGLSKNQKSKPEKDNNKFSWSIDTNINYFGLLAPIGSAYFL 1946

Query: 1967 LELHSLLATFSNVYMN-PQQLKEKITCNLALQNTLFMIKSPEVNNQVSKVLDFSVNLSTE 2025
             EL  LLA+ + +  + P Q    I+   +++N LF IK   +  ++SK+LDFS+ +S  
Sbjct: 1947 FELRMLLASLTKMGSDIPNQ--SDISGQFSVENVLFFIKERALPVRLSKLLDFSIKVSAL 2004

Query: 2026 TKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQIFKTKKKASV 2085
             K  N+  ++++ESSHFRVCL+PESL+++L    Q S+S +YYK+H     +  + K + 
Sbjct: 2005 QKKKNTSNTYQIESSHFRVCLSPESLVRLLWATNQVSTSIQYYKDHHVDNKWDLRSKLNN 2064

Query: 2086 VSENLIGAPLIEYSIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAYEDSYGKLTVVD 2145
            + +     PL   S H LSYNFC+GW+F     S PGLI+GY+RLFSAYE + GKLT+VD
Sbjct: 2065 IPK-APDLPLNVPSFHILSYNFCVGWLFSVDSKSEPGLILGYNRLFSAYEKNLGKLTLVD 2123

Query: 2146 GFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYGETIDVRF 2205
             FFSIANG SSD F+S+G EK+KYNRSYLPN+QI YW K+   M+ LFVRF+GE +DV F
Sbjct: 2124 VFFSIANGNSSDNFFSEGKEKDKYNRSYLPNMQISYWFKDAGTMRDLFVRFHGEALDVTF 2183

Query: 2206 LSNFATIINLTIESVQHFQMIKKETVREMNVEAEKKVGED---DISTKFSLFFSKVQRIN 2262
            LS++  +I   + SVQ FQ +KK+ +    +  ++KV +D   +++T  S F + ++ I+
Sbjct: 2184 LSSYLDVIESALTSVQTFQELKKDLIP--GLPKKQKVNDDKTLELNT-LSPFLANIRSIS 2240

Query: 2263 CQCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDMKKPHWIRSFINIEPT 2322
            CQ  YDGGVF ++ +      +E + E+ +P V+ID++YK+  +  K HWIRS I I  T
Sbjct: 2241 CQFKYDGGVFKIFSLEDAETQSEPSFEVNSPNVVIDLNYKHLENRTKQHWIRSLIKINST 2300

Query: 2323 YNTLLSQFASFLTEFGESVHEMVAKFSPKEQPPAPKTVSPPIDYKRILEDFDVSFSISAG 2382
            +N L ++ A  L++F E +  MV K S  E+    K  S  +DYKR+L+ FD++  I++ 
Sbjct: 2301 HNILYAKCAPLLSDFFERIQGMVKKHSSSEESTLSKPSSQNLDYKRLLDSFDIALKITSA 2360

Query: 2383 KQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDIKTSINHEFSTEPT 2442
            KQ++SLSCEP AKV A++GF+SF+F++ TND D  EPLS SL+V   + SI H FS E +
Sbjct: 2361 KQQLSLSCEPKAKVQADIGFQSFIFTVTTNDLDAAEPLSFSLSVEKTEASIKHIFSRETS 2420

Query: 2443 ASFSVDFVDITTLFTHPD---IYGTTLISDVSLYFNIKQLQNLMVFLDIWNLKRLIKLRP 2499
             S  VDFVD+T +FTHPD   ++GT LIS+++L+FN+KQLQNL +FLDIW L  L+K +P
Sbjct: 2421 TSIGVDFVDVTLMFTHPDVINVHGTALISNINLFFNVKQLQNLYLFLDIWRLSDLLKSKP 2480

Query: 2500 QKSVPVKKPEXXXXXXXXXXXXXXIIPWSFTVIITDINGDIHXXXXXXXXXXXXXXXWIS 2559
               + VK                 IIPW FT+I T++ GD+                W +
Sbjct: 2481 ANDI-VKAKTDSSLSIAQLSDPESIIPWCFTLIFTNVKGDVDLGPSLGVISVQLKRTWFA 2539

Query: 2560 TNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRYVENEKLDQSPLVDITLN 2619
            T+H+++ RK L  FTD  SL+S GRL G+ ++   SWI  V +  +  ++  PLV IT+N
Sbjct: 2540 TDHYKNMRKVLHAFTDGTSLSSKGRLSGIFELKGASWISEVNWPTDTTINAHPLVSITMN 2599

Query: 2620 VENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLHLVCDEIDICSTALVAS 2679
            ++ ++ KAAFDYHMFLIG ++N   +L SEKD+ G +PDLLK+  +C+ I +CSTALVA+
Sbjct: 2600 IDEISTKAAFDYHMFLIGAINNTRVHLHSEKDVNGVMPDLLKVTFLCESITLCSTALVAA 2659

Query: 2680 NILDISNTISRTRQDSRNSYIETLLESNPPPQKSSISYTDILKSLNLLRTDVGIEIHKMQ 2739
            NILDI NT  R RQD++ SYIETL ESN    K  I+YTDIL+SLNLL+TDV ++I+ + 
Sbjct: 2660 NILDIYNTAMRMRQDNKISYIETLRESNEAESKPPINYTDILRSLNLLQTDVSVDIYTLN 2719

Query: 2740 VQISPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKATLSLSKSNEELDEEAV 2799
            +QISPI+LFDVEV+V T+E++SARS T SG+KLMT+L+M++Y A++SLS S EE+DE  V
Sbjct: 2720 IQISPITLFDVEVLVITIESISARSETHSGKKLMTELEMQVYDASVSLSTSKEEMDEATV 2779

Query: 2800 SEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYLFACKFHDKISVRWNLG 2859
            S+ISV +Y+ YA K+ GG I+ IPKL V MTT+Q E S I+EYL+ C F DK+SVRWNLG
Sbjct: 2780 SKISVKNYLQYASKIVGGTIIEIPKLLVSMTTFQEEKSDILEYLYTCVFDDKLSVRWNLG 2839

Query: 2860 PVNFIKEVWATHVKSLAVRRAQLKGDKEPQLVPGIIGXXXXXXXXXXXXXXXXXXXXXXX 2919
            P+NFIKE+W TH++++AVRR+Q+ G  + Q    +                         
Sbjct: 2840 PINFIKEMWTTHIRAIAVRRSQVVGVLDGQSEEDV-----------------------EK 2876

Query: 2920 XXXXXXXXXKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFPRVTHQTAIILIQK 2979
                     +F YV L+ P+I+MP+I+DL DATPP+EWFGVNRK+FP  THQTA+ L+QK
Sbjct: 2877 RIKEEENFSRFKYVALEPPRIDMPQIRDLGDATPPMEWFGVNRKRFPAFTHQTAVFLVQK 2936

Query: 2980 IVHVAQKEYAKVLGDS 2995
            +V+ A++EYA +LG S
Sbjct: 2937 LVYSAEREYANILGSS 2952

>KAFR0B02720 Chr2 complement(549702..558650) [8949 bp, 2982 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2982

 Score = 2560 bits (6636), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1305/3047 (42%), Positives = 1899/3047 (62%), Gaps = 118/3047 (3%)

Query: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60
            M   S+F S+ +   K FSWVFL  W+L  +  L+VIFY+ R    I + IL W +WK+ 
Sbjct: 1    MASSSEFQSVPISGGKNFSWVFLLDWILLVVLCLSVIFYVGRAIAYITSLILEWLLWKRA 60

Query: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120
             +K+NIES+R+S LGG +F KN++II++D+T+S L+  + WRYWLL +R+  Y ++    
Sbjct: 61   HIKVNIESLRISLLGGRIFFKNVTIIHKDYTISLLQGTLTWRYWLLKTRKPSYHLE---- 116

Query: 121  SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS 180
                  S  SN +T++KN +LPC  ++ C+G E+FVYNR  +Y+N++ LF+KEER KF  
Sbjct: 117  ------SKDSNGVTMKKNEQLPCRFVLHCEGAEIFVYNRTWSYDNIINLFSKEERIKFQK 170

Query: 181  FLNEHDLGDIVS-----------------EDTNVNSMDKDYFXXXXXXXXXXXXXINDRT 223
            FL+E    D  S                  DT +N  D   F              NDR 
Sbjct: 171  FLDEQIFNDHSSYSSKTTNGANSSTGESNSDTKLNDED---FVESGYSSQSTYNQNNDRI 227

Query: 224  YKKNKDERKSILFNFLPIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDL 283
            + + K ++ S+     P+++ +   ++  GN+FTPSLV+ S E+  G++D     EK+DL
Sbjct: 228  FDQAKSDKDSLFLQTFPVEIEVHRASLAFGNKFTPSLVIISSEHGTGIIDYCQPKEKLDL 287

Query: 284  YKSKVTMKFQDVNISVKPNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYH 343
            YK K+ ++  +  ++VKPN+ Y  E   +  ID+GKLSR+W  F  I  +I  P      
Sbjct: 288  YKMKLAIETHNFAVTVKPNIGYKEEMLLKFKIDRGKLSRLWKRFTPITGIITRPLGLT-- 345

Query: 344  KHMKKKEHDVESMFVNKWRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNF 403
               KKK ++   +F+ KW+GLSLYK  + +     LD+  +DFLN EYAKFSS++KCP  
Sbjct: 346  -QRKKKRNEPPDLFIQKWQGLSLYKGTIFEPTTDDLDDIQFDFLNHEYAKFSSVVKCPKA 404

Query: 404  TLSYYLDSPGIVPHGAHQTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSY 463
              +Y  D PG VPHGAH TN + DGPD+GN+G+PP   +D+Q+   SI YGPWT RQ+++
Sbjct: 405  IFTYEYDIPGCVPHGAHPTNSEIDGPDVGNNGAPPTHSLDIQIFGGSICYGPWTQRQMNF 464

Query: 464  LIRMLSPVVSKNQIPIKKLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFV 523
            +  ML+P VS+ + P+K+  PGS RI+T  K+S+ I+D+++WRI TREPSKD  F+K + 
Sbjct: 465  IHSMLAPAVSRTESPVKRRVPGSTRIYTATKLSISIMDDTTWRIATREPSKDNIFLKHYK 524

Query: 524  KTNDDFRPFGWLDFNLNKGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKS 583
            +TNDD+RPFGW+D   +K + A F F+L+PT +G  N+ +IH    E+ +SVNHDIL+K 
Sbjct: 525  ETNDDYRPFGWIDLRFSKESYAYFTFALVPTTEGFKNDINIHLAQNEIRSSVNHDILMKC 584

Query: 584  KEFDVVADIGYPLGWNSQADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELF 643
            K FD   D+ YPL WN +A W  D+ + QLETFLL+EHI+L +D  +DF S +PTPYELF
Sbjct: 585  KFFDFDIDVSYPLVWNDRATWTIDMNSNQLETFLLREHITLIADTLTDFTSGEPTPYELF 644

Query: 644  RPFTYSLNWDIEGYSIYLNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPY 703
            RP    +NW ++ Y IYLNVND NIVNNPLDFNENCYLSLHGD+L I+  IP+  I+  +
Sbjct: 645  RPSETFINWKMDAYFIYLNVNDHNIVNNPLDFNENCYLSLHGDDLLINVTIPSEDITAQF 704

Query: 704  TEIAFNIYTPMFRLLLNTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTIT 763
             EI +NI TPMFRLLLNTPPWNTL+EFMK KEVGR++DF  +GSYL+YS+LD+DNVDTI+
Sbjct: 705  NEITYNITTPMFRLLLNTPPWNTLNEFMKYKEVGRSYDFSAKGSYLLYSELDVDNVDTIS 764

Query: 764  MECTSRSTTLFCYGVVIRYLMNVQANYFGDFVHFITSEEYSEILQ---------KNNKRS 814
            + C SR TTL CYG VIRYL NV+ NYFGDF +FITSEEY+ I +          +N   
Sbjct: 765  IICESRGTTLQCYGFVIRYLANVKMNYFGDFFNFITSEEYTGITRDEELEEELISSNLSD 824

Query: 815  NDEQGSFXXXXXXXXXXXXXXXXXLYTKEQDLSKPHVRRADVLRTENELDIWFTFRVWDG 874
            N++ G                       ++   +  ++R+D+ RT NE D++ TF VWDG
Sbjct: 825  NEDNGDVYSDGESGMDDA--------ISQEIPERTTLKRSDLRRTANETDLFLTFSVWDG 876

Query: 875  ALILPEGLYNGNLCSSLLFSELMISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVR 934
            A+ILPE +YN + C++L F EL+I  R SNYYMD L +L D  + R+   SP +IF+ V 
Sbjct: 877  AIILPETIYNCDNCTALKFGELIIDLRSSNYYMDLLASLEDTVMERYTEKSPIDIFKSVL 936

Query: 935  DPDHNLNIVHGTLSDVTIHAHRMFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLF 994
              +   +   G LSD++IH HRMFGLPPN+ TYFC+W  D G L ++S  +FL  F   F
Sbjct: 937  HDNRESSEAQGFLSDLSIHGHRMFGLPPNEPTYFCKWDFDIGVLNVNSEFDFLKGFLTSF 996

Query: 995  TKLGFGYSNLENKLVYKVESSDDMTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSID 1054
            +++GFG+ +LEN L+Y  E  +DMT LT+  +++ + + ++VS    +L+   +   SID
Sbjct: 997  SRIGFGFKDLENILLYSKEVINDMTSLTVNAQEISVNLKNEVSGIDMALKTQHVNFTSID 1056

Query: 1055 FQNERYSKRINLKIPEFSISIFDVRNPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRT 1114
            F++  YS R++L IP   +S++ +     K  L  F TK+  T+F  K++F+   + QR 
Sbjct: 1057 FESANYSSRLDLIIPSLKMSMYGLDIDGKKARLFNFTTKVHLTDFAQKKNFKRHRSMQRN 1116

Query: 1115 YITLHDSPYHRCFFILPTMYQESFLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLK 1174
            YITL+D+ +HR  F+LP  +Q+  LYNELYG I PS S+P+L +P+LP T+DF++EDFL 
Sbjct: 1117 YITLNDAAFHRTSFLLPQSFQKKELYNELYGSIVPSSSLPVLALPILPKTVDFILEDFLG 1176

Query: 1175 EYSDLLENPFLNIRSINNLDTSSLFNEYRVDTYISEKAIFKAEEKNTVNYDPKYEYDNYI 1234
            EY  LL++     R+I  +   S     +  T+  E         +TV+ +  Y+ DN +
Sbjct: 1177 EYVSLLDD-----RTIFRMPFGSTNTPNQASTHHEEDMDPLEFSNSTVSTEKNYQCDNLV 1231

Query: 1235 LNVEYIRVDINPLFSDFIDSMSTKLYSENXXXXXXXXXXXXXXXLGSPKKVLLRETNLKL 1294
            +++EYI V+INP  S +I+S+S+ +Y EN               L + ++     TN+KL
Sbjct: 1232 IDIEYISVEINPSISTYIESLSSTVYEENIVQVIDDIEIETIKILSTFQEGTSSITNIKL 1291

Query: 1295 KISYVDIFWGSRNSEGIEIYLDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSET 1354
            ++ Y DI+WG R+  GIE+YLDKLDFEM QR  +   ++ L E T+L+K +S+R S SE 
Sbjct: 1292 RVLYSDIYWGERDRYGIELYLDKLDFEMSQRNIEKDREKGLLEITMLAKTRSIRASISEE 1351

Query: 1355 QYEEIEYERPPALSLTVEGLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVE 1414
               + E ERPPALSL VEG E+WS T   Q NSI+ +STDIT+D SQ  WL  ++N+Q +
Sbjct: 1352 GSTKNEKERPPALSLVVEGCELWSATAEKQVNSIDTISTDITIDESQLEWLFLFVNEQNQ 1411

Query: 1415 FFYNLKGSVDLLQKRDVTLQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVREN 1474
               N+  +++ +Q      ++ LISKLT A+++YQI HDPYVITKPA I RLS  HVREN
Sbjct: 1412 NLQNIITTLNSVQAEHTVSRRKLISKLTAANDFYQISHDPYVITKPAFITRLSKGHVREN 1471

Query: 1475 RSWRIVTRLRHILNYLPEGWEKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVAR 1534
            RSW+I+TRLRHIL Y+P  WE     +++ + +    + K VF+SVFSNWRNWE SDVAR
Sbjct: 1472 RSWKIITRLRHILTYIPSDWESGVENYLKEKSLNDQDEAKKVFMSVFSNWRNWEFSDVAR 1531

Query: 1535 SYIYRRVFL---PDIEKNLINNTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQMLS 1591
            SYIY R+FL    +  K  +    K+ + SF+ T Y+  Y +D N V+T  N++ +Q   
Sbjct: 1532 SYIYGRLFLTNQAEKHKQSMRRIIKVNLSSFFLTSYTAGYDIDQNFVLTNANIVFEQT-- 1589

Query: 1592 DEEPKAATANKNDKIYDITGTVGTFKGELGDQLIRLKKLYS-EDKAKIRSEKSTDF---S 1647
               P        +K+ ++TG++G+ KG   D+L+RLK+L    +K + + E+S  F   +
Sbjct: 1590 --PPFTEAGVSREKLINLTGSIGSVKGNFSDELLRLKELIPLLNKEQEKMERSPSFQVDN 1647

Query: 1648 IPKFFKINIVLIVEKGELTLAAANTKLISRIKNGKISGFFENARDVANASGSIVYYATRT 1707
            IPK FK+N +L+ EK E+ L    +KL +RI NGK+S   ++ ++  + +GSI+ YA R+
Sbjct: 1648 IPKSFKLNALLLFEKTEVQLVIGESKLTNRILNGKVSLLLDHPKEAISPAGSIILYAKRS 1707

Query: 1708 ELWLKHNELILLDAHLDDLFISVIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLRE 1767
            E  + H    L++  + D  +S   E    KPT+LV+ + +H   K++  T  LV  ++E
Sbjct: 1708 ETLITHRNTTLVENQVRDFSLSATVESWSSKPTVLVSTQCAHFHIKSMAKTATLVNSVKE 1767

Query: 1768 FEREISKITGRLTDKDNKKRHTSTSPIFSTKKXXXXXXXXXXXXXXXXVILSPFTVKHSM 1827
              + +  I  +L+  D      + SP    K                 + +SPF ++H  
Sbjct: 1768 MVQTVKNIDKQLSISDRLAEGENKSPKKKLKDVEIEVVCQLSNVSFEIMPISPFYIRHET 1827

Query: 1828 KELKIVFNREGDNDTIFSILDADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITIN 1887
            K+  + F + G  + +  + D D +L S     QYFR+S+ D  +   L + +  ++  N
Sbjct: 1828 KKFDLKFKQFGSQNVMIDVWDTDFFLRSDLTKQQYFRISFGDFQITYNLIEGEFIIVDAN 1887

Query: 1888 IVTSLIKLTLADPKKITNSLLQDEKTFEQSLESIKTLNTLFSSNREVRTS-AVDNPYKFM 1946
            +  S+IKLT ++P +I +S LQDE+T  +S + +K L        E R   A     +++
Sbjct: 1888 VSASMIKLTFSEPNRILSSFLQDERTASESFKLLKALKPFLLPQTEGRLQPATTKEMRWL 1947

Query: 1947 VNFDLTYFGLLFPVDTSYFILELHSLLATFSNVYMNPQQLKEKITCNLALQNTLFMIKSP 2006
            ++ D+ YFG+L P+ T+YF+ E H+L+ + S++       K++    ++++N +F+IK  
Sbjct: 1948 LDTDIKYFGILVPISTTYFVFETHALVLSMSDIDTEKYTEKDETQSQVSIENVVFLIKDR 2007

Query: 2007 EVNNQVSKVLDFSVNLSTETKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFK 2066
             + + +S++LDFS++ ST  K++    SF+VES+HFR+ L+P SL++++ G  Q      
Sbjct: 2008 GIPSALSRMLDFSISFSTIQKMMELDTSFQVESNHFRIFLSPYSLVRLVWGGQQFLGLAN 2067

Query: 2067 YYKEH--TRL-QIFKTKKKASVVSENLIGAPLIEYSIHFLSYNFCIGWIFENSQSSYPGL 2123
            YYKE   T L  I  +K K      + IG  +   S H LSYNFCIGW+F  + +S PG+
Sbjct: 2068 YYKEQRGTDLWDIKASKLKKEKKGSSSIGMNM--SSFHVLSYNFCIGWMFPEANASAPGI 2125

Query: 2124 IMGYDRLFSAYEDSYGKLTVVDGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWL 2183
            ++G+ RLFSAYE  YGKLT+VD FFS+A G +S TFY + +E E  NRSYLPN+QI YW+
Sbjct: 2126 MLGFSRLFSAYEGGYGKLTLVDAFFSVARGATSATFYPRESELESVNRSYLPNMQIAYWV 2185

Query: 2184 KEVDAMKQLFVRFYGETIDVRFLSNFATIINLTIESVQHFQMIKKETVREMNVEAEKKVG 2243
            K+   MK +F+RF+GE +DV FL+ F T+I   ++S Q FQ +K   ++  N    +   
Sbjct: 2186 KKSGLMKDVFIRFHGEALDVSFLTTFITVIESMLQSFQVFQELKTSLIQP-NTSTTENNT 2244

Query: 2244 EDDISTKFSLFFSKVQRINCQCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKY 2303
            E  I +  + F S ++ +NCQ  YDGGVF V+         E + E+ TP VIID +YK+
Sbjct: 2245 EPKIKS-LAPFLSNIKSVNCQFKYDGGVFKVFSFEDIESHLEPSFELKTPGVIIDFNYKH 2303

Query: 2304 RIDMKKPHWIRSFINIEPTYNTLLSQFASFLTEFGESVHEMVAKFSPKEQPPA-----PK 2358
             I   KPHWIR+ + I  T+NTL +  A  + EF E +HEMV K S   +  +      K
Sbjct: 2304 NIGSLKPHWIRALVAIGSTHNTLFAVCAPLIAEFLEHIHEMVKKHSSNTKHESIATNLSK 2363

Query: 2359 TVSPPIDYKRILEDFDVSFSISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTE 2418
              S  IDYKR+L+ FD++F +++ +QK+SLSCEP AKV A+VGF+SF+  I+TN+ D TE
Sbjct: 2364 APSQNIDYKRLLDGFDIAFKLTSSEQKLSLSCEPKAKVQADVGFDSFIIGIVTNNLDETE 2423

Query: 2419 PLSCSLTVNDIKTSINHEFSTEPTASFSVDFVDITTLFTHPDI---YGTTLISDVSLYFN 2475
            PL+ SL++   K SI H FS E + SF +D +D+  +FTHPDI   YGT LIS+V LYFN
Sbjct: 2424 PLTFSLSIKKTKASIKHIFSKETSTSFGLDLIDLNFMFTHPDIINMYGTGLISEVDLYFN 2483

Query: 2476 IKQLQNLMVFLDIWNLKRLIKLRPQKSVPVKKPEXXXXXXXXXXXXXXIIPWSFTVIITD 2535
            +KQLQNL +F+DIW L   I+  P+      K E               IPWSFT+I T+
Sbjct: 2484 VKQLQNLYLFIDIWKLSSFIRPGPKGKSNNGKRENKHLTLPQPSNLYGEIPWSFTLIFTN 2543

Query: 2536 INGDIHXXXXXXXXXXXXXXXWISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANIS 2595
            ING                  W++++H+QD+R+ +R FTD LS  S GRL G+ ++   S
Sbjct: 2544 INGSADLGPSLGVLSLKLKRTWVASDHYQDKRQVIRAFTDYLSFVSKGRLSGIFELDGAS 2603

Query: 2596 WILNVRYVENEKLDQSPLVDITLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGN 2655
            W+  V + + ++    PLV++++N++N+++KAAFDYHMFLIG +    F+L SEKD++G 
Sbjct: 2604 WMSEVSWPKEKRTHNYPLVNVSVNIDNLSLKAAFDYHMFLIGTISTAKFSLHSEKDIVGT 2663

Query: 2656 LPDLLKLHLVCDEIDICSTALVASNILDISNTISRTRQDSRNSYIETLLESNPPPQKSSI 2715
            +PDLLK++  C+ I+ICSTALVA+NILD+ NT+ R RQD++  Y+ETL ES+    + + 
Sbjct: 2664 MPDLLKVNFTCEMINICSTALVAANILDLYNTVMRMRQDNKILYLETLRESDTLETRGNP 2723

Query: 2716 -SYTDILKSLNLLRTDVGIEIHKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKLMT 2774
             +Y DIL+SLNLL+TDV   IH +++Q+SPI+LFD+EV+V  +EN+SAR+ T +GEKL T
Sbjct: 2724 DNYRDILRSLNLLQTDVSTNIHVLKLQVSPIALFDLEVLVINIENISARAGTFAGEKLKT 2783

Query: 2775 DLQMKIYKATLSLSKSNEELDEEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQL 2834
             L++++Y   ++LS S  E+DE+ VS ISV DYM YA K+SGG I+ +PKL + MT+WQ 
Sbjct: 2784 ILELEVYDGYVALSTSKREIDEDTVSAISVADYMEYASKISGGTIIEVPKLNIAMTSWQE 2843

Query: 2835 ENSKIIEYLFACKFHDKISVRWNLGPVNFIKEVWATHVKSLAVRRAQ------LKGDKEP 2888
            ENS I+EYL+ C F DKI+V+WNLGPVNFIKE+W THVK+LAVRR+Q      ++ D+E 
Sbjct: 2844 ENSDILEYLYKCTFEDKIAVKWNLGPVNFIKEMWTTHVKALAVRRSQNVLDTDMQTDEEV 2903

Query: 2889 QLVPGIIGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKFIYVPLKEPQIEMPKIKDL 2948
            Q                                       K  YVP++EP+I+MP+I+DL
Sbjct: 2904 Q-----------------------------KRIKEEENISKLKYVPIEEPRIDMPQIRDL 2934

Query: 2949 EDATPPLEWFGVNRKKFPRVTHQTAIILIQKIVHVAQKEYAKVLGDS 2995
             DATPPLEWFGVNRK+ P  THQT ++ +QK+VH A+K+YA +L +S
Sbjct: 2935 GDATPPLEWFGVNRKRLPAFTHQTVVVPVQKLVHAAEKQYASLLDNS 2981

>TDEL0F03870 Chr6 complement(713797..722625) [8829 bp, 2942 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2942

 Score = 2550 bits (6609), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1322/3027 (43%), Positives = 1899/3027 (62%), Gaps = 122/3027 (4%)

Query: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60
            ME  SQF  +SL  E+ FSWVFL  WVL C+ +LTVIFYL R+F    T +L W +WK +
Sbjct: 1    MEGQSQFERVSLSNERNFSWVFLVDWVLLCVVTLTVIFYLGRLFAYAITLVLEWFLWKHW 60

Query: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120
            KVKI++ES+R++ L G++  +N+ II +D T+S L+  ++WRY LL +R  +Y+  ++  
Sbjct: 61   KVKISVESLRIAPLSGSILFRNLCIIGKDQTISILKGSLRWRYRLLATRRSQYEEASSQK 120

Query: 121  SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS 180
                 G +  NSM   KN  LPC  ++ C+GFE+F+YNR  AYEN++++F++EER +F  
Sbjct: 121  DGLGVGEEDVNSM---KNITLPCRFVLFCEGFEIFIYNRTVAYENIIQMFSREERVQFEK 177

Query: 181  FLNEHDLGDIVSEDTNVNSMDKDYFXXXXXXXXXXXXXINDRTYKKNKDERKSILFNFLP 240
            F+++ ++ ++    +   S DK                INDR + +  +++KSI   FLP
Sbjct: 178  FMSKQEMSELFHCHSE-RSDDKGSTDSVLSSSVSDVPNINDRVFDEVHNQKKSIFMRFLP 236

Query: 241  IQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNISVK 300
            ++L+L  G++ LGN+FTPSL++AS  +  GV+D+    EK+DLYK    + F D++IS++
Sbjct: 237  MELQLSRGSIVLGNKFTPSLLIASCTSGRGVVDLCQPKEKLDLYKMHFQVDFIDIDISIR 296

Query: 301  PNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESMFVNK 360
             N+ Y+ +   +     GKLSR+W TF+ ++ +   PF   Y+K    K  + E  F+ K
Sbjct: 297  QNIEYNRK---KATFKNGKLSRMWATFVKVLHI---PF---YNKSHNNKGTESEP-FMTK 346

Query: 361  WRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVPHGAH 420
            W+GL LYK    D      DE  +DF N EYAK S+I+K P   L+Y  D PG+VPHGAH
Sbjct: 347  WKGLGLYKGLTFDRDGEDYDEVHFDFANHEYAKVSNIIKSPRTVLTYSYDIPGVVPHGAH 406

Query: 421  QTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQIPIK 480
             T    +GP++GN+G+PPEF +DLQ    +I YGPW  R++ +L+RM+SP V+++ +PIK
Sbjct: 407  PT---LEGPEVGNNGAPPEFGIDLQFYGVTICYGPWAQREIQHLLRMISPTVARSSVPIK 463

Query: 481  KLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDFNLN 540
             L PGSRRI+TVFK +  ++D SSWRIPTRE SKD+EF+K+F  T++++RPFGWLD    
Sbjct: 464  TLSPGSRRIYTVFKTTFRVLDGSSWRIPTRERSKDQEFLKKFKATSEEYRPFGWLDLKFA 523

Query: 541  KGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLGWNS 600
              +  +    L P  +G  N   IHF +ME T+SVNHD++LK   FDV  D+GYPLGWNS
Sbjct: 524  MDSYGSVTTVLCPKEEGFPNKMYIHFAEMEATSSVNHDVMLKCNCFDVAGDVGYPLGWNS 583

Query: 601  QADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGYSIY 660
             A W  ++ + QLETFLL+EH++L +D+F+DF+S +PTPYELFRPF Y +NW I+GYSIY
Sbjct: 584  SATWTINLHSTQLETFLLREHVTLVADIFTDFSSGEPTPYELFRPFIYQINWIIDGYSIY 643

Query: 661  LNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRLLLN 720
            LNVND NIVNNPLDFNENCYLSLHG+EL ID   PN  I+  Y ++ + I TPMFRLLLN
Sbjct: 644  LNVNDHNIVNNPLDFNENCYLSLHGEELLIDVTAPNDSITGAYMDVPYKISTPMFRLLLN 703

Query: 721  TPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYGVVI 780
            TPPWNTL+EFMK+KEVGR++ F + G Y +YS+LDIDNVDT+++ECTS  TTL CYG V+
Sbjct: 704  TPPWNTLNEFMKNKEVGRSYSFAVCGLYTVYSELDIDNVDTLSVECTSTGTTLHCYGFVM 763

Query: 781  RYLMNVQANYFGDFVHFITSEEYSEILQKNNKRS--NDEQGSFXXXXXXXXXXXXXXXXX 838
            RYLMNV+ NYFGDF HFITSEEY+ +++   K S    E+ S                  
Sbjct: 764  RYLMNVKMNYFGDFFHFITSEEYTGVIRAKEKESVGKTEEESL-----------RDNSTN 812

Query: 839  LYTKEQDLSKPHVR--------RADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSS 890
            L T    LS P+VR        R+DV RT NE DIWFTF VW+GAL+LPE +YN + C +
Sbjct: 813  LSTDSGGLSDPYVRLRADPPVSRSDVKRTTNETDIWFTFSVWEGALVLPETIYNCDPCVA 872

Query: 891  LLFSELMISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDV 950
            L F EL++  R  NYYMD L  +    I R+++    E+F  +R  +      HG+L+ +
Sbjct: 873  LHFGELIVDLRSCNYYMDLLATMSSTSIKRYVSRQSHELFESIRRDNGRTEKEHGSLAAL 932

Query: 951  TIHAHRMFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVY 1010
            TIH HRM+GLPP + TYFCQW ID   L I+S+ EF   FF LF  +GFGY+NLEN L+Y
Sbjct: 933  TIHGHRMYGLPPIEPTYFCQWGIDLDGLTINSDAEFAKGFFTLFAGIGFGYTNLENTLLY 992

Query: 1011 KVESSDDMTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPE 1070
             VE+ DDMT +T+    + ++V +D S  +A +++  L   SIDF+NERYS+RI+LK+P 
Sbjct: 993  DVETPDDMTSVTVRVRDMNVVVENDSS--RAVVDVPNLTFTSIDFENERYSQRIDLKVPS 1050

Query: 1071 FSISIFDVRNPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFIL 1130
             SI +    + +    L+   TK+  T+F+ K DF    + QR YITL+DSP++RC F+L
Sbjct: 1051 LSILLLTSEDDSEPIRLMDLTTKVYLTDFIQKRDFAKHRSKQRDYITLNDSPFYRCSFLL 1110

Query: 1131 PTMYQESFLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLENPFLNIRSI 1190
            P   QES LY  L G I+PS S+P LP+P+L  TIDF++ED L E++  L+  +   R++
Sbjct: 1111 PCYLQESPLYKSLLGSISPSSSLPPLPMPLLAETIDFIIEDLLGEFAAGLKCDYDTQRTV 1170

Query: 1191 NNLDTSSLF----------NEYRVDTYISEKAIFKAEEKNTVNYDPKYEYDNYILNVEYI 1240
            ++ D+ S            ++ R D +        A+    ++ +P  +YDN I++V+++
Sbjct: 1171 DDPDSPSESFDTSQEHEGPDDVRYDRF--------AQLPKILSPNPLEQYDNVIIDVKFL 1222

Query: 1241 RVDINPLFSDFIDSMSTKLYSENXXXXXXXXXXXXXXXLGSPKKVLLRET---NLKLKIS 1297
             VD++PL   ++D +  + +  N               LG     L   T   NLKL + 
Sbjct: 1223 AVDLDPLICSYVDGLLGEFWKVNTVDIIDEIEMSIVKRLGQ----LWNNTCVLNLKLYVV 1278

Query: 1298 YVDIFWGSRNSEGIEIYLDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYE 1357
             ++ FWG +N++ +++Y DKLDF++ QR  D   +  + E+  LSKL+S+R +  +    
Sbjct: 1279 DINFFWGDKNAKVVDLYFDKLDFDLGQRTRDLDGETIVSEKITLSKLRSVRATVFDRSIT 1338

Query: 1358 EIEYERPPALSLTVEGLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFY 1417
            E   ERPPALSL VEG E +S        S+++LSTDITVD SQ  WL  Y+ +Q +   
Sbjct: 1339 EGVEERPPALSLAVEGWEAYSWMREKIVGSVSLLSTDITVDESQLEWLSVYIAEQRDLIK 1398

Query: 1418 NLKGSVDLLQKRDVTLQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSW 1477
            N+  S   L +     ++ L+  +TTASE+YQI H+PYVITKPA IMRLSN HVREN SW
Sbjct: 1399 NMLTSFTKLHEYWQGTRRDLLRDITTASEHYQISHEPYVITKPAFIMRLSNGHVRENPSW 1458

Query: 1478 RIVTRLRHILNYLPEGWEKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYI 1537
            RI+TRLRHIL YLP  W  +S   V      +D+       SV S+WR WE+SD+ RSYI
Sbjct: 1459 RIITRLRHILTYLPNEWRNNSAIQVSPTVDSTDA-------SVASHWRRWEISDITRSYI 1511

Query: 1538 YRRVFLPDIEKNL---INNTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEE 1594
            YR +FL D  K     +    K+   SF+FTIYS+ Y V HN V+TR N++ +++ + E 
Sbjct: 1512 YRTIFLSDQSKTQCQSLKKMLKVDFHSFFFTIYSEGYRVAHNFVITRANIVGEEIPAAEL 1571

Query: 1595 PKAATANKNDKIYDITGTVGTFKGELGDQLIRLKKLYSEDKAKIRSEKSTDFSIPKFFKI 1654
             K   A   D + ++T ++G  KGEL DQL++L+ ++S+ +        T  +I K +K+
Sbjct: 1572 SKVQQALDYDNVMNLTVSLGAIKGELNDQLLKLRNIFSKAQTPALKRSKTSINISKSYKV 1631

Query: 1655 NIVLIVEKGELTLAAANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHN 1714
            N++L  ++ EL      T+L +RI NGK +   E  ++ A  + S V++A R+E WLKH 
Sbjct: 1632 NVLLAFDRSELQFVLGQTRLTNRILNGKAALLLEKLKNSAAPALSFVFFAKRSESWLKHA 1691

Query: 1715 ELILLDAHLDDLFISVIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISK 1774
            +L+L +A   +L +++ AEL    P++ +N++ S+   +A+ +T+ LV  +++    IS+
Sbjct: 1692 DLVLAEALSRELSLTMTAELWSYMPSLSINIQCSNSHIRAMTSTELLVNSIKQIMESISE 1751

Query: 1775 ITGRLTDKDNKKRHTSTSPIFSTKKXXXXXXXXXXXXXXXXVILSPFTVKHSMKELKIVF 1834
            +      +        TS   S                   + L+PF V+H MK+L +  
Sbjct: 1752 LKRHFAMEKTTPNVQGTSTNLSIPLQNTALTVSFSDVTAELMPLTPFVVRHEMKQLGLYL 1811

Query: 1835 NREGDNDTIFSILDADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTSLIK 1894
            NR   N+ + SI DA++ L S+Q   QYF  +  D+ ++  L    S ++ + + TSL+K
Sbjct: 1812 NRVQSNEILISIWDANIILKSHQTTEQYFNFALGDLQVKCNLPTESSAILNVGLSTSLMK 1871

Query: 1895 LTLADPKKITNSLLQDEKTFEQSLESIKTLNTLFS--SNREVRTSAVDNPYKFMVNFDLT 1952
            LTL++P++I +S LQDEK   +SL  IK L  LFS  +  + ++SA+    ++ ++ +L 
Sbjct: 1872 LTLSEPRRILSSFLQDEKLIGESLGYIKGLLQLFSPLARNKTQSSAL----RWSLDANLN 1927

Query: 1953 YFGLLFPVDTSYFILELHSLLATFSNVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQV 2012
            YFG+L P+ +++F+ E+H LLA  +N      +    +T  ++++N L +IK P +   +
Sbjct: 1928 YFGILVPMASTFFVFEIHMLLAAMNNASDGQDEGDHHVTGQVSIENCLLLIKEPSLPADL 1987

Query: 2013 SKVLDFSVNLSTETKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHT 2072
            SK+LDFS+ + +  K+ NS +S+++ESSHFRVCL+P SL+++L G  Q  S  +Y+++H 
Sbjct: 1988 SKLLDFSIRVMSSQKVPNSPQSYQIESSHFRVCLSPGSLVQVLWGTHQLQSLLEYFRKHR 2047

Query: 2073 RLQIFKTKKKASVVSENLIGAPLIEY-SIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLF 2131
            +    K     S+   +      I++ SIH LSYN CIGW+F+       GLI+G+DRLF
Sbjct: 2048 KQD--KAISPFSLFDGSASADRQIDFRSIHILSYNLCIGWMFQLGDDVKTGLIIGFDRLF 2105

Query: 2132 SAYEDSYGKLTVVDGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQ 2191
            SAYE  YGKLT++DG+FS+ANG S+DTFYSQG+EK++YNRS+L N+QI YWLKE+D+MK 
Sbjct: 2106 SAYEKHYGKLTLIDGYFSVANGQSTDTFYSQGSEKQRYNRSFLSNVQITYWLKEIDSMKD 2165

Query: 2192 LFVRFYGETIDVRFLSNFATIINLTIESVQHFQMIKKETVREMNVEAEKKVGEDDISTKF 2251
            LF+R  GE ++V  LSN   II  T+ S+Q FQ +KKE + + +     K+  ++ S   
Sbjct: 2166 LFIRVNGEALEVSLLSNSFDIIESTLASIQKFQTLKKERMHKRDSGPRNKLNLENTSNNI 2225

Query: 2252 SLFFSKVQRINCQCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDMKKPH 2311
            S F S ++ I+CQ  Y GGV  +Y +   +     ++EI +P V+I + Y +    ++PH
Sbjct: 2226 SPFLSHIRTIDCQFKYVGGVLKIYSLDDLNRAEGPSLEIKSPGVVIALKYNHNEAERRPH 2285

Query: 2312 WIRSFINIEPTYNTLLSQFASFLTEFGESVHEMVAKFSPKEQPPAPKTVSPPIDYKRILE 2371
             IR  ++I+PT+N L SQ    L +  E+   MV K SP E    P   S  IDYK +L+
Sbjct: 2286 RIRCLVSIDPTHNILYSQCVPILNDIVEASQRMVQKHSPDE---TPLESSQSIDYKSLLD 2342

Query: 2372 DFDVSFSISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDIKT 2431
             FD++F +++G+Q++SLSCEP AKV A+VGF+SF F + TND     P   SL+V  I++
Sbjct: 2343 SFDIAFKVTSGRQQLSLSCEPRAKVQADVGFDSFTFGVTTNDLVDGNPTGVSLSVEKIQS 2402

Query: 2432 SINHEFSTEPTASFSVDFVDITTLFTHPDIYGTTLISDVSLYFNIKQLQNLMVFLDIWNL 2491
            S+ H FS E +ASFSVDFVD T++FTHPD++G  L+SD++++FN+KQLQNL +FLDIW L
Sbjct: 2403 SVRHIFSRETSASFSVDFVDFTSIFTHPDVFGVALVSDINVFFNMKQLQNLNLFLDIWQL 2462

Query: 2492 KRLIKLRPQKSVPVKKPEXXXXXXXXXXXXXXIIPWSFTVIITDINGDIHXXXXXXXXXX 2551
               +  + +     +K +               I WSFT+I T++ GD+           
Sbjct: 2463 NGKLNNKGRAKDDDRKKQTKSMTLSKRTSTPTSICWSFTLIFTNVKGDVDLGPSLGVLSL 2522

Query: 2552 XXXXXWISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRYVENEKLDQS 2611
                 W +T+H+  +R+ L  F D LS+ S GRL G+ D+ N +WI  V Y     +  S
Sbjct: 2523 RLSRTWFATDHYGAQRRVLHAFADELSIKSEGRLSGVFDLKNATWISEVNYPAAGSIKGS 2582

Query: 2612 PLVDITLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLHLVCDEIDI 2671
              + ++L+V  VA+K AFDYHMFLIG +  + F+L SE DL G LPDLL + L C E+D 
Sbjct: 2583 SEMSLSLSVGRVAIKTAFDYHMFLIGTIDEMKFHLRSESDLYGILPDLLVVALSCKEMDF 2642

Query: 2672 CSTALVASNILDISNTISRTRQDSRNSYIETLLESNPPPQKSSISYTDILKSLNLLRTDV 2731
            C+TAL A+NILDI NTI+R RQD+R SYIETL ESN    + ++ Y DIL+SLNLLRTD+
Sbjct: 2643 CATALTAANILDIYNTITRMRQDNRISYIETLRESNSTEARVTLLYDDILQSLNLLRTDL 2702

Query: 2732 GIEIHKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKATLSLSKSN 2791
              +I   + QISPISLFDVEV+V  ++NVSARS TQSGEKL T+L +++  A +SLS S 
Sbjct: 2703 SFDITTFKAQISPISLFDVEVLVLNIDNVSARSETQSGEKLKTELHLQVSNAKVSLSTSK 2762

Query: 2792 EELDEEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYLFACKFHDK 2851
            EELDEE V++IS++DYM+YA K+SGG I+ +P+L V MTTWQ   S +IEYLF C+F D+
Sbjct: 2763 EELDEERVAKISIEDYMLYASKISGGTIVKVPRLLVSMTTWQKPKSDLIEYLFTCRFFDR 2822

Query: 2852 ISVRWNLGPVNFIKEVWATHVKSLAVRRAQ-----LKGDKEPQLVPGIIGXXXXXXXXXX 2906
            ++V+WNLGP+NFIKE+W+TH+KSLAVR+ Q      + DK+  L P              
Sbjct: 2823 VAVKWNLGPINFIKEMWSTHIKSLAVRQTQSNKTMSEKDKQADLDP-------------- 2868

Query: 2907 XXXXXXXXXXXXXXXXXXXXXXKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFP 2966
                                  K  YVPL EP IEMP+IKDL DATPP+EWFGV+RK+ P
Sbjct: 2869 ----------------EEEIKAKLQYVPLDEPYIEMPQIKDLGDATPPMEWFGVHRKRLP 2912

Query: 2967 RVTHQTAIILIQKIVHVAQKEYAKVLG 2993
              THQ AI+LIQK+VH A+KEYAKV G
Sbjct: 2913 AATHQLAIVLIQKLVHAAEKEYAKVQG 2939

>NDAI0B01980 Chr2 complement(483519..492398) [8880 bp, 2959 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2959

 Score = 2548 bits (6603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1306/3020 (43%), Positives = 1902/3020 (62%), Gaps = 92/3020 (3%)

Query: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60
            M+  SQF  I L ++K FSWVFL  W+L  I +L VIFYL R      +FIL W +WK+ 
Sbjct: 1    MDAISQFQRIPLTKQKDFSWVFLVDWILILIVTLFVIFYLSRTLAYGISFILEWFLWKRS 60

Query: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120
             VKINIESIR+S LGG VF KN+ II+QD+T+SFLE  + WRYWLLN R+  Y       
Sbjct: 61   NVKINIESIRISPLGGRVFFKNVVIIHQDYTISFLEANVTWRYWLLNVRKSGY------- 113

Query: 121  SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS 180
             +  +  D +++ ++    KLPC   +E +G E+FVYNR  AY+N++  F+KEER +F  
Sbjct: 114  -DTPELPDKASANSV----KLPCRFFLEFEGLEIFVYNRGVAYDNIIGQFSKEERNQFEK 168

Query: 181  FLNEHDLGDIVSEDTNVNSMDKDYFXXXXXXXXXXXXXINDRTYKKNKDERKSILFNFLP 240
            FLNE    D  +E +N  S  ++                NDR +++   ER   L +FLP
Sbjct: 169  FLNEQVFTDSKAEVSNSESNSEEDTFESAGTFKSDSSTTNDRVFQEELSERPQFL-DFLP 227

Query: 241  IQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNISVK 300
            I  ++ HG++ +GN+FTPSL++ S  +C G++DV   +EK+DLYK +  + F+   I +K
Sbjct: 228  IDFKVSHGSLIIGNKFTPSLMIGSCSSCTGMIDVCQPSEKLDLYKLRFLLDFKTFAIDIK 287

Query: 301  PNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESMFVNK 360
             N+ ++ EF+ +  ID+ ++S++W  F  ++      ++ +   H++  +   E  F  K
Sbjct: 288  QNIGFNEEFSMKFKIDRNRVSKMWQQFNKVLLTC---YSHMKLSHLRSNKVSEEDPFYEK 344

Query: 361  WRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVPHGAH 420
            WRGLSLY+  +       +++  +DF N EYAKFSSI++ P    ++  D PGIVPHGAH
Sbjct: 345  WRGLSLYRGTIFGKSNDDINDIDFDFANHEYAKFSSIVRTPQAIFTFECDIPGIVPHGAH 404

Query: 421  QTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQIPIK 480
             T    DGPD+GNSG+PPEF +++Q+S  SI +GPW  RQ++ LIR+LSP+ S+N  P K
Sbjct: 405  PTLTATDGPDVGNSGAPPEFSLEIQISGGSICFGPWAQRQLNSLIRLLSPIASRNAKPTK 464

Query: 481  KLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDFNLN 540
            +L PG  RI+T FK ++   +E++WRIPTRE SKD EF++ + +TN+++RPFGW+D   +
Sbjct: 465  RLTPGCTRIYTQFKTTISTTEETTWRIPTRESSKDPEFLQHYRETNEEYRPFGWIDLKFS 524

Query: 541  KGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLGWNS 600
            K T      +  PT +G  N  DIH  D E+ +SVNHDILLK K F+ V DIG+PLGWN 
Sbjct: 525  KDTYICSTVAQCPTKEGFKNTLDIHLGDNEIRSSVNHDILLKCKSFNFVMDIGFPLGWNE 584

Query: 601  QADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGYSIY 660
            +A W  D+ + QLE F+L+EHI+L +D  +DF+S +PTPYELFRPF Y +NW I GYS+Y
Sbjct: 585  EATWTIDLESTQLEAFILREHITLIADTLTDFSSGEPTPYELFRPFVYRINWKINGYSLY 644

Query: 661  LNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRLLLN 720
            LNVND NIVNNPLDFNENCYLS HGD L ID ++P   +S  +TE+++ IYTPMFRL+LN
Sbjct: 645  LNVNDHNIVNNPLDFNENCYLSFHGDILQIDLVVPKREVSAGFTEVSYTIYTPMFRLVLN 704

Query: 721  TPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYGVVI 780
            TPPWNTL+EFMK+KEVGR+ DF I GSYLIYS+LDIDNVDTI +EC+S+ST L CYG VI
Sbjct: 705  TPPWNTLNEFMKNKEVGRSHDFKITGSYLIYSELDIDNVDTIIIECSSQSTVLQCYGFVI 764

Query: 781  RYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGSFXXXXXXXXXXXXXXXXXLY 840
            RYL NV+ NYFGDF HF+TSEEY+        R+N+ Q  F                 + 
Sbjct: 765  RYLTNVKMNYFGDFFHFVTSEEYT-----GEIRANEVQNQFTDRQLYEDKASLSSYESIE 819

Query: 841  T---KEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLFSELM 897
            T   +++      ++R+D+ R  NE D+WFTF VW+GA++LPE +YN + C  L F EL+
Sbjct: 820  TSSVRKEQTGDSKIKRSDLKRATNETDLWFTFTVWEGAILLPETIYNCDPCIGLHFGELL 879

Query: 898  ISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDVTIHAHRM 957
            I FR  NYYMD L ++ D+ + R++    +EI+  VR  +   N  +G+LSD+ IHAHRM
Sbjct: 880  IDFRSCNYYMDLLASMNDISLRRYIGKQQNEIYESVRQDNGCGNKKYGSLSDMVIHAHRM 939

Query: 958  FGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVESSDD 1017
            +GLPP + TYFCQW    G+L ++ +I FL  F   F K+ FG  +LEN L+Y+ E  DD
Sbjct: 940  YGLPPLEPTYFCQWDFSLGTLDLNCDISFLEGFITSFNKISFGLVDLENILLYEKEVIDD 999

Query: 1018 MTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFSISIFD 1077
            MT LT+  +K+ I++ +            +L  ++I+F+NE+Y  R++L+IP F++ ++ 
Sbjct: 1000 MTSLTVDVKKISIMIRESEMDTFLLCTAEELYFSNINFENEKYCTRLDLRIPIFNLFMYT 1059

Query: 1078 VRNPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPTMYQES 1137
            + N   K  L  F+TK++ +NF    D     + Q+ YITLHD+PYHRC FILP   Q+S
Sbjct: 1060 M-NGAKKEKLFEFETKVNLSNFEKPNDIATHKSKQQEYITLHDAPYHRCAFILPPSLQDS 1118

Query: 1138 FLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLL--ENPFLNIRSINNLDT 1195
             +Y +L+G I PS S+P LPIP+LP TID++V+D L  + ++L  ENPF      +   +
Sbjct: 1119 EIYQDLFGSIAPSSSLPPLPIPLLPATIDYIVDDLLGCFPEILESENPFR--IPFSPATS 1176

Query: 1196 SSLFNEYRVDTYISEKAIFKAEEKNTVNYDPK-YEYDNYILNVEYIRVDINPLFSDFIDS 1254
              L N +      S++ +   E K   + D + +  DN+++++ Y  + INP    ++D+
Sbjct: 1177 PKLGNPFEGSDTESDEELDPLEFKTETSGDSETFASDNFVIDISYCSLSINPRLWSYLDN 1236

Query: 1255 MSTKLYSENXXXXXXXXXXXXXXXLGSPKKVLLRETNLKLKISYVDIFWGSRNSEGIEIY 1314
                  S++               L   ++ +    N+KL+I Y+D+FWG R + GI +Y
Sbjct: 1237 CREHFCSQDIVQILDDIEIGIVNHLSDLQEGIETARNIKLQILYLDLFWGDRQNAGISLY 1296

Query: 1315 LDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEIEYERPPALSLTVEGL 1374
            LD++D EM Q++ ++ N+  + E T L+K++S+R + +E        ERPPALSL +EG 
Sbjct: 1297 LDRIDLEMCQKMLEENNETKITEVTFLNKIRSVRATINEASSVGKADERPPALSLVIEGS 1356

Query: 1375 EVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGSVDLLQKRDVTLQ 1434
            E+WSC   AQ NS+NILS DIT+D +Q  WL +Y++KQ+     +  ++  +Q+   T +
Sbjct: 1357 EIWSCITNAQVNSLNILSADITIDEAQIDWLFQYIDKQLTLSQEIASALQSIQESRSTTR 1416

Query: 1435 KSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLRHILNYLPEGW 1494
            K L+SKL  ASEYYQI HDPYVITKPA I RLS  HVRENRSW+I+TRLRHIL YLP  W
Sbjct: 1417 KQLVSKLAVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITRLRHILTYLPIDW 1476

Query: 1495 EKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFLPDIEK---NLI 1551
             +        +  ++  DP N F+SVFSNWRNWE SD+ARSYIYR +F     K   N +
Sbjct: 1477 LRVIDEMRNQQDSHTLPDPGNAFISVFSNWRNWEFSDIARSYIYRNMFSEGHSKKQENSM 1536

Query: 1552 NNTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQM--LSDEEPKAATANKNDKIYDI 1609
             N+ K+ + S +FT+YS  Y V+HN ++TR NV+++ +  +SD      ++   +KI ++
Sbjct: 1537 ENSIKLKLASLFFTVYSTGYEVEHNFILTRTNVVVETLPAISD------SSIIQEKIINV 1590

Query: 1610 TGTVGTFKGELGDQLIRLKKLYSEDKAKIRSEKSTDFSIPKFFKINIVLIVEKGELTLAA 1669
            TG++GT KG+   +LI LKKL  E   K   + ST F   + FK+N++L+ E+ EL    
Sbjct: 1591 TGSLGTIKGKTSHKLINLKKLLPELSMKKNLKPSTPFL--RCFKLNMLLLFERSELQFVL 1648

Query: 1670 ANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNELILLDAHLDDLFIS 1729
              +K++SR+  GK+S  +E+ +D+A+ + S+  YA R+E+W+KH+ +IL ++ + +  I 
Sbjct: 1649 GASKVMSRVFGGKLSMLWESPKDLASKAISMTVYAQRSEMWMKHHNIILAESQMREFSII 1708

Query: 1730 VIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRL-TDKDNKKRH 1788
            + AE    KPT+LVN++ + + F+A+  T  L   + E    I ++     +D D+  + 
Sbjct: 1709 ITAESWSYKPTVLVNLQCTDIHFRAMTATDVLAKSVGEIIENIKELEKLFYSDSDSGIQQ 1768

Query: 1789 TSTSPIFSTKKXXXXXXXXXXXXXXXXVILSPFTVKHSMKELKIVFNREGDNDTIFSILD 1848
             S  P+   +K                + LSPF+ +H+ K+L I FNR G ND + S+ D
Sbjct: 1769 ISQYPVME-QKINMVLTCYFTNVNLEIMPLSPFSFRHNAKQLDIYFNRLGSNDLVLSVWD 1827

Query: 1849 ADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKLTLADPKKITNSLL 1908
             DL+L S+    +YFR S+ +I L+  + ++ +  I I++  S++KLTL D +++  S L
Sbjct: 1828 TDLFLISHLTKEEYFRFSFGNIQLKGNILENPNYTINIDVSASIVKLTLGDIRRLIPSFL 1887

Query: 1909 QDEKTFEQSLESIKTLNTLFSSNREVRTSAVDNPYKFMVNFDLTYFGLLFPVDTSYFILE 1968
            QDEK   +SLE   +L           T        + +  ++ YFGLL P+ ++YFILE
Sbjct: 1888 QDEKILIESLEQFSSLKLFQRKKPAPSTEKSGRTVTWSLESNINYFGLLVPISSTYFILE 1947

Query: 1969 LHSLLATFSNVYMNPQQLKEK---ITCNLALQNTLFMIKSPEVNNQVSKVLDFSVNLSTE 2025
            LH LL + + +    Q +  K   ++   ++ N  F++K   +   +SK+LDFS+ +ST 
Sbjct: 1948 LHMLLMSLNKI----QGISSKYNGLSGQFSIDNVCFLLKEKSLPADLSKILDFSIKVSTL 2003

Query: 2026 TKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQI-----FKTK 2080
             K+  + RSF++ES HFRVCL+P SL  +L    Q  ++ +YYKEHT +       FK  
Sbjct: 2004 QKLKVTPRSFQIESPHFRVCLSPGSLAHMLWRGNQALTNIRYYKEHTSVAWEKVINFKNT 2063

Query: 2081 KKASVVSENLIGAPLIEYSIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAYEDSYGK 2140
              ++ V  +         S H LSYNFC+GW+F     + PGLI+GY RLFSAYE ++GK
Sbjct: 2064 NNSAEVQADFP-------SFHVLSYNFCVGWLFSPEFDNEPGLIIGYSRLFSAYEKNFGK 2116

Query: 2141 LTVVDGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYGET 2200
            LT++D +FS+ANG +SDTF+S+G+EK++YNRSYLPN+QI YWLK    ++ +++RF+GE 
Sbjct: 2117 LTLIDAYFSVANGKTSDTFFSKGHEKDRYNRSYLPNMQISYWLKNEGLLRDVYLRFHGEA 2176

Query: 2201 IDVRFLSNFATIINLTIESVQHFQMIKKETVREM-NVEAEKKVGEDDISTKFSLFFSKVQ 2259
            +DV FL++F  +I  ++ES+Q FQ +K++ V    N++ + +    +     S FF+ ++
Sbjct: 2177 LDVNFLASFIDVIESSLESIQKFQELKRDLVGTASNIKEQTQSTTQEPIGDISPFFTGIR 2236

Query: 2260 RINCQCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKY-RIDMKKPHWIRSFIN 2318
             INCQ  YDGGVF V+         + + EI +P VIID++YKY     + P WIR+ I 
Sbjct: 2237 SINCQFQYDGGVFKVFSSAEASNHLKPSFEIKSPNVIIDMNYKYNEKKTQTPTWIRTLIT 2296

Query: 2319 IEPTYNTLLSQFASFLTEFGESVHEMVAKFSPKEQPPAPKTVSPPIDYKRILEDFDVSFS 2378
            I  T+NTL ++ A  + EF E + +MV + S   +P         IDYKR+L+ FDV+  
Sbjct: 2297 INSTHNTLFAKCAPLIAEFSEGIQKMVKRHSSDREPSGTNISKQNIDYKRMLDSFDVAVE 2356

Query: 2379 ISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDIKTSINHEFS 2438
            + + KQ +SL CEP AKV A++GF+SF F++ TND DP EPL  +L+V   + SI H FS
Sbjct: 2357 VISAKQLLSLCCEPRAKVQADIGFQSFTFTVTTNDYDPEEPLIFALSVEKTEASIKHIFS 2416

Query: 2439 TEPTASFSVDFVDITTLFTHP---DIYGTTLISDVSLYFNIKQLQNLMVFLDIWNLKRLI 2495
             E + SF VDF+D+T +FTHP   +I GT LISDV ++FN+KQLQNL +FLDIW L  L+
Sbjct: 2417 REASTSFGVDFIDLTVMFTHPNSINILGTGLISDVHVFFNVKQLQNLYLFLDIWKLSNLL 2476

Query: 2496 KLRPQKSVPVKKPEXXXXXXXXXXXXXXIIPWSFTVIITDINGDIHXXXXXXXXXXXXXX 2555
              +P   V   + +               IPW FT+I ++INGD+               
Sbjct: 2477 NSKPMNEVVKSRTDLKSLSSVQSKDTDSTIPWCFTLIFSNINGDVDLGPTLGVLSLHFKR 2536

Query: 2556 XWISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRYVENEKLDQSPLVD 2615
             W +T+H++  RK L  +T  ++LTS GRL G++++   SWI  V +   E ++  PLV 
Sbjct: 2537 TWFATDHYKSTRKVLHAYTKGITLTSKGRLSGILELDGASWISEVNWPIYENINDYPLVS 2596

Query: 2616 ITLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLHLVCDEIDICSTA 2675
            I+LN++ V  K AFDYHMFL+G ++NI  ++ SEKD+ G  PDLLK++++C+ I +CSTA
Sbjct: 2597 ISLNIDRVETKVAFDYHMFLVGAINNIDVHIHSEKDINGIKPDLLKVNVICEAIKLCSTA 2656

Query: 2676 LVASNILDISNTISRTRQDSRNSYIETLLESNPPPQKSSISYTDILKSLNLLRTDVGIEI 2735
            LVA+NILDI NT+ R RQD++ SYIETL ESN    + ++ Y DIL+SLNL++TDV ++I
Sbjct: 2657 LVAANILDIYNTVMRLRQDNKISYIETLKESNTSEPRQALDYKDILRSLNLIQTDVSVDI 2716

Query: 2736 HKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKATLSLSKSNEELD 2795
            + + +QISPISLFD E++V  +EN+SARS T +G KL T+L+M++Y A+++LS S EELD
Sbjct: 2717 YTLNIQISPISLFDAEILVVNIENISARSETHAGNKLKTELEMQVYDASVALSTSKEELD 2776

Query: 2796 EEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYLFACKFHDKISVR 2855
            E+ ++ ISV+DYM YA ++SGG I+  P+L + MTT+Q E S I+EYL+ C F DKISVR
Sbjct: 2777 EDIIATISVEDYMHYAGRISGGVIIEAPRLLIAMTTYQKEKSDILEYLYTCSFGDKISVR 2836

Query: 2856 WNLGPVNFIKEVWATHVKSLAVRRAQLKGDKEPQLVPGIIGXXXXXXXXXXXXXXXXXXX 2915
            WNLGPVNFIKE+WATHV+++AVRR+Q+     P                           
Sbjct: 2837 WNLGPVNFIKEMWATHVRAMAVRRSQIDVTFGP-----------------------VSEE 2873

Query: 2916 XXXXXXXXXXXXXKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFPRVTHQTAII 2975
                         +F YVPL+EP+I+MP+I+DL DATPPLEWFG+NRK+FP  THQTA+I
Sbjct: 2874 DVGKRIKKEEEFSRFQYVPLEEPRIDMPQIRDLGDATPPLEWFGLNRKRFPAFTHQTAVI 2933

Query: 2976 LIQKIVHVAQKEYAKVLGDS 2995
            L+QK+VH A+KEY  +LG S
Sbjct: 2934 LVQKLVHTAEKEYGSILGHS 2953

>CAGL0L12210g Chr12 complement(1315265..1324210) [8946 bp, 2981 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087c
          Length = 2981

 Score = 2484 bits (6439), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1291/3052 (42%), Positives = 1906/3052 (62%), Gaps = 140/3052 (4%)

Query: 5    SQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKYKVKI 64
            + F   SLG ++ FSWVFL  W+LT I +L  +FYL R F    TFIL W +WK+ KVK+
Sbjct: 8    AGFRGESLGFKRNFSWVFLVDWILTVILTLATLFYLSRAFAYGVTFILEWLLWKQAKVKV 67

Query: 65   NIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKV-QANLSSEQ 123
            +I ++R+S L G VF KN++II++D T++ LE  I WRYWL+ +R+ EY+V Q   +S  
Sbjct: 68   SIGALRISLLAGRVFFKNLTIIDKDRTITILEGSITWRYWLIRTRKSEYRVAQMAHASAG 127

Query: 124  SQGS-------DASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEERE 176
            S G+       D +N M  EK  KLPC  L EC+GFE+F+YNR  AY+N++ + +K ERE
Sbjct: 128  SSGNSEDDTKFDIANYM--EKQLKLPCRFLFECEGFEMFIYNRTYAYDNIVNVLSKVERE 185

Query: 177  KFSSFLNEHDL----------GDIVSEDTNVNSMDKDYFXXXXXXXXXXXXXINDRTYKK 226
            KF  F+ E+D             I    +  NS D++                NDRT++ 
Sbjct: 186  KFEKFMAENDFLDPSSDGSSDDKIEETSSATNSTDEETIA-------------NDRTFQN 232

Query: 227  NKDERKSI--LFNFLPIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLY 284
              D RK++      LPI+  L  G++ +GN+FTP +++ S+E+   + DV  A  K+DLY
Sbjct: 233  --DTRKTLPRYLEALPIEALLNKGSILIGNKFTPCVLILSFESAVALQDVGEAPSKLDLY 290

Query: 285  KSKVTMKFQDVNISVKPNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHK 344
            + K  ++ +++ I +K N+ YD+E +   + DKGKLSR+W+ F  I  ++P PF      
Sbjct: 291  RMKYEVRLKNLEIMMKQNIDYDNEKSRNFEFDKGKLSRLWHRFTRIFKLVPFPFKS---N 347

Query: 345  HMKKKEHDVESMFVNKWRGLSLYKDNLRDAGRYG-LDEASYDFLNREYAKFSSILKCPNF 403
              K++ HD    F+ KW+GLS+Y++++   G +   D+  +D  + EYAKF+S+LK P  
Sbjct: 348  RRKEQPHD---NFMQKWKGLSMYRNDM--FGEFDEFDDIEFDISSHEYAKFTSLLKSPRV 402

Query: 404  TLSYYLDSPGIVPHGAHQTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSY 463
            T+ +  D PG VPHGAH  +   DGPD+GN+ +PP+++ ++ +   ++ YGPW  RQ ++
Sbjct: 403  TIHHDYDMPGWVPHGAHPPSSYADGPDVGNNMAPPQYIFEINIFGGTVCYGPWAQRQTNH 462

Query: 464  LIRMLSPVVSKNQIPIKKLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFV 523
            L  +LSP VS+   PIKKL+PGS+RI+TV K++++ +++ +WRIPTRE SKD EF+  + 
Sbjct: 463  LQSLLSPSVSRTAKPIKKLKPGSKRIYTVLKLTINAMEDVTWRIPTRESSKDVEFLMHYK 522

Query: 524  KTNDDFRPFGWLDFNLNKGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKS 583
            +TNDD+RPFGW+D  +++ +   F+ ++ PT  G  N  D+  +D E+ +SVNHDI LKS
Sbjct: 523  ETNDDYRPFGWIDIKVSRDSCGIFDLAMCPTSKGFKNTIDVQLVDTEIRSSVNHDIFLKS 582

Query: 584  KEFDVVADIGYPLGWNSQADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELF 643
            K F    DIGYPLGWN++A+W   + + QLE FLL+EH++L +D  +DF+S +P PYELF
Sbjct: 583  KSFSFNCDIGYPLGWNAEANWTIIMDSNQLELFLLREHVTLIADTLTDFSSGEPVPYELF 642

Query: 644  RPFTYSLNWDIEGYSIYLNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPY 703
            RPF Y + W+++GYS YLNVND NIVNNPLDFNENCYLS+HGD+L ++ ++P   I+  +
Sbjct: 643  RPFVYHIKWNMKGYSFYLNVNDHNIVNNPLDFNENCYLSIHGDDLTMNVMVPKKTITSRF 702

Query: 704  TEIAFNIYTPMFRLLLNTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTIT 763
            T + ++IYTPMFRLLLNTPPWNTL+EFM++KEVGR+ DF ++GSYLIYS+LDIDNVDT+T
Sbjct: 703  TNMTYDIYTPMFRLLLNTPPWNTLNEFMRNKEVGRSHDFRLKGSYLIYSELDIDNVDTLT 762

Query: 764  MECTSRSTTLFCYGVVIRYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGSFXX 823
            +EC+SR T L  YG VIRYL+NV+ NYFG+F HF+TSEEY+      N R  D +     
Sbjct: 763  VECSSRGTALHIYGFVIRYLINVKMNYFGEFFHFVTSEEYT-----GNTRPTDLENIISE 817

Query: 824  XXXXXXXXXXXXXXXLYTKEQD-----LSKPHVRRADVLRTENELDIWFTFRVWDGALIL 878
                           + +   D       K  ++++D+ RT NE DIWFTF VWDGALIL
Sbjct: 818  DRRDDDFSSYESVSRISSNSSDKNPKAKKKHSLKKSDLKRTSNETDIWFTFSVWDGALIL 877

Query: 879  PEGLYNGNLCSSLLFSELMISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDH 938
            PE +YN + C +L F+EL++  R  NYYMD L    D+ + R++    DEI+ YV   + 
Sbjct: 878  PETIYNADPCIALHFAELIVDLRSCNYYMDILATACDINLKRYVGKRADEIYEYVHLNNG 937

Query: 939  NLNIVHGTLSDVTIHAHRMFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLG 998
              + VHGTLSD+ IH HRM+GLPP + TYFCQW +DFG L IDSN+ FL   FG F K+G
Sbjct: 938  KDHEVHGTLSDIYIHGHRMYGLPPTEPTYFCQWDMDFGHLNIDSNMFFLQGLFGAFYKIG 997

Query: 999  FGYSNLENKLVYKVESSDDMTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNE 1058
            FGY +LEN L+Y+ E  DDMT LT++   + I ++D  +   A L++ +     IDF+NE
Sbjct: 998  FGYKDLENILLYETEIIDDMTSLTIFINTIDIRLNDVDTTAHADLKLERFCFTLIDFENE 1057

Query: 1059 RYSKRINLKIPEFSISIFDVRNPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITL 1118
            RYSKR+++KIP    +IF   +  +   LL FK  ++FTNFV  +DF      QR YI L
Sbjct: 1058 RYSKRMDIKIPSLEFNIFSNEDNDLS--LLNFKVDMNFTNFVQNQDFNKHRKIQRDYIVL 1115

Query: 1119 HDSPYHRCFFILPTMYQESFLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSD 1178
            +D+PYHRC F+LP  YQ+S +YNEL+G I PS S+P LPIP+  +TI++++ED L++Y  
Sbjct: 1116 NDAPYHRCAFLLPESYQKSRIYNELFGAIAPSSSLPPLPIPLTADTIEYVLEDLLEDYMG 1175

Query: 1179 LLENPF-LNIRSINNLDTSSLFNEYRVDTYISEKAIFKAEEKNTVNY-DPKYEYDNYILN 1236
            L E  + +   S+ NL+ S++     +    +E+        N +   D   E DNY++ 
Sbjct: 1176 LFEGNYDIKESSVENLELSAIEATRAITGIGAERT-----HSNPITLSDYAVESDNYVVK 1230

Query: 1237 VEYIRVDINPLFSDFIDSMSTKLYSENXXXXXXXXXXXXXXXLGSPKKVLLRETNLKLKI 1296
            VE I +DINP     I+ +   +Y ++               L S    +   TN+K++I
Sbjct: 1231 VESIVIDINPALYTTIEKLLKHIYDQDAVQIIDGIEIGIVKRLSSIHDGVTTMTNVKVQI 1290

Query: 1297 SYVDIFWGSRNSEGIEIYLDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQY 1356
             + ++FWG + S+ + ++ DK+DF + ++  +  ++++L E T+L+K+K++R +  +   
Sbjct: 1291 KHFNLFWGEKESDNVSMFFDKMDFALTEKTLEQNSEKNLLEMTVLAKIKAVRLTVVQQPG 1350

Query: 1357 EEIEYERPPALSLTVEGLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFF 1416
                 ERPPA+++ VEG E WS     Q NSI++ S DITVD +Q  W  KY+ +Q  FF
Sbjct: 1351 LIPTQERPPAITVGVEGFEFWSTAIEKQVNSISVSSADITVDDAQVEWFFKYIVRQKYFF 1410

Query: 1417 YNLKGSVDLLQKRDVTLQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRS 1476
             ++  S + +Q   +  QK LIS+LT ASEYYQI HDPYVITKPA IMRLS  HVREN+S
Sbjct: 1411 LDMLQSYNRIQNNRIESQKELISRLTAASEYYQISHDPYVITKPAFIMRLSRGHVRENKS 1470

Query: 1477 WRIVTRLRHILNYLPEGWEKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSY 1536
            W+I+TRLRHIL YLP+ W  +    +  R      D +++F+S+FSNWR+WE SDVARSY
Sbjct: 1471 WKIITRLRHILTYLPKDWYLNVGQPLRDRKFDPSQDARSIFMSIFSNWRSWEFSDVARSY 1530

Query: 1537 IYRRVFLPD---IEKNLINNTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDE 1593
            IY ++FL D    +K  +    K+ + +F+ T+YS  Y VDH+IVV+   ++++   S  
Sbjct: 1531 IYGKLFLNDHAEKKKQSLQKLFKLNIGNFFMTVYSTNYDVDHSIVVSNAKLLLELTPSST 1590

Query: 1594 EPKAATANKNDKIYDITGTVGTFKGELGDQLIRLKKLY-----SEDKAKIRSEKSTDFSI 1648
            EPK  +  + + I DI+GTV   KG+L  +L++L+KL        +K  ++  + T   I
Sbjct: 1591 EPKENSLQREELI-DISGTVDVIKGKLSTKLLKLQKLIPILTEGSEKQPVKPPQDT---I 1646

Query: 1649 PKFFKINIVLIVEKGELTLAAANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTE 1708
            PK FK+N   +V   ++ L    TKL   + +G+IS  +EN +D    +GS+V ++  TE
Sbjct: 1647 PKPFKMNAAFMVNSCDIQLVMDATKLNMNVNDGRISVLWENLQDSTAQAGSVVLFSKHTE 1706

Query: 1709 LWLKHNELILLDAHLDDLFISVIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREF 1768
            L LKH   +L +  + + + +   +   ++PT L++ KSS + F+ +  T+ LV  +++ 
Sbjct: 1707 LVLKHINSVLAEGRVSNFYATFTTDTWAQRPTYLIHSKSSSIHFRTMAKTERLVEAIKDI 1766

Query: 1769 EREISKITGRLTDKDNKKRHTSTSPIFSTKKXXXXXXXXXXXXXXXXVILSPFTVKHSMK 1828
            + +I +I+ +L   + ++R T    ++   K                + +SPF +K+S K
Sbjct: 1767 KLKIDQISEQL---ELERRLTQHPTVYDPNKSNVIASCLFSNVSMDIMPVSPFALKNSAK 1823

Query: 1829 ELKIVFNREGDNDTIFSILDADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINI 1888
            ++   +N+   +  +  + D D +LTS Q   QY RLS + + +   ++ SK KL+ IN+
Sbjct: 1824 QIDFFYNKFDSDSWLIKLKDTDFFLTSDQTKEQYMRLSMKKLQIRVNVSSSKPKLVDINL 1883

Query: 1889 VTSLIKLTLADPKKITNSLLQDEKTFEQSLESIKTLNTLF--SSNREVRTSAVDNPYKFM 1946
             T+L+KLT ++PK I  S L+DE+   +S+  ++TL  LF  S ++E    +     +++
Sbjct: 1884 STNLVKLTFSEPKNIVYSFLKDERVASESVHLLQTLKPLFSISDDKESTPQSYQEKTEYL 1943

Query: 1947 VNFD--LTYFGLLFPVDTSYFILELHSLLATFSNVYMNPQQLKEKITCNLALQNTLFMIK 2004
             + D  + YFG+L P+ ++Y+++E HS +++ SN    P      IT +++++N LF+IK
Sbjct: 1944 WSLDSSIDYFGILIPMTSTYYVMEFHSYVSSISNANGAPSG-NLDITGHMSVENILFLIK 2002

Query: 2005 SPEVNNQVSKVLDFSVNLSTETKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSS 2064
               + + +SKV+D +VN+ST  ++ ++ RS +VESSH R+CL+P+SLL++L G  Q    
Sbjct: 2003 ESSLPDGLSKVIDIAVNVSTLQRVDDNSRSIQVESSHARICLSPDSLLRLLWGFNQGHKL 2062

Query: 2065 FKYYKEHTRLQIFKTKKKASVVSE--NLIGAPLIEY-----SIHFLSYNFCIGWIFENSQ 2117
             ++Y ++    ++++  K+    +  N I +    +     SIHFLSYN C+GW+FE   
Sbjct: 2063 SEHYLKYHSKSLWQSFAKSDDKQQDTNSIKSNETSFFSSINSIHFLSYNLCVGWLFEYEL 2122

Query: 2118 SSYPGLIMGYDRLFSAYEDSYGKLTVVDGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNL 2177
                GLI GY RLFSAYE+  GKLTV+D +F+ A G +S TFY + N KE +NR YLPN+
Sbjct: 2123 GPPKGLITGYSRLFSAYENCMGKLTVIDSYFAAAQGNTSSTFYPETNVKELFNRFYLPNM 2182

Query: 2178 QILYWLKEVDAMKQLFVRFYGETIDVRFLSNFATIINLTIESVQHFQMIKKETVREMNVE 2237
            QIL+W K ++ MK ++VRF GET+DV++LS+F   I  T+ S++ FQ +KKE + E    
Sbjct: 2183 QILFWWKVIEGMKDVYVRFTGETLDVKYLSDFMLTIESTLHSIKMFQKLKKELIVETPKR 2242

Query: 2238 AEKKVGEDDISTKFSLFFSKVQRINCQCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVII 2297
                + ED      +     ++ +NC   YDGG ++V+ +    ++   AIEI +P + +
Sbjct: 2243 EVVHIKEDKPVNSSNNILKNIKSVNCHFKYDGGTYSVFNISDGSLNPTPAIEIKSPVISV 2302

Query: 2298 DVDYKYRIDMKKPHWIRSFINIEPTYNTLLSQFASFLTEFGESVHEMVAKFSP--KEQPP 2355
            DV YK+     K H IR  +NI+PT+N L +  A  +  F E V  +  ++    K    
Sbjct: 2303 DVLYKHEKQNTKHHSIRCLVNIDPTHNVLYATCAPLVKNFVEDVRSIFGRYESENKHSET 2362

Query: 2356 APKTVSPPIDYKRILEDFDVSFSISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDD 2415
             P +V   IDY+++LED+D++ ++++ KQ++SLSCEP AKV A+VGFE+   S+ TN  D
Sbjct: 2363 TPTSVQ-NIDYEKLLEDYDLAITVTSAKQQLSLSCEPKAKVQADVGFEALTVSMTTNPFD 2421

Query: 2416 PTEPLSCSLTVNDIKTSINHEFSTEPTASFSVDFVDITTLFTHP---DIYGTTLISDVSL 2472
              EPL+ S ++ D K SI H FS E + SF V ++D+T LFTH    + YGT+LISD+ L
Sbjct: 2422 IDEPLAFSFSIKDTKASIKHLFSRETSTSFGVGYLDLTLLFTHTNRINTYGTSLISDIDL 2481

Query: 2473 YFNIKQLQNLMVFLDIWNLKRLIK---------LRPQKSVPVKKPEXXXXXXXXXXXXXX 2523
            YFN+KQLQNL +FLDIW L  L+          +R  K   V KP               
Sbjct: 2482 YFNVKQLQNLYLFLDIWQLSELLNPVTSSQEQVIRKDKKKSVDKP----------IHNES 2531

Query: 2524 IIPWSFTVIITDINGDIHXXXXXXXXXXXXXXXWISTNHFQDRRKALRFFTDSLSLTSVG 2583
             +PW FT+I T++ GDI                W++T+HF  +R+ L  F D L L S G
Sbjct: 2532 QLPWCFTLIFTNVKGDIDLGPSLGLISLRLSRTWLATDHFSGKRQILHAFVDDLLLISEG 2591

Query: 2584 RLGGLIDVANISWILNVRYVENEKLDQSPLVDITLNVENVAVKAAFDYHMFLIGRVHNIL 2643
            RL G++++   SW+  V ++++ K D  PLV ++LN + + +KAAFDYHMFLIG V+NIL
Sbjct: 2592 RLSGVVNIDGASWVSEVIWLQDSKRDNIPLVALSLNTDKIEIKAAFDYHMFLIGTVNNIL 2651

Query: 2644 FNLESEKDLIGNLPDLLKLHLVCDEIDICSTALVASNILDISNTISRTRQDSRNSYIETL 2703
            F L SE+D++G  PDLLK+   C+EI +CSTALVA+NILDI NTI R RQD++ SYIETL
Sbjct: 2652 FQLHSERDMVGVAPDLLKVSFSCEEIKLCSTALVAANILDIYNTIIRMRQDTKISYIETL 2711

Query: 2704 LESNPPPQKSSISYTDILKSLNLLRTDVGIEIHKMQVQISPISLFDVEVIVTTVENVSAR 2763
             +SN    K +++Y DILKSL LLRTD+ + I  +Q+QISPISLFDVEV+V  V +VSAR
Sbjct: 2712 KDSNMETNKQTLAYRDILKSLQLLRTDLTVSICSLQLQISPISLFDVEVVVINVVSVSAR 2771

Query: 2764 SVTQSGEKLMTDLQMKIYKATLSLSKSNEELDEEAVSEISVDDYMIYAMKLSGGKILSIP 2823
            S T S  KL T L M++Y ATLSLS + +ELDE+A+S+I+V DYM YA K+ GG I+ IP
Sbjct: 2772 SETHSEAKLTTSLNMEVYDATLSLSTAKQELDEDALSKITVADYMTYASKIRGGTIIEIP 2831

Query: 2824 KLFVGMTTWQLENSKIIEYLFACKFHDKISVRWNLGPVNFIKEVWATHVKSLAVRRAQLK 2883
            ++ V MTTWQ E S I+EYL++CKFHDK++VRWNLGPVNF+KE+W THVK++AVRR+Q+ 
Sbjct: 2832 RMGVQMTTWQEEKSDILEYLYSCKFHDKVAVRWNLGPVNFMKEMWTTHVKAIAVRRSQV- 2890

Query: 2884 GDKEPQLVPGIIGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKFIYVPLKEPQIEMP 2943
                      + G                                K  YVP++EPQI+MP
Sbjct: 2891 ----------LTG------------SFNVSEKDVEKRIKEEENITKLNYVPVEEPQIDMP 2928

Query: 2944 KIKDLEDATPPLEWFGVNRKKFPRVTHQTAIILIQKIVHVAQKEYAKVLGDS 2995
            +IKDL DATPP+EWFGVNRK+FP  THQTA++ +Q +V++AQK+YAK LG S
Sbjct: 2929 QIKDLGDATPPVEWFGVNRKRFPAFTHQTAVVPVQNLVYLAQKQYAKTLGRS 2980

>TPHA0J00730 Chr10 complement(165253..174393) [9141 bp, 3046 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3046

 Score = 2480 bits (6428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1303/3101 (42%), Positives = 1899/3101 (61%), Gaps = 172/3101 (5%)

Query: 5    SQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKYKVKI 64
            ++FA++SL +E+YFSWVFL YW+L  +A+ T +FY+ +++G   TF   W +WK   +K+
Sbjct: 6    TEFANVSLSQERYFSWVFLVYWILVVVATSTFVFYVAKLWGFGLTFACEWLLWKTMNIKV 65

Query: 65   NIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLSSEQS 124
             IESIR+SFL GT+F KN+ +I+QD T+S LEC + WRYWLLN+R+ EY++ A   + + 
Sbjct: 66   TIESIRLSFLTGTIFFKNVCLIDQDKTISILECSVTWRYWLLNTRKSEYELNAKADTSKP 125

Query: 125  QGSDASNSMTIE------------------------------------------KNSKLP 142
             G D  ++ TI                                           KN KL 
Sbjct: 126  NGDDMLDNNTIHDRSNNDNNDNNDNNDNNDNNNNNDNNDNNETNNYNDIDYDYNKNKKLD 185

Query: 143  CTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSSFLNEHDLGDIV----SEDTNVN 198
                I C GFE+F+YNRK AYE +++ F+KEE+ +F  FL +HDL DI     SE  N N
Sbjct: 186  SLFAINCTGFEIFLYNRKRAYETIIQNFSKEEKIQFIDFLRQHDLDDIFEEVSSEIKNCN 245

Query: 199  SM-------DKDYFXXXXXXXXXXXXXIN----------DRTYKKNKDE-----RKSILF 236
                     +  +F             I+          DR+   N+++      + +  
Sbjct: 246  EYCNHKEGNNSAHFGSSCKSDKESASNISISGDSQENDSDRSNIDNRNKISAHIMRKLHL 305

Query: 237  NFLPIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVN 296
            + LP+ + +  GA+T+GN+FT SL+V ++   +G+LD +  + K+D++K+KVT +  D++
Sbjct: 306  DILPLDININKGAITIGNKFTRSLLVINFTEAHGLLDYALPDSKLDVFKNKVTFEINDID 365

Query: 297  ISVKPNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESM 356
            +S+K N+ Y+ E  +  +   G L+RIW+    ++++IP    K +++ ++ KE   ++ 
Sbjct: 366  MSIKRNIGYNPELASRFNFRAGVLTRIWSYLQLVLNLIPTGRLKTWYESLRYKE---DTT 422

Query: 357  FVNKWRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVP 416
            FV KW GL LYKD+++ + + G D+  +DF N EYAK S+  K P    S   D PGIVP
Sbjct: 423  FVKKWDGLVLYKDSVKSSTKLGADDVDFDFANHEYAKVSNFFKAPQIIFSIESDIPGIVP 482

Query: 417  HGAHQTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQ 476
            HG+H    K  GPDIGN  SPP FL+DLQ+S ASIY+G W NR +  L  ++ PV+SK+Q
Sbjct: 483  HGSHPPLSKAHGPDIGNHESPPTFLIDLQLSHASIYFGSWVNRNIVDLRDLMFPVISKDQ 542

Query: 477  IPIKKLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLD 536
             P+ KL+PG  R+H++F  SV ++D+SS R+PTREPSKD +F+KQ+++T DDFR FGW+D
Sbjct: 543  KPLNKLKPGLTRVHSMFNFSVSVLDDSSIRLPTREPSKDSDFLKQYLETKDDFRAFGWID 602

Query: 537  FNLNKGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPL 596
             +  KG++   N  +IPT  G  N     F ++EVTTSVNH++L KS   ++ A+IGYPL
Sbjct: 603  LSFKKGSEFMLNIPMIPTSGGFENTLFSKFSELEVTTSVNHNLLFKSNSLNIAANIGYPL 662

Query: 597  GWNSQADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEG 656
            GWN   +W F+I +KQL+ FLL+EHI+L SDM  DF++++PTPYELFR FTY+LN  I G
Sbjct: 663  GWNDPVNWIFNINSKQLDIFLLREHITLLSDMIIDFSTQEPTPYELFRSFTYNLNLKIGG 722

Query: 657  YSIYLNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFR 716
            YS Y NVNDRNI+NNPLDFNENCYLS HGD    +  IP + ++Q Y  I++ I+TPMFR
Sbjct: 723  YSFYFNVNDRNIINNPLDFNENCYLSFHGDLFTSEITIPIISLAQQYVTISYEIFTPMFR 782

Query: 717  LLLNTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCY 776
            L LNTP WNTLSEFM++KE+GR+ DF + G+YLIYS+LDIDNVD++T++  S ST L+C+
Sbjct: 783  LFLNTPSWNTLSEFMRNKEIGRSHDFRVSGTYLIYSELDIDNVDSLTIDFESNSTVLYCF 842

Query: 777  GVVIRYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGSFXXXXXXXXXXXXXXX 836
            G VI+Y+MN QANYFG F+ FIT+EEYSE+++ N    ND  GS                
Sbjct: 843  GFVIKYMMNFQANYFGSFIKFITTEEYSELIRNN---VNDNLGSI-NTNDLTSIEGLQKM 898

Query: 837  XXLYTKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLFSEL 896
              +    +D+++  ++R+D+LRTENE DIW  F+V DGALILPE LYNG+ C SL F EL
Sbjct: 899  DSITNDVEDINQKTIKRSDLLRTENETDIWLNFKVNDGALILPEELYNGDSCVSLSFGEL 958

Query: 897  MISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDVTIHAHR 956
             I+ R  NYYMD    LYD  +NRF    P E+F Y++  + + + V G +SD+TIH HR
Sbjct: 959  FINMRTCNYYMDVYITLYDNNLNRFEKIDPHELFEYIQTRNRS-SSVEGNISDITIHGHR 1017

Query: 957  MFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVESSD 1016
            M+GLPP +LTYFCQWSI+ G+ +IDS++ FL SF     K+GF  SN EN L+Y+ ++ +
Sbjct: 1018 MYGLPPKELTYFCQWSINIGTFLIDSDMIFLLSFIQSLNKIGFFLSNKENSLLYESDTVN 1077

Query: 1017 DMTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFSISIF 1076
            DMTLL++  E + +++SD + + +A +    + + +IDF+NE+Y+KR+++   EF  S+ 
Sbjct: 1078 DMTLLSVDVESLKVILSDPLLEARAEIGASSIIIRNIDFENEKYTKRLDVNASEFYFSLD 1137

Query: 1077 DVRNPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPTMYQE 1136
             ++  + K  +L  +TK++ TNF   ++  N L+ QR +I LHDSPYHRCFF+LP  +QE
Sbjct: 1138 SLKIDSGKKNILDVRTKLNITNFFKTDNHINHLDTQRKFIGLHDSPYHRCFFLLPEKFQE 1197

Query: 1137 SFLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLENPFLNIRSI----NN 1192
            S  Y ELYG ITPSFS+P+LPIP + +T +F+VE  L +YS+ L +   N  SI    N+
Sbjct: 1198 SSSYKELYGSITPSFSLPMLPIPHIYSTTNFIVEGILDDYSEFLLSDHHNQMSINAELNS 1257

Query: 1193 LDTSSLFNEYRVDTYISEKAIFKAEEKNTVNYDPKYEYDNYILNVEYIRVDINPLFSDFI 1252
            +DT+ L + + +              +N +  +  YE DN+++NV+Y+ V +NP     I
Sbjct: 1258 VDTTPLKDSFDMQI---------TNFQNILTTEDPYETDNFVVNVKYLTVTVNPDIVFTI 1308

Query: 1253 DSMST---KLYSENXXXXXXXXXXXXXXXLGSPKKVLLRETNLKLKISYVDIFWGSRNSE 1309
            +  ST   K +S N               L   K+ +  + N+ L +  +D  WG R+  
Sbjct: 1309 EKFSTEFNKKFSMN--NQIDGIEMAIVNRLSDLKENISSKINVNLNVEKIDAAWGHRDVC 1366

Query: 1310 GIEIYLDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEIEYERPPALSL 1369
             I  Y++ L FE+ Q    + N    ++ T+L K +S+R       Y     +RPP LSL
Sbjct: 1367 FIGTYINMLKFELSQESTYNNNGGLQKDLTLLGKFRSVRIIIQNHSYNSFSDDRPPGLSL 1426

Query: 1370 TVEGLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGSVDLLQKR 1429
             +EG E WS T T Q  ++N+ S DITVD  Q  WLI Y+  Q+  F  ++ SV L+   
Sbjct: 1427 MLEGFEAWSSTTTKQLTTLNLTSFDITVDEYQIHWLIPYVKSQILLFTKIQDSVKLIYDE 1486

Query: 1430 DVTLQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLRHILNY 1489
              + QK+ I+ L  A E YQIDHDPYVITKPA ++RLS  H+RENRSWRIVT+LRHIL Y
Sbjct: 1487 QASYQKTFITSLIWAGEKYQIDHDPYVITKPATVLRLSAWHIRENRSWRIVTKLRHILTY 1546

Query: 1490 LPEGWEKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFLPDIEKN 1549
            LPE WE         +    + +  + FL+VFSNWRNWEVSD+ +SYIYR +F+ ++ K 
Sbjct: 1547 LPEDWEDRLDEEDLIKRSGLEKEAASTFLNVFSNWRNWEVSDIEKSYIYRMIFVEEVSKR 1606

Query: 1550 LINNTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPKAATANKNDKIYDI 1609
            ++ N+ K+ +E+FYFTIYS+ Y+ D N ++T+ N++I+   +D+  +     K ++I D+
Sbjct: 1607 ILQNSIKVFLETFYFTIYSRNYSADQNFLITKANILINNE-ADQVNEVDLIRKQEEIVDV 1665

Query: 1610 TGTVGTFKGELGDQLIRLKKLYSE-DKAKIRSEKSTD-FSIPKFFKINIVLIVEKGELTL 1667
               +G+ K E  + +++LK+   +  K  + S+   D  SI KFFK+N+  I +  +   
Sbjct: 1666 VTKIGSIKFEFTEAILKLKRDIEQIIKTSVDSKSEGDKLSITKFFKVNLSFIFDHIDFNG 1725

Query: 1668 AAANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNELILLDAHLDDLF 1727
               N+ L SR+ N  I  +FEN  + +  SGS VYYA RT + LKH   IL+D  + +LF
Sbjct: 1726 QFYNSSLKSRMSNVNILSYFENNIESSTPSGSFVYYADRTGIALKHLNNILIDCQVRNLF 1785

Query: 1728 ISVIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRLTDKDNKKR 1787
             S  AEL     ++++N + S+L FK++P T+  V  ++  +R++  ++  ++       
Sbjct: 1786 ASTTAELHSAVNSLMINFRCSNLHFKSVPKTEIFVNAIKAIQRDVETLSAEISKAQGTTD 1845

Query: 1788 HTST--SPIFSTK----------KXXXXXXXXXXXXXXXXVILSPFTVKHSMKELKIVFN 1835
            + +T  +P    K          K                 +L P  +KH    + I +N
Sbjct: 1846 NINTEHTPSVHEKNKMQKAKPNSKNNITLSATFTNVSSEITLLHPIYLKHETNSVNISYN 1905

Query: 1836 REGDNDTIFSILDADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKL 1895
                ++ +  +LD DLYL S     QY RLSY  + L   L D   KLI + I +S++KL
Sbjct: 1906 TINIDELLVQVLDTDLYLNSSHTKEQYARLSYDKLELTTFLPDLNEKLIDLEISSSILKL 1965

Query: 1896 TLADPKKITNSLLQDEKTFEQSLESIKTLNTLFSSNREVRTSAVDNPYKFMVNFDLTYFG 1955
            T +DP+++  S LQDEK  + SL  +++L +L        +  + + Y+++VNF   Y G
Sbjct: 1966 TTSDPRRMLFSFLQDEKELKNSLTFLRSLESLNRKANSEDSETLFSSYEWIVNFKSKYMG 2025

Query: 1956 LLFPVDTSYFILELHSLLATFSNVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSKV 2015
            +L P+  +Y++ ELH  L+T SN       + +K   +L+  + +F+IK   + ++ SK+
Sbjct: 2026 VLLPIQATYYVFELHDALSTVSNKEEPSSAVHKKFHGDLSFDHIIFLIKDQSIPHKFSKI 2085

Query: 2016 LDFSVNLSTETKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQ 2075
            LDFS+ LST   + N  RSFE+ESS FRVCL P SL++ + G +Q       Y + + + 
Sbjct: 2086 LDFSIKLSTHRTVNNFDRSFEIESSFFRVCLTPFSLIQTMWGYYQLLYLLNSYYDQSTVN 2145

Query: 2076 IFKTKKKASVVSENLI-GAPLIE-------YSIHFLSYNFCIGWIFENSQSSYPGLIMGY 2127
             F       V ++N I GA   E        S H LSYNF IGW++++S ++ PGLI+GY
Sbjct: 2146 FF-------VFNDNNIDGATNSEKENVFSVRSFHILSYNFSIGWLYQDSDNTIPGLILGY 2198

Query: 2128 DRLFSAYEDSYGKLTVVDGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVD 2187
            +RLFS YED++GKLT+VDGFFS+ANG S DTFYS G+E  K+NRSYLPN+QILYW+KE++
Sbjct: 2199 NRLFSTYEDNHGKLTLVDGFFSLANGSSGDTFYSSGDESSKFNRSYLPNIQILYWIKEIE 2258

Query: 2188 AMKQLFVRFYGETIDVRFLSNFATIINLTIESVQHFQMIKKETVREMNVEAEKKVGEDDI 2247
             MK LF++F+GET+DV F  NF  II  T+ S+  FQ +K+E +  + V+A+ +  E   
Sbjct: 2259 KMKHLFIKFHGETLDVNFFENFVNIIESTVRSIDLFQTLKREKINPL-VKAKPERDEKSN 2317

Query: 2248 STKFSL---FFSKVQRINCQCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYR 2304
            S   ++    F K++++NC+ IYDGG+F ++         E  + I +PKV I + Y Y 
Sbjct: 2318 SALTNIKGPIFGKLKQVNCEFIYDGGLFRLFSNASMTNKLEPTLMIKSPKVKIMLSYDYF 2377

Query: 2305 IDMKKPHWIRSFINIEPTYNTLLSQFASFLTEFGESVHEMVAKFSPKEQPPAPKTVSPPI 2364
                K HWI   I+IEPT N L S    FL++F   + ++V       +      V  PI
Sbjct: 2378 EKELKKHWINCLIDIEPTQNVLKSGCVPFLSDFISQIKDIVELQDVNMEENMDNNVKDPI 2437

Query: 2365 DYKRILEDFDVSFSISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSL 2424
            +   +LE+FD+ F + +G Q V+L CEP AK++ +VGF SF FSI+T   +P +PL  SL
Sbjct: 2438 NITSLLENFDICFKLISGTQHVTLDCEPKAKINTDVGFGSFEFSILTPHLNPIDPLDISL 2497

Query: 2425 TVNDIKTSINHEFSTEPTASFSVDFVDITTLFTHPDIYGTTLISDVSLYFNIKQLQNLMV 2484
             +NDIKTS+ H+FS E +ASF V  +D+  +FTHP+++GT L+ DV L+FN+KQ QN+ +
Sbjct: 2498 KINDIKTSVKHQFSNEASASFEVSKLDVILIFTHPEVFGTGLVDDVKLHFNLKQFQNISI 2557

Query: 2485 FLDIWNL-----KRLIK-----LRPQKSVPVKKPEXXXXXXXXXXXXXXIIPWSFTVIIT 2534
            FLDIW++     K+L K     L   KS P+ +                 +PWSF  I T
Sbjct: 2558 FLDIWDVSKSTEKKLFKKDSNTLVDAKSSPIAQ----------TIVNSSTLPWSFVFIAT 2607

Query: 2535 DINGDIHXXXXXXXXXXXXXXXWISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANI 2594
            +INGDI+               WIST+HF ++R+ L  FTD++ ++S GRLGG +++ +I
Sbjct: 2608 NINGDINMGSTLGNLALNLQRTWISTDHFHNKRQLLHLFTDNVKISSEGRLGGFVEIDDI 2667

Query: 2595 SWILNVRYVENEKLDQSPLVDITLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIG 2654
            +W L+V YV+  K   SPLVD+  +V  V++K AFDYHMFLI  V ++ F++ SEKD+  
Sbjct: 2668 TWKLDVNYVDKYKFVVSPLVDLLFDVGKVSMKVAFDYHMFLISTVKDLKFHVLSEKDIDD 2727

Query: 2655 NLPDLLKLHLVCDEIDICSTALVASNILDISNTISRTRQDSRNSYIETLLESNPPPQKSS 2714
             LPDLL ++L CDEI +C+TALVASNILDI NTI RTRQD++NSYIETLLESN    K  
Sbjct: 2728 ILPDLLTVNLTCDEIKVCTTALVASNILDIYNTIMRTRQDNKNSYIETLLESNNNVLKRK 2787

Query: 2715 ISYTDILKSLNLLRTDVGIEIHKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKLMT 2774
              Y DILKSLNLL+T +   IH++ +QISP SL+D EVI+  V++V + + T++GEK+ T
Sbjct: 2788 PLYEDILKSLNLLQTSLSANIHELNLQISPSSLYDAEVIIIRVQDVFSSTETRTGEKIKT 2847

Query: 2775 DLQMKIYKATLSLSKSNEELDEEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQL 2834
            DL+M++Y ATLSL+   +EL EE ++E+S + Y+ YA  L+ G+I  IP+L + MTT+Q 
Sbjct: 2848 DLEMRVYNATLSLTSFGKELTEEDIAEMSAETYISYASTLTSGRIFEIPQLTINMTTFQN 2907

Query: 2835 ENSKIIEYLFACKFHDKISVRWNLGPVNFIKEVWATHVKSLAVRRAQLKGDKEPQLVPGI 2894
             ++ I++Y ++C F  K+ V WNLGP+NFIKEVWATHV+SL VR  Q  G+ +  L    
Sbjct: 2908 ADNMILQYTYSCSFDGKVDVTWNLGPINFIKEVWATHVRSLEVRTVQFMGNHDISL---- 2963

Query: 2895 IGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKFIYVPLKEPQIEMPKIKDLEDATPP 2954
                                                 Y+ L+EP IEMP+IKDL+DATPP
Sbjct: 2964 --------------------ENEGDTDESVKVLSNIEYIALEEPYIEMPQIKDLKDATPP 3003

Query: 2955 LEWFGVNRKKFPRVTHQTAIILIQKIVHVAQKEYAKVLGDS 2995
            LEWFG+NRK FP  THQ+ I+ IQK+V+VAQKEYAKVLG S
Sbjct: 3004 LEWFGLNRKYFPSATHQSVIVPIQKLVNVAQKEYAKVLGSS 3044

>KNAG0G02030 Chr7 complement(453579..462575) [8997 bp, 2998 aa] {ON}
            Anc_8.260 YLR087C
          Length = 2998

 Score = 2431 bits (6300), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1272/3063 (41%), Positives = 1876/3063 (61%), Gaps = 143/3063 (4%)

Query: 5    SQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKYKVKI 64
            SQF SISL + K FSWVFL  W+LT I S+TV+FY+ R      +FI  W +WK+Y++K+
Sbjct: 6    SQFNSISLDKGKDFSWVFLVDWILTLILSITVLFYVGRAIAWFISFIAEWLLWKRYRLKV 65

Query: 65   NIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLSSEQS 124
            NIES+RVS LGG +F KN++II++D+T+SFL  +I WRYWL   R  ++  +  L++E  
Sbjct: 66   NIESLRVSLLGGRIFFKNLTIIDKDYTISFLIGQISWRYWLFRPRIPQFLTE--LNAEDD 123

Query: 125  QGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSSFLNE 184
             G+      ++++N KL C +L+EC+G E+F+YNR  AY+N +++F+KEER KF  FLNE
Sbjct: 124  DGA------SLQRNEKLACRLLLECEGVELFLYNRTVAYDNTIKMFSKEERAKFEEFLNE 177

Query: 185  HDLGDIVSEDTNV----------NSMDKDYFXXXXXXXXXXXXXINDRTYKKNKDERKSI 234
            H   D  S +++           + ++   +              NDR +  +++  K++
Sbjct: 178  HVFTDRASTESSNGSSSEESKAQDEVEIKSYTESSFDESNESQMANDRIFH-DEETGKNL 236

Query: 235  LFNFLPIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQD 294
              N+LP+Q+++ H +  +GN+FTPSL++ S ++  GV+D     EK+D+YK+K+TM  ++
Sbjct: 237  FLNYLPLQIKVSHASYVVGNKFTPSLLIVSADSAEGVMDYCQPKEKLDIYKTKLTMDAKN 296

Query: 295  VNISVKPNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVE 354
            V++S+K N+ Y+ E   +  +  GKLS++W+ F+     +  P         KK    V 
Sbjct: 297  VSVSLKQNIGYNEEVLLKFKLTTGKLSKLWDNFVKATAFVRKPLGL---SRKKKNRPSVT 353

Query: 355  SMFVNKWRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGI 414
            + F  KWRGLSLYK+ + +  +  LD+  +D    EYAKF+SI+KCP   L+Y  D PG 
Sbjct: 354  ANFHQKWRGLSLYKNYMFEDVQNDLDDIEFDLAGHEYAKFTSIIKCPRAILTYEFDIPGF 413

Query: 415  VPHGAHQTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSK 474
            VPHGAH T    DGPDIGN+G+PP F +++Q+   S+ YGPW  RQV+++  +L+P +S+
Sbjct: 414  VPHGAHPTLSSIDGPDIGNNGAPPTFGLEIQLFGGSLCYGPWAQRQVAFIQSLLAPQISR 473

Query: 475  NQIPIKKLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGW 534
            +Q P+K L+PG RR++T+FK+ + + ++ +WRIPTRE SKD EF++ +  TN+D+RPFGW
Sbjct: 474  DQKPVKPLQPGERRMYTLFKLGIVVNEDITWRIPTRESSKDAEFLRHYKNTNEDYRPFGW 533

Query: 535  LDFNLNKGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGY 594
            LD   +K + A+FNF+L  T DG  N   IH  D E+ +SVNHDI +KSK  D   ++G+
Sbjct: 534  LDLKFSKDSYASFNFALCSTADGSQNTMKIHLGDSEIRSSVNHDIFIKSKSLDFDLNLGF 593

Query: 595  PLGWNSQADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDI 654
            PLGWN +A W  ++ + QLETFLL+EHI+L +D  SDF++ +PTPYELFRPF Y++NW +
Sbjct: 594  PLGWNEKAKWTINVASSQLETFLLREHITLIADTMSDFSTGEPTPYELFRPFLYTINWKL 653

Query: 655  EGYSIYLNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPM 714
            +GYSIYLNVND NIVNNPLDFNENCYLS HGD L++D  +P   I    T+I++NIYTPM
Sbjct: 654  DGYSIYLNVNDHNIVNNPLDFNENCYLSFHGDILNVDITVPKDRIDARATDISYNIYTPM 713

Query: 715  FRLLLNTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLF 774
            FRL+LN PPWNTL+EFMK KEVGRA+DF   G+YLIY++LD+DNVD IT+ C+S+ST L 
Sbjct: 714  FRLMLNAPPWNTLNEFMKHKEVGRAYDFRTTGNYLIYNELDVDNVDMITIICSSKSTVLH 773

Query: 775  CYGVVIRYLMNVQANYFGDFVHFITSEEYSEILQKNN-------KRSNDEQGSFXXXXXX 827
            CYG VIRYLMN++ NYFGDF HF+TSEEY+E +           ++ +D+  +F      
Sbjct: 774  CYGFVIRYLMNIKMNYFGDFFHFVTSEEYTEKISSKGYGEGSLFEKYSDDASTFVSDFDK 833

Query: 828  XXXXXXXXXXXLYTKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNL 887
                          +E D  K     ADV R  NE D+W TF +W+GAL+LPE +YN + 
Sbjct: 834  N------------NEEDDKVKVPRGPADVRRKTNETDLWLTFNIWEGALLLPETIYNCDP 881

Query: 888  CSSLLFSELMISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTL 947
            C +L F EL I  R +NYYMD L +L D+ + ++ N  P+EIF  VR  +      H  +
Sbjct: 882  CIALHFGELAIDVRSTNYYMDLLASLDDIILRQYSNVQPNEIFENVRQCNGRDVKGHSYI 941

Query: 948  SDVTIHAHRMFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENK 1007
            S++ IH HRM+GLPP + TYFC+W  D G++ ++S ++F+      F K+GFG+ +LEN 
Sbjct: 942  SNINIHGHRMYGLPPTEPTYFCKWDFDLGTIKLESEVDFMKGLVTSFQKIGFGFDDLENV 1001

Query: 1008 LVYKVESSDDMTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLK 1067
            L+Y+ E  DDMT +T+  +   I++ +     +A L +  ++  +IDF+NE+YS R++++
Sbjct: 1002 LLYEKEVVDDMTAVTVNVKDFKIIIHNPELHSRAELILNNMQFCNIDFENEKYSTRMDIR 1061

Query: 1068 IPEFSISIFDVRNPTIKPI-LLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRC 1126
            IP   +S++       K +    F+TKI+FTNF   ++       QR YIT++D+P+HRC
Sbjct: 1062 IPLLKLSLYGYNYEASKELSFFNFETKINFTNFCNYKNCVQHRALQRDYITMNDAPFHRC 1121

Query: 1127 FFILPTMYQESFLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLENPFLN 1186
             FILP  YQ S +Y +LYG I PS S+P LP+P+L  T +F+++DFL EY+   +   LN
Sbjct: 1122 GFILPASYQNSVIYQKLYGSIVPSSSLPPLPLPLLEETFEFIIQDFLHEYNTTSDCIILN 1181

Query: 1187 I--RSINNLDTSSLFNEY--RVDTYISEKAIFKAEEKNTVNYDPKYEYDNYILNVEYIRV 1242
            +      NL++ S FN Y       +S+  I K+         P+ E DNY+++  YI +
Sbjct: 1182 LPYPDSTNLNSDS-FNSYPDTAPHTLSDTIIRKSPL-------PEDERDNYVIDFRYISI 1233

Query: 1243 DINPLFSDFIDSMSTKLYSENXXXXXXXXXXXXXXXLGSPKKVLLRETNLKLKISYVDIF 1302
             I+P    +I+ +    Y ++               L + ++ +    N K++I + D+F
Sbjct: 1234 SIDPELFFYIEKLLNHFYGDDDTQVIDSIEIGLVKRLSNFQEGISSINNFKIRILFFDVF 1293

Query: 1303 WGSRNSEGIEIYLDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEIEYE 1362
            WG R++ GIE+YLD LDFEM ++  +   ++SL E T L KL S+R S +          
Sbjct: 1294 WGQRDTGGIELYLDTLDFEMNEKSIEKNREKSLTEVTTLMKLNSIRASVNAKYSRGKTEG 1353

Query: 1363 RPPALSLTVEGLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGS 1422
            +PPALSL VEG++ WS T     NSI + S D T+D +Q  WL  +   Q E   ++  +
Sbjct: 1354 QPPALSLMVEGVKFWSTTAKKVINSIILTSIDATIDETQVVWLFNFFGDQKELIGSVVKT 1413

Query: 1423 VDLLQKRDVTLQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTR 1482
             + +QK     +K LIS+LT ASEYYQI HDPYVITKPA I RLS  HVRENRSW+I+TR
Sbjct: 1414 FEKVQKLRTQSRKELISRLTVASEYYQISHDPYVITKPAFITRLSRGHVRENRSWKIITR 1473

Query: 1483 LRHILNYLPEGWEKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVF 1542
            LRHI+ YLP+ W ++    ++ R   +  D K++F+SVFS+WRNWE SDVARSYIY +VF
Sbjct: 1474 LRHIMTYLPDDWNETVAKQLKERKYNASKDAKSIFMSVFSSWRNWEFSDVARSYIYNKVF 1533

Query: 1543 L---PDIEKNLINNTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPKAAT 1599
            L    + ++  +N   K    S Y T+Y+    VDH+ +VT+ N++      +E P    
Sbjct: 1534 LANQAEKQQKTVNKGWKAAFVSVYITVYTAGLGVDHSFIVTKSNLVF-----EETPDTTE 1588

Query: 1600 ANKN-DKIYDITGTVGTFKGELGDQLIRLKKLYSEDKAKIRSEKSTDFSIPKFFKINIVL 1658
            +  N +K+ ++TG +G+ KG++ D++ +L  L +  + +      +  S  + FK+NI L
Sbjct: 1589 SGYNQEKVINVTGNLGSIKGKISDKMFKLHNLMNLVQQQEDPALKSISSFSRSFKLNIAL 1648

Query: 1659 IVEKGELTLAAANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNELIL 1718
            + +  +L      T L + I +GK S  +EN +     + S+V YA R E  +KH   +L
Sbjct: 1649 LFDSSDLLFVFGETSLTNTIHSGKASFLWENPKGPTKETASLVLYAKRCETSMKHRNSML 1708

Query: 1719 LDAHLDDLFISVIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGR 1778
             +  +  + +S  A+ ++  P+I+ N +   +  + +P T+ +V FL+EF  + + +   
Sbjct: 1709 FENQITGIALSAAADSIISHPSIVANFQCDDINLRVMPQTEVIVTFLQEFIAKFNLVKES 1768

Query: 1779 L-TDKDNKKRHTSTSPIFSTKK------XXXXXXXXXXXXXXXXVILSPFTVKHSMKELK 1831
              TD   K   T+ SP  +  K                      + + PF  +   K+++
Sbjct: 1769 FETDDLPKPTPTNDSPKPTPTKINPFLLVDLDFTCFFSNVSLDIMPIVPFQFRQETKKME 1828

Query: 1832 IVFNREGDNDTIFSILDADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTS 1891
              F+ +   +  F+I D+DLYL S+    QYFRLS  +I +        + +  +++  S
Sbjct: 1829 FKFSSQRTQNFQFNIWDSDLYLGSHLTKQQYFRLSLGNIIVGYTNGRLVNTIHNLDVSAS 1888

Query: 1892 LIKLTLADPKKITNSLLQDEKTFEQSLESIKTLNTLFSSNREVRTSAVDNPYKFMVNFDL 1951
            ++KLT ++P ++  S LQDE+   +S++ ++ L  LFSS  E+ T        + +N D+
Sbjct: 1889 IVKLTFSEPHRMLFSFLQDEREVSRSVKKLQVLGNLFSSEPEINTIPAGAKIDWRLNADI 1948

Query: 1952 TYFGLLFPVDTSYFILELHSLLATFSNV-YMNPQQLKEKITCNLALQNTLFMIKSPEVNN 2010
             Y G+L PV T++F+ E+H+LLA+ ++V Y    +  ++ +  +++ N LF+IK   + +
Sbjct: 1949 KYLGILIPVSTTFFVFEMHTLLASLADVDYGEIYREADEASGQVSVDNILFLIKDRTIPS 2008

Query: 2011 QVSKVLDFSVNLSTETKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKE 2070
             +S+++D S  +S   KI+ S  S+++ES H R C +P SL++IL G  Q  +   +Y+ 
Sbjct: 2009 TLSRIIDLSFKISAIQKIMESHHSYQIESPHLRFCFSPYSLVRILWGGHQLLALHSHYRR 2068

Query: 2071 HTRLQIF----KTKKKASVVSENLIGAPLIEYSIHFLSYNFCIGWIFENSQSSYPGLIMG 2126
            H    ++    K +KK          + L   S H LSYNFC+GW+F+N+  +  GLI+G
Sbjct: 2069 HHSKNLWDFLPKKEKKVEEDKTTSFFSTLTFGSCHILSYNFCVGWLFQNNGDTDAGLILG 2128

Query: 2127 YDRLFSAYEDSYGKLTVVDGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEV 2186
            Y+RLFSAYE   GKLT+VD FFS++NG +SDTFYS GNE++KYNRS+LPNLQI+YWLK  
Sbjct: 2129 YNRLFSAYEKGCGKLTLVDAFFSVSNGRTSDTFYSDGNEEDKYNRSFLPNLQIIYWLKAA 2188

Query: 2187 DAMKQLFVRFYGETIDVRFLSNFATIINLTIESVQHFQMIKKETVREMNVEAE------- 2239
              MK +F+R +GET+DV FLS+F  II  T++S+Q FQ +KK  V  +            
Sbjct: 2189 AEMKDVFIRLHGETLDVNFLSSFVKIIEATLQSIQVFQELKKVLVNPLTQSEARSEEEEE 2248

Query: 2240 -------------KKVGEDDISTKFSLFFSKVQRINCQCIYDGGVFTVYPVRGNHIDTEH 2286
                         K+  ED      + F S ++++NCQ  YDGG+F VY       + + 
Sbjct: 2249 ESEEHNRRETVPGKEKKEDAPRKDIAPFLSDIRKVNCQFKYDGGIFKVYSFEDIESNLDP 2308

Query: 2287 AIEITTPKVIIDVDYKYRIDMKKPHWIRSFINIEPTYNTLLSQFASFLTEFGESVHEMVA 2346
            + EI +P V ID+DYK  I   KPH IR+ I +  T+N L ++ A  L    + +  MV 
Sbjct: 2309 SFEIRSPGVTIDLDYKNNIGDVKPHLIRTLITVNSTHNVLFARCAPLLMALSQDIQHMVK 2368

Query: 2347 KFSPKEQPPAPKTVSPP---IDYKRILEDFDVSFSISAGKQKVSLSCEPVAKVHANVGFE 2403
            K S K++P   + VS P   IDYKR+L  FD+ F I + +QK+SLSCEP AKV ANVGF+
Sbjct: 2369 KHSSKKKPEPKQRVSRPSQNIDYKRLLNSFDILFKIISSEQKLSLSCEPKAKVQANVGFD 2428

Query: 2404 SFVFSIITNDDDPTEPLSCSLTVNDIKTSINHEFSTEPTASFSVDFVDITTLFTHPDI-- 2461
            SF+F+I+TND D +EPLS +L V + +++I H FS EP+ASF +D +D+T +FTHP+I  
Sbjct: 2429 SFMFAILTNDLDTSEPLSFALVVKNTRSAIRHIFSREPSASFGLDLIDVTFMFTHPNIIN 2488

Query: 2462 -YGTTLISDVSLYFNIKQLQNLMVFLDIWNLKRLIKLRPQKSVPVKKPEXXXXXX----X 2516
             +G  LISDV +YFN+KQLQNL +FLDIW L  L  LRP+   P+KKPE           
Sbjct: 2489 MFGACLISDVEVYFNVKQLQNLYLFLDIWKLSNL--LRPK---PMKKPEDHHVAIDAPPS 2543

Query: 2517 XXXXXXXIIPWSFTVIITDINGDIHXXXXXXXXXXXXXXXWISTNHFQDRRKALRFFTDS 2576
                   IIPW FT+I  +ING +                W +++H++ +R+ L  + D 
Sbjct: 2544 SPMDVGNIIPWCFTLIFANINGKVDLGPSLGLLSLSMRKAWFASDHYESKRQLLHAYIDQ 2603

Query: 2577 LSLTSVGRLGGLIDVANISWILNVRYVENEKLDQSPLVDITLNVENVAVKAAFDYHMFLI 2636
            + LT+ GRL G++++    W   V + + +  D  PLV ++  + N+++K AFDYHMFLI
Sbjct: 2604 IKLTAKGRLSGIVELDGALWAAEVNWPKYD--DPYPLVALSFVISNISLKVAFDYHMFLI 2661

Query: 2637 GRVHNILFNLESEKDLIGNLPDLLKLHLVCDEIDICSTALVASNILDISNTISRTRQDSR 2696
            G V N +F+L SE+D  G +PDLLK+ L C++ID+CSTALVA+N+LD+ NTI R RQD+ 
Sbjct: 2662 GTVLNTVFHLHSERDTSGFMPDLLKVMLTCEQIDMCSTALVAANLLDLYNTIMRMRQDTN 2721

Query: 2697 NSYIETLLESNPPPQKSSISYTDILKSLNLLRTDVGIEIHKMQVQISPISLFDVEVIVTT 2756
             SY+ETL ESN    K ++ Y DILK LNL++TDV ++I+ + VQISPISLFDVEV+V  
Sbjct: 2722 VSYLETLRESNTTDTKETVDYKDILKVLNLIQTDVVVDINTLNVQISPISLFDVEVLVVN 2781

Query: 2757 VENVSARSVTQSGEKLMTDLQMKIYKATLSLSKSNEELDEEAVSEISVDDYMIYAMKLSG 2816
            + NV A   T +GEKL T L +++Y A  SLS S  E+DE+ VS+ISV+DYM+YA K+ G
Sbjct: 2782 IANVCANVKTHAGEKLETYLHLQLYNAHGSLSSSKGEMDEDMVSKISVEDYMVYASKIVG 2841

Query: 2817 GKILSIPKLFVGMTTWQLENSKIIEYLFACKFHDKISVRWNLGPVNFIKEVWATHVKSLA 2876
            G I  IPKL + M T+Q  NS I+EY +   F DKI+VRWNLGPVNFIKE+W TH+K+LA
Sbjct: 2842 GTIFDIPKLEISMHTFQKSNSDILEYGYRSTFGDKIAVRWNLGPVNFIKEMWTTHIKALA 2901

Query: 2877 VRRAQ----LKGDKEPQLVPGIIGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKFIY 2932
            VRR+Q      GD+E  +                                      K  Y
Sbjct: 2902 VRRSQSLVGTTGDEEGDV---------------------------EKRMRDEETLSKLTY 2934

Query: 2933 VPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFPRVTHQTAIILIQKIVHVAQKEYAKVL 2992
            + ++EPQI+ P+IKDL DATP LEWFG+NRKKFP  THQT I+ +QK++H A+KEYA ++
Sbjct: 2935 IAIEEPQIDTPQIKDLGDATPSLEWFGLNRKKFPIFTHQTVIVPVQKLIHSAEKEYANIV 2994

Query: 2993 GDS 2995
            G S
Sbjct: 2995 GHS 2997

>ZYRO0C01694g Chr3 (121250..130270) [9021 bp, 3006 aa] {ON} similar to
            uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 3006

 Score = 2351 bits (6093), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1244/3068 (40%), Positives = 1853/3068 (60%), Gaps = 143/3068 (4%)

Query: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60
            M+  S F  +SL R + FSWVFL  WVLTCI +LTVIFYL R+FG + TFIL W +WK+ 
Sbjct: 1    MDGRSPFQKVSLDRTRNFSWVFLVDWVLTCIVTLTVIFYLGRIFGFLLTFILEWVVWKRC 60

Query: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120
            KVKINIES+R++ LGG +  +N+ II++D+T+S LE  I WRYWL NSR+ +Y  Q NL 
Sbjct: 61   KVKINIESLRIAPLGGNIMFRNLCIIHRDYTISCLEGTINWRYWLFNSRKSQY--QENLD 118

Query: 121  SEQSQGSDASNSMTIEKNS--KLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKF 178
            +E+ +     N    + NS  K PC  L+ C+G E+FVYN+ ++YEN++ +F+KEER +F
Sbjct: 119  NEEER---LENGQEPKSNSGRKHPCRFLLACEGLEIFVYNKTSSYENIIHMFSKEERAQF 175

Query: 179  SSFLNEHDLGD----------IVSEDT-------NVNSMDKDYFXXXXXXXXXXXXX--- 218
              F+++  + +          ++SE T        V S D++                  
Sbjct: 176  EKFVDDQTMTELFNESEQENKVLSESTPSSVTMETVGSNDRNNNEDSNEEEDAGRNQNDG 235

Query: 219  ------INDRTYKKNKDERKSILFNFLPIQLRLIHGAVTLGNRFTPSLVVASYENCNGVL 272
                   ND  +++    RKS+   FLPIQ+     ++ LGNRFTPS++V S +N  G++
Sbjct: 236  QAPNNLENDELFEQQCSNRKSMYMRFLPIQISTRRFSLVLGNRFTPSILVVSAKNSKGII 295

Query: 273  DVSHANEKIDLYKSKVTMKFQDVNISVKPNLAYDSEFTNELDIDKGKLSRIWNTFIDIMD 332
            D+    EK+DL+K K+  +  DV+ SVK N+ +D + +      +G+LS++W  F  I  
Sbjct: 296  DLCPPKEKLDLFKIKLEKELYDVDASVKQNIGFDDDISTSFKWTRGRLSKLWQKFARIF- 354

Query: 333  MIPNPFTKIYHKHMKKKEHDVESMFVNKWRGLSLYKDNLRDAGRYGLDEASYDFLNREYA 392
            ++P     +  KH++ +E   +  F   W+GLSLY+ N+ +     L+   +DF N EYA
Sbjct: 355  LLPT----LGPKHLQTQE---DITFRENWKGLSLYRQNMEEDE---LENVDFDFANHEYA 404

Query: 393  KFSSILKCPNFTLSYYLDSPGIVPHGAHQTNVKKDGPDIGNSGSPPEFLVDLQVSKASIY 452
            +  SILK      +Y  D PG+VP    +T     GP++GNSG+PPEF VD+Q+  A+I 
Sbjct: 405  RVISILKSAKIVFTYEYDIPGLVPKEPEET---LQGPEVGNSGAPPEFGVDIQLYGANIC 461

Query: 453  YGPWTNRQVSYLIRMLSPVVSKNQIPIKKLEPGSRRIHTVFKMSVHIIDESSWRIPTREP 512
            YGPW  RQ+SYL  +LSPVVS+   PIK L PGS+RI+T+FK S+ I++ES+WRIPTRE 
Sbjct: 462  YGPWAERQLSYLRALLSPVVSRTPKPIKTLTPGSQRIYTIFKTSISIMEESTWRIPTREK 521

Query: 513  SKDKEFIKQFVKTNDDFRPFGWLDFNLNKGTQATFNFSLIPTIDGLGNNFDIHFLDMEVT 572
            SKD+EF++ +V+T ++FRPFGW+D    K +    +  + PT +G  NN + HF +ME+ 
Sbjct: 522  SKDQEFLRHYVETKEEFRPFGWIDLKFMKDSYGILDTVICPTEEGSPNNVNFHFSNMEIR 581

Query: 573  TSVNHDILLKSKEFDVVADIGYPLGWNSQADWKFDIIAKQLETFLLKEHISLFSDMFSDF 632
            TSVNH++LL++K FD  AD+GYPLGWN QA+W  ++ + QLE F+L+EHI+L SD+F+DF
Sbjct: 582  TSVNHELLLRAKSFDFEADMGYPLGWNDQANWNINLSSTQLEIFILREHITLISDVFADF 641

Query: 633  ASEDPTPYELFRPFTYSLNWDIEGYSIYLNVNDRNIVNNPLDFNENCYLSLHGDELHIDS 692
            +S DPTPYELFRPF Y +NW+++GYSIYLNVND NIVNNPLDFNENCYLSLHGD L  D 
Sbjct: 642  SSGDPTPYELFRPFIYRINWNLDGYSIYLNVNDHNIVNNPLDFNENCYLSLHGDHLIFDV 701

Query: 693  LIPNLLISQPYTEIAFNIYTPMFRLLLNTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYS 752
             IP   ++   TEI ++I TPMFRLLLNTPPWNTL+EFMK+KEVGR+++F + G Y ++S
Sbjct: 702  KIPRQTVANRCTEITYHISTPMFRLLLNTPPWNTLNEFMKNKEVGRSYNFQVNGLYTVFS 761

Query: 753  DLDIDNVDTITMECTSRSTTLFCYGVVIRYLMNVQANYFGDFVHFITSEEYS---EILQK 809
            +LDIDNVDTI++EC+S  TTL CYG V+RYLMNV+ NYFGDF HF+T+EEY+      + 
Sbjct: 762  ELDIDNVDTISVECSSFGTTLHCYGFVVRYLMNVKMNYFGDFSHFVTAEEYTNANHTEEP 821

Query: 810  NNKRSNDEQGSFXXXXXXXXXXXXXXXXXLYTKEQDLSKPHVRRADVLRTENELDIWFTF 869
             N+   DE   F                    +  +   P  +R+++ RTENE+DIWF F
Sbjct: 822  KNENLGDEHSGFNISSTEDVETDRTNPE---GRPANKGIPMPKRSELKRTENEMDIWFVF 878

Query: 870  RVWDGALILPEGLYNGNLCSSLLFSELMISFRGSNYYMDFLTNLYDMKINRFLNFSPDEI 929
             VW+GALILPE +YN + C +L F+EL +  R +NYYMD L  + + ++ R+++  P ++
Sbjct: 879  SVWEGALILPETIYNSDPCIALHFNELEVDLRSTNYYMDLLATMNNTELKRYVSRHPHDL 938

Query: 930  FRYVRDPDHNLNIVHGTLSDVTIHAHRMFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSS 989
            F  VR  +      HG LS +TIH HRM+GLPP + TYFCQW +D   L I+S++EF   
Sbjct: 939  FECVRKDNGRQEKSHGYLSSLTIHGHRMYGLPPTEPTYFCQWGVDIDRLEINSDLEFAKG 998

Query: 990  FFGLFTKLGFGYSNLENKLVYKVESSDDMTLLTLYGEKVLILVSDDVSQKQASLEILKLK 1049
            F   F+K+GFG+ NLEN L+Y+  +  DMT +T+  +++  +++D  +  ++ L   K+ 
Sbjct: 999  FLTCFSKIGFGFKNLENILLYETNTLFDMTSVTVRVKELKFMMNDADTSSRSVLHAKKIT 1058

Query: 1050 LNSIDFQNERYSKRINLKIPEFSISIFDV-RNPTIKPILLGFKTKIDFTNFVIKEDFRNS 1108
              +IDF+NE YS+R++ K P+ +  IF++  N      LL  KT+++FT+F+  + F + 
Sbjct: 1059 FTAIDFENEAYSQRVDFKFPDINFLIFELDENQKEGRFLLHLKTQLNFTDFIQNQAFADH 1118

Query: 1109 LNGQRTYITLHDSPYHRCFFILPTMYQESFLYNELYGGITPSFSIPILPIPMLPNTIDFL 1168
               QR YITLHDS Y+RC F+LP  +QES LY EL G I+PS ++P LP+P+L  TID++
Sbjct: 1119 RYRQREYITLHDSAYYRCSFLLPCFFQESVLYKELLGSISPSATLPPLPLPVLAETIDYI 1178

Query: 1169 VEDFLKEYSDLLENPFLNIRSINNLDTSSLFNEYRVDTYISEKAIFKAEEKNTVNYDPKY 1228
            +ED L EY+  ++    +    +    + L NE   DT     + F +        + + 
Sbjct: 1179 IEDCLGEYAPTVKPDDSSSSDTSEGQRTPLTNE---DTRFQANSGFFSPHMPHNPPNNRD 1235

Query: 1229 EYDNYILNVEYIRVDINPLFSDFIDSMSTKLYSENXXXXXXXXXXXXXXXLGSPKKVLLR 1288
             Y+NY+L+VEY+ +++ P  +  + +   K Y+E+               LG+ +     
Sbjct: 1236 RYNNYVLDVEYVNLEVKPSVTGVLLNYLKKFYTEDTTDIIDKNEIAIVKKLGNLQYGASF 1295

Query: 1289 ETNLKLKISYVDIFWGSRNSEGIEIYLDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLR 1348
             T  +L +  +   +      G+E+ L+  DF++R++  ++ +++ + E+T+ S + +LR
Sbjct: 1296 VTTSRLHVKDLHFLYDFEEGSGVELALNSFDFDLRRKTIENEDEKVILEKTMFSNIHTLR 1355

Query: 1349 CSFSETQYEEIEYERPPALSLTVEGLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKY 1408
             S  E     I   +P AL L++E LE+WS T     NS+N+ S   T+D SQ   +  Y
Sbjct: 1356 ISLLEAHPSSISM-KPAALQLSIEDLELWSSTVDENVNSVNVTSFGFTLDESQLERISGY 1414

Query: 1409 LNKQVEFFYNLKGSVDLLQKRDVTLQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSN 1468
            L  Q++   +   S   L+      QK LI  LT+ASEYYQI HDPYVITKPA IMRLS 
Sbjct: 1415 LFGQIKVLRDTITSAKELENLRKKTQKDLICDLTSASEYYQISHDPYVITKPAFIMRLSE 1474

Query: 1469 SHVRENRSWRIVTRLRHILNYLPEGWEKSSIAFVEARHVYSDSDPKN---------VFLS 1519
             HVRENRSWRI+TRLRHIL YLP  W         A H+ +  D +N         +F+S
Sbjct: 1475 GHVRENRSWRIITRLRHILTYLPNDWRT-------ADHLVTVQDSENPNVPQRDEDIFVS 1527

Query: 1520 VFSNWRNWEVSDVARSYIYRRVFLPDIE---KNLINNTTKIGMESFYFTIYSQRYAVDHN 1576
            VFSNWRNW++SD+ RSYIY+++FLP  E   K  +    KI  +SF+FT+    Y V  +
Sbjct: 1528 VFSNWRNWDLSDITRSYIYKKIFLPQNEDSFKKELRTVLKINFQSFFFTVLISGYEVARS 1587

Query: 1577 IVVTRINVIIDQMLSDEEPKAATANKNDKIYDITGTVGTFKGELGDQLIRLKKLYSE--- 1633
             + TR N+I+D +       +    K +K+  +T  +G  KGE G+++ +LK+L+S+   
Sbjct: 1588 TIFTRTNIIVDVLPPSVNTSSENLFKQEKVITLTANMGAIKGEWGEEVFKLKELFSKFSE 1647

Query: 1634 ---DKAKIRSEKSTDFSIPKF---------------------FKINIVLIVEKGELTLAA 1669
               D        S   SI  F                      KI   +I E+ +L    
Sbjct: 1648 NELDDLSNLGSISRSASISGFGSQMDRLESSRASGPGDRFRNLKIFATMIFERCDLHFVV 1707

Query: 1670 ANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNELILLDAHLDDLFIS 1729
             +T+L +RI NGK S   EN+++    + S V++A R E+WLKH+  +L +  L  L ++
Sbjct: 1708 GDTRLTNRIINGKNSMLLENSKENTPPALSAVFFAQRHEIWLKHSTNVLAEVLLKQLHVA 1767

Query: 1730 VIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRLTDKD--NKKR 1787
              A+L V  P + +N ++++   +A+P+T  L   + + +R++  +  +    +  N   
Sbjct: 1768 ATAQLGVI-PFVSLNCQATNSFIRAMPSTVVLRNSVEKIKRQVEVLIPQFKSHEVKNSSA 1826

Query: 1788 HTSTSPIFSTKKXXXXXXXXXXXXXXXXVILSPFTVKHSMKELKIVFNREGDNDTIFSIL 1847
             T  +P    K                 ++LSPF +   +K+L I  +   + + +   L
Sbjct: 1827 VTKKTPRIPIK---FDIRFNFTDMSSEIMLLSPFYLLQDVKQLHIYASGHENMELVLGFL 1883

Query: 1848 DADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKLTLADPKKITNSL 1907
            + D+YL S  +  Q+F+ S  D+  +  + D    ++ + I TSL+KLTL +P++  ++L
Sbjct: 1884 EYDVYLKSQLSSEQFFKFSSTDLQFKCEVADEVVPVVEVQISTSLMKLTLCEPRRALHNL 1943

Query: 1908 LQDEKTFEQSLESIKTLNTLFSSNREVRTSAVDNPYKFMVNFDLTYFGLLFPVDTSYFIL 1967
            LQDE+T  +S++ I+ L     S       +     ++ ++ +L YFGLL PV +  +I 
Sbjct: 1944 LQDEQTLVESVDHIQKLWNFLRSASGGNDRSPSRNTRWALDANLKYFGLLVPVSSICYIF 2003

Query: 1968 ELHSLLATFSNVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSKVLDFSVNLSTETK 2027
            ELHSL A+ +N     ++     +  + +++   ++K   +   +SKVLDFS+   T  K
Sbjct: 2004 ELHSLFASLTNANEQYEEYDRHFSGQIVVESCYLLVKELSLPANLSKVLDFSIRFLTSQK 2063

Query: 2028 ILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQIFKTKKKASVVS 2087
            + NS +S+++ESS+FR+CL PE L+ IL  V    S   ++K+H    +  +  K +   
Sbjct: 2064 VPNSLQSYQIESSYFRLCLFPELLVDILWSVHYLQSLLNHFKKHHTPWLPYSSNKTAKSG 2123

Query: 2088 ENLIGAPLIEYSIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAYEDSYGKLTVVDGF 2147
            E+ +       SIH LSYNFC+GW+FE   +S PGLI+GYDRLFSAYE  +GKLT++DG+
Sbjct: 2124 ESTLDF----RSIHILSYNFCVGWLFEVGDNSEPGLILGYDRLFSAYEKHFGKLTLIDGY 2179

Query: 2148 FSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYGETIDVRFLS 2207
             S+ANG +SDTFYSQ +EK+ Y R+YL N+QI YWLK  + +K LFVRF+GE IDVRFLS
Sbjct: 2180 LSVANGNTSDTFYSQKSEKDSYTRTYLSNMQIFYWLKGENLLKDLFVRFHGEVIDVRFLS 2239

Query: 2208 NFATIINLTIESVQHFQMIKKETVREMNVEAEKKVGEDDISTKFSLFFSKVQRINCQCIY 2267
                ++  T+ S++ F  +KK  +++     + K+  +  S   + F + ++ IN Q  +
Sbjct: 2240 TSFKLVEKTLHSIKRFNEMKKAKIKQTGSSTKSKLNMEAASNTLAPFLAHIRTINSQLNF 2299

Query: 2268 DGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDMKKPHWIRSFINIEPTYNTLL 2327
             GGVF VY         E  +EI +P V + ++Y++    +K H IR F  IEPT+N L 
Sbjct: 2300 AGGVFKVYSPTELDSKAEPLLEIKSPGVQMAINYEFNETREKSHCIRFFTTIEPTHNMLF 2359

Query: 2328 SQFASFLTEFGESVHEMVAKFSPKEQPPAPKTVSPPIDYKRILEDFDVSFSISAGKQKVS 2387
            ++ A  L++F  ++  M+   S +++    K V+  IDYK +L  +D++F I++GKQK+S
Sbjct: 2360 AKCAPLLSDFNHNIKNMIRNLSSEDKSHPSKPVTDSIDYKSLLNPYDIAFEIASGKQKLS 2419

Query: 2388 LSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDIKTSINHEFSTEPTASFSV 2447
             SCEP AKV  + GF SF+F + T+  D  EP + S +++ I++S+ H FS + +A+F +
Sbjct: 2420 FSCEPKAKVQLDAGFNSFLFRVTTDKVDSVEPFNVSFSMDKIESSVRHIFSRDSSAAFML 2479

Query: 2448 DFVDITTLFTHPDIYGTTLISDVSLYFNIKQLQNLMVFLDIWNLKRLIKLRPQKSVPVKK 2507
            D++DI  +FT+P++YG  L+SD+++Y N+KQ QNL +FLDIW L    + +P ++    K
Sbjct: 2480 DYIDIVMMFTYPNVYGVALVSDMNIYCNMKQRQNLNIFLDIWRLSNRGRTKPSENKAEDK 2539

Query: 2508 PEXXX----XXXXXXXXXXXIIPWSFTVIITDINGDIHXXXXXXXXXXXXXXXWISTNHF 2563
             +                  + PWSFT+I T++ G +                WI+T H 
Sbjct: 2540 SDAKKSLSPPFSPSSNDSRKVFPWSFTIIFTNMGGVVDLGPSLGVLTLGLEQVWITTKHQ 2599

Query: 2564 QDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRYVENEKLDQSPLVDITLNVENV 2623
             D+++    F   +++ S GRL G+ ++   S +  + + E + L   PL+ +++ +  +
Sbjct: 2600 GDQKRTWHTFAHGITVNSEGRLSGMFELDQASSVSEISWPEEDLLRVGPLISVSMAINRM 2659

Query: 2624 AVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLHLVCDEIDICSTALVASNILD 2683
            ++K+AFDYHMFLIG + ++  +L +E D    LPDLL++ L  + I +C+TAL A+N LD
Sbjct: 2660 SIKSAFDYHMFLIGSMKSVKVHLHNESDTYAILPDLLQVSLEFESIVLCATALTAANALD 2719

Query: 2684 ISNTISRTRQDSRNSYIETLLESNPPPQKSSISYTDILKSLNLLRTDVGIEIHKMQVQIS 2743
            I NTI R +QD+R SYIETL ESN     +S++Y ++L SLNLLRTD+ + + +++V IS
Sbjct: 2720 IYNTIMRMQQDNRISYIETLKESNISASSTSVAYEEVLNSLNLLRTDMSVIVKELKVHIS 2779

Query: 2744 PISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKATLSLSKSNEELDEEAVSEIS 2803
            P+SLFD EV+V +V +V+ARS TQSGEKL T+LQ++I     SLS S EELDEE VS+I+
Sbjct: 2780 PMSLFDAEVLVVSVRDVNARSETQSGEKLKTELQLQISDVNASLSSSKEELDEETVSKIA 2839

Query: 2804 VDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYLFACKFHDKISVRWNLGPVNF 2863
            VDDYM+YA K SGG I+ +P+L V MTTWQ ++S ++EYLF CKF DKIS++WNLGPVNF
Sbjct: 2840 VDDYMLYASKFSGGTIIKLPQLLVSMTTWQQQSSPVLEYLFTCKFFDKISMKWNLGPVNF 2899

Query: 2864 IKEVWATHVKSLAVRRAQLKGDKEPQLVPGIIGXXXXXXXXXXXXXXXXXXXXXXXXXXX 2923
            IKE+WATHV+SLAVRR QL G+  P+L                                 
Sbjct: 2900 IKEMWATHVRSLAVRRTQL-GNSSPEL------------------------EVANESDKE 2934

Query: 2924 XXXXXKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFPRVTHQTAIILIQKIVHV 2983
                 KFIYVPL EP IEMP+IKDL DATPPLEWFGV+RK  P  THQTA++LIQK+VH 
Sbjct: 2935 DTVKSKFIYVPLDEPYIEMPQIKDLGDATPPLEWFGVHRKNLPAATHQTAVLLIQKLVHT 2994

Query: 2984 AQKEYAKV 2991
            A+KEYAK+
Sbjct: 2995 AEKEYAKL 3002

>TBLA0E04420 Chr5 complement(1126342..1135788) [9447 bp, 3148 aa] {ON}
            Anc_8.260 YLR087C
          Length = 3148

 Score = 2181 bits (5651), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1152/2604 (44%), Positives = 1635/2604 (62%), Gaps = 88/2604 (3%)

Query: 433  NSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQIPIKKLEPGSRRIHTV 492
            N  +PPE  ++ Q+  ASI YGPW +R +  + R+ SP+VS+        EPG  R +T+
Sbjct: 590  NISAPPESNMEFQLFDASINYGPWAHRNIMNIQRIFSPIVSRTPELQPDPEPGFLRRYTM 649

Query: 493  FKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDFNLNKGTQATFNFSLI 552
             K+SV I+++SSWR+PTREPSKD++F+K+++KTND  R FGW D N ++ ++ATF  S I
Sbjct: 650  TKISVSIMEDSSWRVPTREPSKDQDFLKRYMKTNDSSRSFGWFDLNFSRNSEATFCISSI 709

Query: 553  PTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLGWNSQADWKFDIIAKQ 612
            P ++G  N  ++ F D+EV +SVNHDI  +SK + V +DIGYPLGWN +  W F   + Q
Sbjct: 710  PDVNGYANKLNLDFKDLEVRSSVNHDIFFRSKSYRVDSDIGYPLGWNDEVTWSFVFDSYQ 769

Query: 613  LETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGYSIYLNVNDRNIVNNP 672
            LETF L+EH+ L +D FSDF+S +PTPYE FRP  Y ++W+  GYS YLNVND NI+NNP
Sbjct: 770  LETFFLREHLVLIADTFSDFSSGEPTPYEFFRPSIYKVDWNFHGYSAYLNVNDHNIINNP 829

Query: 673  LDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRLLLNTPPWNTLSEFMK 732
            LDFNENCY+S+HGD+ HI   IP L I+  YT+I F I TPMFRLLLNTPPWNTL+EFM+
Sbjct: 830  LDFNENCYISVHGDDAHIGVEIPRLGITATYTDIIFQISTPMFRLLLNTPPWNTLNEFMR 889

Query: 733  DKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYGVVIRYLMNVQANYFG 792
            +KE+GR +DF  EGSY+IYSDLDIDNVD++T+EC++R  TL  YG VI YL+NVQ NYFG
Sbjct: 890  NKEIGRGYDFTAEGSYIIYSDLDIDNVDSLTIECSTRRMTLLTYGFVIGYLLNVQMNYFG 949

Query: 793  DFVHFITSEEYSEILQKNNKRSNDEQGSFXXXXXXXXXXXXXXXXXLYTKEQDLSK---- 848
            +F HFIT+EEY++I++ N+   ND   +                        + SK    
Sbjct: 950  EFSHFITAEEYTDIVRGND---NDIVSTLADFSVMSETNSVSNVSNSQHNPDNSSKSNII 1006

Query: 849  -----PHVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLFSELMISFRGS 903
                 P +R+ D+ R  NE DIWFTF VW+GAL+LPE LYN + C +L F EL+I FR  
Sbjct: 1007 DPLYNPPLRKDDIKRKVNETDIWFTFSVWEGALLLPEVLYNSDPCIALSFKELIIDFRNC 1066

Query: 904  NYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIV----HGTLSDVTIHAHRMFG 959
            +YY+D L  L      R +  + ++IF  V    HN  I     HG++S+++IH HRM+G
Sbjct: 1067 DYYLDLLATLNGTSFKRCIRKNQNDIFELV----HNNAIKNLEEHGSVSNISIHGHRMYG 1122

Query: 960  LPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVESSDDMT 1019
             PP   +YF  W++D  +L I+S+I F+  F    TK+GF +SNL+N L+Y     D+MT
Sbjct: 1123 APPTSPSYFSDWAVDVNNLSINSDIYFIRGFISYITKVGFEFSNLQNILLYDESVLDNMT 1182

Query: 1020 LLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFSISIFDVR 1079
             +T++G  + ILV+D  +  Q  L +  +  N I+F N+RYS RI+L++P    + FD  
Sbjct: 1183 SVTVHGTGIDILVADKSTSAQVLLNMDGITFNRINFANDRYSSRIDLQVPGLHFAFFDNG 1242

Query: 1080 NPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPTMYQESFL 1139
            +   K  L  FKTKI+FTNF   +D       Q+ +I L+DS +HRC F+L    QES L
Sbjct: 1243 SSMDKTCLFEFKTKINFTNFTQMKDGELHSKKQQEFIALNDSAFHRCSFLLLPHIQESLL 1302

Query: 1140 YNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLENPFLNIRS---INNLDTS 1196
            Y+ELYGGITPS S+P LPIP+   TI F+++DFL         PF  I S   + ++ TS
Sbjct: 1303 YHELYGGITPSSSVPPLPIPVQAETIAFIIDDFL--------GPF-GINSTELLGSISTS 1353

Query: 1197 SLFNEYRVDTYISEKAIFKAEEKNTVNYDPKYE--YDNYILNVEYIRVDINPLFSDFIDS 1254
            +  +           ++    E    +  P     + NYI+++ YI +DINPLF  +  +
Sbjct: 1354 TPIHSSNKPLKPPSSSVIHPIESMQSHLVPSQSVTHGNYIIDISYITLDINPLFFTYASN 1413

Query: 1255 MSTKLYSENXXXXXXXXXXXXXXXLGSPKKVLLRETNLKLKISYVDIFWGSRNSEGIEIY 1314
               + YSEN               LG+  + L   TN+KL+I Y+D F+G RN+EG+E+Y
Sbjct: 1414 FLDEFYSENIIETIDGIEMAIVNRLGTKSEELDSVTNIKLQIKYLDFFFGQRNTEGLELY 1473

Query: 1315 LDKLDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSFSETQYEEIEYERPPALSLTVEGL 1374
            +D++D E+ Q+ F   +   L+E  ILS+  SLR S +E +  E   ERPPALSL +EG 
Sbjct: 1474 VDQIDLEVSQKTFQKKSTVVLDEIAILSRFLSLRASINEKKVLEDFDERPPALSLALEGW 1533

Query: 1375 EVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGSVDLLQKRDVTLQ 1434
            E WS T ++Q NS+NI STDITVD SQ  WLI YLN+ V F + L  S+D +QK+   +Q
Sbjct: 1534 EGWSSTASSQVNSLNISSTDITVDESQIEWLIDYLNRLVVFVHELVNSLDSIQKKSNGIQ 1593

Query: 1435 KSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLRHILNYLPEGW 1494
            K L+S LT ASEYYQI HDPYVITKPA +MR+S  HVR+NRSWRIVTRLRHI  YLP+ W
Sbjct: 1594 KKLVSDLTLASEYYQISHDPYVITKPAYVMRVSKGHVRQNRSWRIVTRLRHIYTYLPDDW 1653

Query: 1495 EKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFLPDIE---KNLI 1551
            E      +  + +   SD  ++FL+VFSNWRNWEVSDVARSYIY+++FL + E   +  +
Sbjct: 1654 EIHVQEEMRGKDMNDVSDSSDIFLTVFSNWRNWEVSDVARSYIYKKIFLSNDETTSEKKL 1713

Query: 1552 NNTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPKAATANKNDKIYDITG 1611
              T K+ + S +FTIYS  YA+DHNI++T+  ++++  L+ E   +    K+  I ++TG
Sbjct: 1714 QTTVKLNLNSIFFTIYSTGYAIDHNIILTKAVILLE--LTTETAVSPPIEKS--ILNMTG 1769

Query: 1612 TVGTFKGELGDQLIRLKKLY----SEDKAKIRSEKSTDFS-IPKFFKINIVLIVEKGELT 1666
            ++G+ KGE  D+ +RL +L      E+  K  +E S+  S    +F I++ L+ E G L 
Sbjct: 1770 SLGSIKGEFSDKFLRLLELIPDFSKEEDIKSLTENSSIVSEKSPYFTIHLFLLFENGGLQ 1829

Query: 1667 LAAANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNELILLDAHLDDL 1726
            L   +T L + + +GKIS   E +      S S  YY  ++E+ LKHN+ I+ +  L  L
Sbjct: 1830 LTMGDTTLSNNVTDGKISALLEKSSYSKEFSYSGAYYMKKSEMCLKHNKDIIAEFQLHHL 1889

Query: 1727 FISVIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRLTDKDNKK 1786
             +          P IL+N++S+ L FK+L +T+ +V  +     +I++ +  L    + +
Sbjct: 1890 GLISTGIYTPICPVILINLRSADLHFKSLASTEKIVKTI----EDITEYSVHLYKHYDLR 1945

Query: 1787 RHTSTSPIFSTKKXXXXXXXXXXXXXXXXV-----ILSPFTVKHSMKELKIVFNREGDND 1841
            ++T T P    +K                V     ++SPF +++  K+L + FN+ GD +
Sbjct: 1946 KYT-TKPTKVDQKPEKINFDVRVACNLSKVSAELTLISPFYLRYETKQLDLYFNQNGDGE 2004

Query: 1842 TIFSILDADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLITINIVTSLIKLTLADPK 1901
             + S+ D D+++TS+    QYFR SY DI +       K+K++ +++  SL+KLT ++P+
Sbjct: 2005 ILLSLWDTDIFVTSHHTKEQYFRFSYDDIQINCNPMSEKNKVLVVSLSASLVKLTFSEPR 2064

Query: 1902 KITNSLLQDEKTFEQSLESIKTLNTLFSSN-REVR-----TSAVDNPYKFMVNFDLTYFG 1955
            +I  S LQDE+   +S + +K L  +F SN + V+         D P K+ +  ++ YFG
Sbjct: 2065 RIFASFLQDERITIESFQELKKLKKIFFSNAKNVKKLNNDVPKEDTPTKWALELNINYFG 2124

Query: 1956 LLFPVDTSYFILELHSLLATFSNVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSKV 2015
            +L P+ +++F+LELH LL + +N     Q++  +I+  ++L+N LF+I    +  ++SK+
Sbjct: 2125 ILLPIASTFFVLELHMLLGSLTNTTEEIQEVNNQISGQISLENILFLINDRSLPLRLSKL 2184

Query: 2016 LDFSVNLSTETKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQ 2075
            +DFS+ +ST  K  +S  S ++ESSHFR+C +PESL+ +L GV Q  +  +YYK+H   +
Sbjct: 2185 VDFSIRISTLQKTTSSYESLQIESSHFRMCFSPESLVFVLWGVKQLQNELEYYKDHKTKR 2244

Query: 2076 IFKTKKKASVVSENLIGAPLIEY-SIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAY 2134
             +      +    +   +PL  + SIH LSYNFCIGW+   +Q   PG + GYDRLFSAY
Sbjct: 2245 QWNLSSHKTGTKSSTSESPLNYFRSIHILSYNFCIGWMLPENQKDIPGWMFGYDRLFSAY 2304

Query: 2135 EDSYGKLTVVDGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFV 2194
            E +YGKLT+++G+ S+ N  SS+ F+SQG EK ++NRS+LP++QILYWLKE ++ K LF+
Sbjct: 2305 EKNYGKLTLIEGYMSVTNSNSSNDFFSQGEEKNRHNRSFLPSMQILYWLKEFNSKKDLFI 2364

Query: 2195 RFYGETIDVRFLSNFATIINLTIESVQHFQMIKKETVREMNVEAEK---KVGEDDISTKF 2251
            R +G+ +DV  LSNF  II L  +S Q F+  +K  + + N+E +K    +  ++ +   
Sbjct: 2365 RLHGDALDVDILSNFVNIIELIFKSYQIFEDFRKSKIVQ-NIEKQKHHEHIKSENATEFV 2423

Query: 2252 SLFFSKVQRINCQCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDMKKPH 2311
              F S +  INC+  Y+GG   V+ V    ID+  ++E+  PKV I ++YK+  D  KPH
Sbjct: 2424 PTFLSDINSINCEFKYEGGTLRVFSVDDVEIDSTPSLELNAPKVSIYLNYKHFDDSPKPH 2483

Query: 2312 WIRSFINIEPTYNTLLSQFASFLTEFGESVHEMVAKFSPKEQPPAPKTVSPPIDYKRILE 2371
            W+R  I+I  ++N L S+ A F+ EF ES+ E++     + +    K  +P   YKRIL 
Sbjct: 2484 WLRCVIDIHSSHNILYSKCAPFVIEFVESIQEILENRPVEPKQSVSKIATPNRTYKRILA 2543

Query: 2372 DFDVSFSISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDIKT 2431
             FD++F I A KQ +S SCEP AKV ANVG +SF+F I T      +PLS +L +N I T
Sbjct: 2544 PFDIAFRIKAAKQMLSFSCEPSAKVQANVGLDSFLFGISTGGSSVEDPLSLTLCINKIST 2603

Query: 2432 SINHEFSTEPTASFSVDFVDITTLFTHPDIYGTTLISDVSLYFNIKQLQNLMVFLDIWNL 2491
            S+ H FS E +ASFS++F+D+T +FT P +Y   LISD+ ++FN+KQ QNL++FLDIW+L
Sbjct: 2604 SVQHIFSKEASASFSLNFIDLTFIFTQPTLYCVGLISDIDIFFNMKQQQNLLLFLDIWHL 2663

Query: 2492 KRLIKLRPQKSVPVKKPEXXXXXXXXXXXXXXIIPWSFTVIITDINGDIHXXXXXXXXXX 2551
               I +RP +     K                IIPW+F +I T++N DIH          
Sbjct: 2664 SESIGIRPNRKKRKHKKHKGHTQIPETPQPGKIIPWNFNIIFTNVNADIHLGPALGIVSA 2723

Query: 2552 XXXXXWISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRYVENEKLDQS 2611
                 W  ++ + D+R+ L+ FTD + L S GRL G++D++N  W L V Y +NE    S
Sbjct: 2724 KLEKTWFISDRYLDKRQILQLFTDGMVLKSRGRLSGMLDISNAGWRLEVNYADNELNYNS 2783

Query: 2612 PLVDITLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLHLVCDEIDI 2671
            P+V I +++  VA+K AFDYHMF+I +V+NI F L SE+D  G LPDLL   L+C+EI I
Sbjct: 2784 PIVAIGIDIGCVALKTAFDYHMFMISKVNNIHFRLHSERDPEGKLPDLLLTTLLCEEISI 2843

Query: 2672 CSTALVASNILDISNTISRTRQDSRNSYIETLLESNPPPQKSSISYTDILKSLNLLRTDV 2731
            CST LVASNILDI NTI RTRQD++NSY ETL+ESN    +++I Y+DILKSLNLLRTDV
Sbjct: 2844 CSTTLVASNILDIYNTIIRTRQDTKNSYFETLMESNNQDTRTNIPYSDILKSLNLLRTDV 2903

Query: 2732 GIEIHKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKATLSLSKSN 2791
             I++ K+Q+QISPISLFD EV+V  ++N+SARS T S +KL T L++++  A+++LS + 
Sbjct: 2904 QIDVSKLQLQISPISLFDFEVLVINIDNMSARSETTSTDKLKTRLELQVCNASVALSTAK 2963

Query: 2792 EELDEEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYLFACKFHDK 2851
            EELDEE+V++ISV DYM YA K+ GG IL IPKL VGMTTWQ   S  IEY F CKF  K
Sbjct: 2964 EELDEESVNKISVADYMTYASKIKGGTILIIPKLLVGMTTWQKVTSNTIEYTFTCKFDGK 3023

Query: 2852 ISVRWNLGPVNFIKEVWATHVKSLAVRRAQLKGDKEPQLVPGIIGXXXXXXXXXXXXXXX 2911
            +SVRWNLGPVNFIKE+WATHVKSLAVR+A++   +EP                       
Sbjct: 3024 VSVRWNLGPVNFIKEMWATHVKSLAVRQARI---EEP------------------VEYSS 3062

Query: 2912 XXXXXXXXXXXXXXXXXKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFPRVTHQ 2971
                             KF YV L EP IEMP+IKDLEDATPP+EWFG+NRKKFP  THQ
Sbjct: 3063 EELESSPESIYLEPAQPKFTYVALVEPSIEMPQIKDLEDATPPMEWFGLNRKKFPSFTHQ 3122

Query: 2972 TAIILIQKIVHVAQKEYAKVLGDS 2995
            TA+I++QK+VH  +KEYAK++G S
Sbjct: 3123 TAVIVVQKLVHAVEKEYAKIIGHS 3146

 Score =  179 bits (453), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 84/182 (46%), Positives = 120/182 (65%), Gaps = 5/182 (2%)

Query: 4   DSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKYKVK 63
           + +F S+SL REKYFSWVFL  W+LTCI  L + FY+ RVF    TFIL W +W+ YKVK
Sbjct: 4   EPKFVSVSLSREKYFSWVFLVTWILTCILCLLMFFYIDRVFAYSLTFILDWLLWRPYKVK 63

Query: 64  INIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLSSEQ 123
           I+ ESIR+S L   +  KN+ II ++ T+S LE +I W+YWLLN+R   Y++      ++
Sbjct: 64  IHCESIRLSLLSARISFKNLCIITENSTISILEGKIIWQYWLLNTRVSAYELH---QQQK 120

Query: 124 SQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSSFLN 183
             G     S    KN +LPC  L +C+G E+FVYN+ +AYEN++  F+ +E+ K+  FL+
Sbjct: 121 EHGYITPGSGF--KNIQLPCKFLFQCEGAEIFVYNKTSAYENIIDSFSPDEKIKYKEFLH 178

Query: 184 EH 185
           +H
Sbjct: 179 KH 180

 Score =  137 bits (345), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 73/190 (38%), Positives = 110/190 (57%), Gaps = 9/190 (4%)

Query: 236 FNFLPIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHA-NEKIDLYKSKVTMKFQD 294
            NF P  L+L  G++  GN+FTPSL++ SY++  G++DV  A N ++DLYK K+ + FQ+
Sbjct: 298 LNFYPFGLKLTKGSIIFGNKFTPSLLIISYKSAEGIVDVLPATNPRVDLYKMKMKLDFQN 357

Query: 295 VNISVKPNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYH-KHMKKKEHDV 353
             I VKPN++Y+ +   +       LSR+W  F  + D++PNP ++  H   + K    +
Sbjct: 358 FEIEVKPNISYEDDSKPKAFYCDSMLSRLWTKFSTLFDIMPNPLSRYIHFSRLHKNSLFL 417

Query: 354 ESM------FVNKWRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSY 407
           E        F  KW+GLSLYKD   + G    +   +DFLN EYA++ SI+K P    + 
Sbjct: 418 EDNIFEDEDFEKKWKGLSLYKDAALNRGN-PEEHIEFDFLNHEYARYCSIVKAPRLIFTN 476

Query: 408 YLDSPGIVPH 417
             D PGIVP+
Sbjct: 477 EYDIPGIVPY 486

>SAKL0H17072g Chr8 (1498942..1507935) [8994 bp, 2997 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2997

 Score = 1971 bits (5105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1139/3079 (36%), Positives = 1715/3079 (55%), Gaps = 168/3079 (5%)

Query: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60
            M+  SQF +I + +E  FSWVFL  WVL  + SL+V+FY  R      T ++ W +W++Y
Sbjct: 1    MDAGSQFKAIPISKENNFSWVFLVDWVLVVVLSLSVVFYFGRALAYCITILMKWVLWRRY 60

Query: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120
            KVKINI+S+++SFLGG VF KN+++I +D T+SFL+    WRYWLLNSR+   +      
Sbjct: 61   KVKINIQSLKISFLGGRVFFKNLTVITKDQTISFLQGSFTWRYWLLNSRKTLLEELEKSG 120

Query: 121  SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS 180
             E+ Q           K+  L C   +E  GFE+F+YNR  AY+ +LR   K+++E F  
Sbjct: 121  EEKDQ-----------KSRMLQCRFFLESDGFELFIYNRTVAYDGILRSVAKDDKESFKK 169

Query: 181  FLNEHDLGDIVSEDTNVNSMDK-DYFXXXXXXXXXXXXXINDRTYKKNKDERKSILFNFL 239
            F           ED+  +S +K +                NDR +++   + +S+L  FL
Sbjct: 170  FFEG-------GEDSLHSSEEKLEDETLASDSSVSNVDSTNDRNFQEQ--DSRSMLLQFL 220

Query: 240  PIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNISV 299
            PI L++  GAV LGN  TPS+++  YE+  GV+DV  +NEK+DLYK +  + F +V++ +
Sbjct: 221  PIHLKVNRGAVLLGNTTTPSVMIIGYESAEGVVDVCQSNEKLDLYKIRYDLDFNNVDLKI 280

Query: 300  KPNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDV----ES 355
            KPN+++  E   +  I   ++SR+W  F  I       F ++ H         +      
Sbjct: 281  KPNISFGDENPIKSYIVHSRMSRVWKKFKKIF------FERMSHYLAHSDNQKIMFVKHQ 334

Query: 356  MFVNKWRGLSLYKDNLRDAGRYGLDEASY--------DFLNREYAKFSSILKCPNFTLSY 407
             F  KWRGL+LY +       + + +           D  N EYAK++ ILK     ++Y
Sbjct: 335  QFFEKWRGLALYSEYNVTTSDHSVGDEEEEEDENMMSDVGNHEYAKYTQILKSTKVAVTY 394

Query: 408  YLDSPGIVPHGAHQTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRM 467
              D PG+VPHGA  T  ++DGPD+GNSG+PPEF +D ++  A+I YGPW +RQ+ YL RM
Sbjct: 395  AYDIPGMVPHGALHTMEQRDGPDVGNSGAPPEFSLDFKLYGATICYGPWAHRQIQYLQRM 454

Query: 468  LSPVVSKNQIPIKKLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTND 527
            L P+VS++ IP+KKL PGSRRI+T F +SV +++++ WRIPTRE SKD++F+KQ+ ++ +
Sbjct: 455  LCPIVSRDAIPLKKLTPGSRRIYTRFNLSVLMMEDALWRIPTRESSKDQDFLKQYRESKN 514

Query: 528  DFRPFGWLDFNLNKGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFD 587
              RPFGWLD  L K T       + PTI G  N    H +  E+ +SVNHDI  K+    
Sbjct: 515  KERPFGWLDIKLTKETDLFMTVGMCPTITGFENKLGFHLVKPEIRSSVNHDIFFKADAQT 574

Query: 588  VVADIGYPLGWNSQADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFT 647
            + AD+GYPLGWNS+A W F   +KQ+ TF L++HI+L SD+F DF S  PTPYELFRPF 
Sbjct: 575  ISADLGYPLGWNSEAQWVFQFNSKQVHTFFLRDHINLLSDIFMDFGSGIPTPYELFRPFV 634

Query: 648  YSLNWDIEGYSIYLNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIA 707
            Y   W I+ YSIYLNVND NI+NNPLDFNENCYLSLHGD L ID  +    I+   T + 
Sbjct: 635  YRFEWSIDNYSIYLNVNDANIINNPLDFNENCYLSLHGDTLKIDFSVDLKTITGNSTTVN 694

Query: 708  FNIYTPMFRLLLNTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECT 767
            ++I TP F L L+TP W+TL EFMK+KEVGR++DF + GSY  +SD+D+ N+DTI +EC 
Sbjct: 695  YSIRTPEFHLQLDTPSWSTLHEFMKNKEVGRSYDFCMNGSYQFHSDVDVGNMDTILIECQ 754

Query: 768  SRSTTLFCYGVVIRYLMNVQANYFGDFVHFITSEEYS-EILQKNNKRSNDEQGSFXXXXX 826
            S+ TTL C G VIRYLMN+  NYFGDF+HF T+EEY+ E+ +K   R  +          
Sbjct: 755  SKYTTLQCCGFVIRYLMNINMNYFGDFIHFKTTEEYTRELQEKLETREAEVIADNVSDES 814

Query: 827  XXXXXXXXXXXXLYTKEQDLSK----PHVRRADVLRTENELDIWFTFRVWDGALILPEGL 882
                          T E DL +    P V+RAD+ R ENE D+WFTF V DG L+ PE +
Sbjct: 815  SQMSSTSFVTNDKETTEYDLHEFNEDPKVKRADLKRKENEKDVWFTFCVEDGCLVFPENI 874

Query: 883  YNGNLCSSLLFSELMISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNI 942
            Y+   C  L F  L +  R  NYYMD   +L    I R  +F+P  IF  VR  +  ++ 
Sbjct: 875  YDCTSCIGLHFDSLDVDLRYLNYYMDLQASLSPTYIKRHSDFNPRNIFDVVRACEGLVDG 934

Query: 943  VHGTLSDVTIHAHRMFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYS 1002
              G LS++ IHAHRMFGLP  + TYFC+W    GSL IDS+I+F     G F+K+GFGY 
Sbjct: 935  HQGFLSELNIHAHRMFGLPIIEETYFCKWDFQIGSLDIDSDIDFAKGLIGAFSKIGFGYK 994

Query: 1003 NLENKLVYKVESSDDMTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSK 1062
            + EN L+Y++    DMT LTL  + +   V+D  +    +L++ K+  + IDF+NERYS 
Sbjct: 995  DYENMLIYEIIKPIDMTSLTLVTDSISFKVTDGNTNCVVALDLDKISASMIDFENERYSN 1054

Query: 1063 RINLKIPEFSISIFDVRNPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSP 1122
            +++ KIP  +I +      +   +   F+T +D   F    DF N  N QR +ITLHDSP
Sbjct: 1055 KMSAKIP--NIKLLVSEKSSKNEVQGLFETSLDLAYFGQNRDFDNHRNLQRNHITLHDSP 1112

Query: 1123 YHRCFFILPTMYQESFLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFL-KEYSD--L 1179
            YHRC F+LP  YQ++ LYN+L+G ITP  SIP L  P++PNTID + E  L K Y D   
Sbjct: 1113 YHRCAFLLPMQYQKTVLYNKLFGAITPGVSIPPLTQPVIPNTIDSIFESLLGKHYQDYEC 1172

Query: 1180 LENPFLNIRSINNLDTSSLFNEYRVDTYISEKAIFKAEEKNTVNY--DPKYEYDNYILNV 1237
              +   +  +    + SS        + + E + +    +N  +Y  +PK+EYD++I+N+
Sbjct: 1173 CSDANYSKETAITEENSSFIQGSGSTSALKELSSY---SQNCPSYKLEPKFEYDSFIINL 1229

Query: 1238 EYIRVDINP-----LFS-------------------DFIDSMSTKLYSENXXXXXXXXXX 1273
                + INP     L S                   D ++  S     ++          
Sbjct: 1230 GKTIIAINPSSEKCLLSIYLQFCVGSIDDIIDANEIDIVEKFSKYFVEKSAVTNLRVLAP 1289

Query: 1274 XXXXXLGSPKKVLLRETNLKLKISYVDIFWGSRNSEGIEIYLDKLDFEMRQRIFDDFNQR 1333
                  GSPK         K ++S  D  +       +E+    LD   +++IF   N  
Sbjct: 1290 KICFTFGSPKG--------KFEVSDYDHLY-------VEVNHPSLDL-CQKKIFGQTNSS 1333

Query: 1334 SLE-ERTILSKLKSLRCSFSETQYE---EIEYERPPALSLTVEGLEVWSCTNTAQSNSIN 1389
             LE    + S LK+   +F   Q +   +   +  P  S+  E LE WS ++ +  NS+N
Sbjct: 1334 KLEYTEEVTSSLKASSINFFINQQQLKPKTLLKARPVFSIVFEELEFWSDSSESSKNSLN 1393

Query: 1390 ILSTDITVDGSQTSWLIKYLNKQV----EFFYNLKGSVDLLQKRDVTLQKSLISKLTTAS 1445
              + D  V+ SQ  WL  YL   +    + F +   S  L+Q R    QK LI +   AS
Sbjct: 1394 ARAVDFFVNHSQLEWLSDYLRAVILCATKLFASFSKSKTLIQAR----QKELIFRTALAS 1449

Query: 1446 EYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLRHILNYLPEGWEKSSIAFVEAR 1505
              Y I HD  VITKPA I RLS +H+RENRSWRI+TRLRHILNYLP+ W K +   ++  
Sbjct: 1450 VEYNIIHDSPVITKPAYITRLSKNHIRENRSWRIITRLRHILNYLPKSWYKRTEESLKKE 1509

Query: 1506 HVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFLP-DIEKNLINNTT-KIGMESFY 1563
                  D ++ FL +FSNWR+WE SDV + YIY+RVFL   ++KN I     K+ +E   
Sbjct: 1510 EFKIPDDARDQFLKIFSNWRSWEFSDVQKCYIYKRVFLSRSMKKNRITGADFKVNLERIS 1569

Query: 1564 FTIYSQRYAVDHNIVVTRINVIIDQMLSDEEPKAATANKNDKIYD----ITGTVGTFKGE 1619
            F++ S  +  +  +VV  +  +I   L +     +  N  D        I+  + + +G+
Sbjct: 1570 FSLSSSTHEDEDFMVVKNLKSVISNELIESSLPPSAKNTEDSASTEKMIISCNIKSIRGD 1629

Query: 1620 LGDQLIRLKKLY------SEDKAKIRSEKSTDFSIPKFFKINIVLIVEKGELTLAAANTK 1673
            LGD +++L ++Y      S+   K  S K      PK   I  VL+V++ +  +     +
Sbjct: 1630 LGDNIVKLVRMYDGLSNLSDTNLKTTSVKHD--VKPKL--IQGVLLVDRTDTNIHLDGKR 1685

Query: 1674 LISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNELILLDAHLDDLFISVIAE 1733
            LI R    + S F E     +    S+      +E W++H   +LL++ L D  ++    
Sbjct: 1686 LILRSFRNRFSTFMERVPSKSETKVSLAATCASSEAWVRHGSAVLLESSLKDGALNFSQS 1745

Query: 1734 LLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRLTDKDNKKRHT---S 1790
            L  +     V ++S  L   A+ +T+  + F+   +  +  I   L     KK +T   +
Sbjct: 1746 LFHEHLITKVVLRSGGLSVSAMASTEQYIHFIWSIKASVDGIRKELASAIPKKNNTTIST 1805

Query: 1791 TSPIFSTKKXXXXXXXXXXXXXXXXVILSPFTVKHSMKELKIVFNREGDNDTIFSILDAD 1850
            T P  S++                   L+PF +  S   +++   +    +   +I D D
Sbjct: 1806 TKPETSSRLNTVTLDATLSGFSLNIQPLTPFGIHQSTDSIEVHVEKHHQLNADITIRDID 1865

Query: 1851 LYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKL-ITINIVTSLIKLTLADPKKITNSLLQ 1909
            + L S ++  +Y + S   +NL    T  ++ + + + + + + KLT++DP++   SL++
Sbjct: 1866 IELLSTRSKQRYLKFSQSTVNLVISNTPEQNAMFLNVGVASGISKLTVSDPREFIYSLVE 1925

Query: 1910 DEKTFEQSLESIKTLNTLF-SSNREVRTSAVDNPYKFMVNFDLTYFGLLFPVDTSYFILE 1968
            DE    ++   +K+L   F S N+E           ++++ ++ Y G++  + ++ ++LE
Sbjct: 1926 DETLAIKNFAQLKSLAEKFPSKNQEKSKQRKQTNIIWLLHVNVEYIGIIVLLGSAGYVLE 1985

Query: 1969 LHSLLATFSNVYMNPQQLKE---KITCNLALQNTLFMIKSPEVNNQVSKVLDFSVNLSTE 2025
            L+++L + SN     + L++    I  + +++N L +I +  +  ++SK++D +VNL   
Sbjct: 1986 LNNVLTSLSNNISARKYLEQGLHGIVGDFSIENVLLLIHANRLKGELSKLVDLAVNLKVS 2045

Query: 2026 TKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQIFKTKKKASV 2085
             +  +  ++ ++ESSHFRV L P SL K+L  + + +   + YK  TR  + + KK A  
Sbjct: 2046 QEEGDDLQNIQIESSHFRVALCPMSLTKVLWAINEFTRVSEAYK--TRSSLLQHKKTAPT 2103

Query: 2086 VSENLIGAPLIEYSIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAYEDSYGKLTVVD 2145
                L        SI  LSYNFCIGWIF+    + PGLI GY+RLF+AY+  YGKLT++D
Sbjct: 2104 DISELSNK---FRSIQILSYNFCIGWIFDAGSETDPGLIWGYERLFAAYQKPYGKLTLLD 2160

Query: 2146 GFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYGETIDVRF 2205
             +FSIA+G SSDTF+S G EK+++NRSYLP++QI YW  +      LFVR  GE +DV F
Sbjct: 2161 AYFSIAHGASSDTFFSNGKEKDQFNRSYLPSMQIGYWFVKEGDTSNLFVRITGERLDVNF 2220

Query: 2206 LSNFATIINLTIESVQHFQMIKKETVR--EMNVEAEKKVGEDDISTKFSLFFSKVQRINC 2263
            LS+   I N  ++S+Q FQ +KK  V     N   EK V  +  +       SK++  NC
Sbjct: 2221 LSSSIGIANGAVKSIQTFQELKKTMVDPFATNKTTEKPVNSE--AAPLDPILSKIRAFNC 2278

Query: 2264 QCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDMKKPHWIRSFINIEPTY 2323
               Y GGVF ++       +++ + E+ +P V + +DYK+  D+ K HWIR  + ++P+ 
Sbjct: 2279 IVKYAGGVFKLFSEEDIQNNSKPSFEVESPSVEVAIDYKHLPDVIKSHWIRGLVTVDPSN 2338

Query: 2324 NTLLSQFASFLTEFGESVHEMVAKFSPKEQPPAPKTVSPP-IDYKRILEDFDVSFSISAG 2382
            NTL       L+   + V  M+  F+ K +P    T+S   ++YK++L  FD++F ++ G
Sbjct: 2339 NTLFPTCVPILSGMTKDVRNMLKSFNSKPKPDRNSTISSSGMNYKKLLRAFDIAFLVNIG 2398

Query: 2383 KQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDIKTSINHEFSTEPT 2442
            KQ +SLSCEP AKV A+VGFE     + TN+ D +EPLS S+ +  ++ +  H FS E +
Sbjct: 2399 KQGISLSCEPKAKVQADVGFEKLAVKMFTNNLDNSEPLSLSIDIEHLRATSRHIFSREVS 2458

Query: 2443 ASFSVDFVDITTLFTHPDI---YGTTLISDVSLYFNIKQLQNLMVFLDIWNLKRLIKLRP 2499
             SF +D +D   + THP+I   YGTTL+SDV +YFN+KQLQ+L +FLDIW     I   P
Sbjct: 2459 TSFQIDHIDAVFVLTHPEIIQTYGTTLVSDVQIYFNMKQLQDLNLFLDIWKPDSQILEMP 2518

Query: 2500 Q----KSVPVKKPEXXXXXXXXXXXXXXIIPWSFTVIITDINGDIHXXXXXXXXXXXXXX 2555
            +    ++  +   +                PW++T+I ++I GDI               
Sbjct: 2519 KGGNTRTRSLSSHDKLPVSKFQKPAGTNAFPWNYTLIFSNIKGDIDLGPSLGVLSVRNNR 2578

Query: 2556 XWISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRYVENEKLDQSPLVD 2615
             W  ++HF D R+ L  F +++ L+S GRLGG + +  + W   + +       ++PL+ 
Sbjct: 2579 SWAISDHFVDWRQRLSVFLENILLSSDGRLGGFLGIERVCWSSEISWPVKGGFYETPLIS 2638

Query: 2616 ITLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLHLVCDEIDICSTA 2675
            ++L + ++A+K +FDYHMFLI  V ++L  L +E+D +G L DLL + + C +I +  TA
Sbjct: 2639 LSLELGSLALKTSFDYHMFLIANVEHLLLKLYNERDEMGILKDLLAVSVTCGKIHLFLTA 2698

Query: 2676 LVASNILDISNTISRTRQDSRNSYIETLLESNPPPQKSSISYTDILKSLNLLRTDVGIEI 2735
            L ++N +DI NTI R RQD++NSYIETL +SN    KS     ++L+SL+LLRTD+ + I
Sbjct: 2699 LASANAIDIYNTIIRMRQDNKNSYIETLKDSNTQSTKSKRQNQNVLESLSLLRTDLSVGI 2758

Query: 2736 HKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKATLSLSKSNEELD 2795
                +Q+ P +LFD+EV+V   E++SA + TQ   K+ T L  +++   +SLS    + +
Sbjct: 2759 DLFYLQVFPSTLFDMEVLVLKAEDMSAHTQTQGDHKVKTRLNWQLHNFKVSLSAFKNQFN 2818

Query: 2796 EEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYLFACKFHDKISVR 2855
            EE VS+I V +Y+ +A K+ GG IL+ P + V MTTWQ  +S +IE L+   F  K+ V+
Sbjct: 2819 EEIVSQIEVKEYIKHATKVRGGTILAAPAILVDMTTWQEVSSNVIELLYTSSFGGKVDVK 2878

Query: 2856 WNLGPVNFIKEVWATHVKSLAVRRAQLKGDKEPQLVPGIIGXXXXXXXXXXXXXXXXXXX 2915
            WNLGP+NFI+E+WATHV++LA+RR     DK                             
Sbjct: 2879 WNLGPINFIREMWATHVRALALRRVHDMRDKNKSFFED---------------------E 2917

Query: 2916 XXXXXXXXXXXXXKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFPRVTHQTAII 2975
                         K++Y+PL+EP+IEMP+IKDL DATPP+EWFGVNR++FP +THQ+ ++
Sbjct: 2918 HIEEKIKDVDLGNKYVYIPLEEPRIEMPQIKDLGDATPPVEWFGVNRQRFPGLTHQSVVV 2977

Query: 2976 LIQKIVHVAQKEYAKVLGD 2994
             +QK+ H+A++EYA+VLG+
Sbjct: 2978 PLQKLAHMAEEEYARVLGN 2996

>KLTH0G13728g Chr7 (1175228..1184128) [8901 bp, 2966 aa] {ON} similar
            to uniprot|Q12150 Saccharomyces cerevisiae YLR087C CSF1
            Protein required for fermentation at low temperature
          Length = 2966

 Score = 1719 bits (4451), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1035/3075 (33%), Positives = 1653/3075 (53%), Gaps = 199/3075 (6%)

Query: 5    SQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKYKVKI 64
            SQF  +SL   + FSWVFL  WVL    SL   FY  RVFG   TF+L W  WK+YKVKI
Sbjct: 3    SQFKRVSLSTNEDFSWVFLVDWVLILSVSLLGAFYFGRVFGYTLTFLLEWLAWKRYKVKI 62

Query: 65   NIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLSSEQS 124
            +I+S+++SFLGG +F KN++++ Q+ T SFL+  I WRYWLLNSR+  +           
Sbjct: 63   SIQSLKISFLGGRIFFKNLTVVTQNQTFSFLQGSITWRYWLLNSRKTAF----------- 111

Query: 125  QGSDASNSMTIEKN-SKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSSFLN 183
                A  S  I+K+  KLPC   +EC+G E F+YN+  A++N+L    +E+ E+F  F  
Sbjct: 112  ----AKASENIDKSVEKLPCRFRVECQGLEHFIYNKTQAFDNILNSLPREDLERFKDFFQ 167

Query: 184  EHDLGDIVSEDTNVNSMDKD------YFXXXXXXXXXXXXXINDRTYKKNKDERKSILFN 237
            ++       ++T+  S+D+D      +              +NDR+++    +       
Sbjct: 168  DNS-----DKNTDECSVDEDSAGQRSHLETSTSSPSSKSKSLNDRSFQS--PDSTPPFLK 220

Query: 238  FLPIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNI 297
             LP++  +  GAV +GN+ + S++V SYE  +GVLD    + KIDLYK KV  +F+  +I
Sbjct: 221  LLPLEYSVQKGAVVIGNKTSSSVMVLSYEKLDGVLDTCLPDSKIDLYKIKVRNEFRKFHI 280

Query: 298  SVKPNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESMF 357
            S+KPNL+ +SE   +  + + KLS++W+    +     +P +K      K    +     
Sbjct: 281  SLKPNLSLESENPLKSFVKRSKLSKLWHRSYQLFFKTDSPSSKNPANSAKDGTRNP---- 336

Query: 358  VNKWRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVPH 417
            + +WRGL LY    ++      D   +D    EYA+++ ++KC N  L Y  D+PGIVPH
Sbjct: 337  LKRWRGLGLY---WKEEDAAWDDRFQFDLSKHEYARYTKVMKCDNMLLEYAFDAPGIVPH 393

Query: 418  GAHQTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQI 477
            GA  T    DGPD+GNSG PP++ +D+Q+S AS+YYGPW++ ++  L ++ SPVVS++  
Sbjct: 394  GALPTFQTVDGPDVGNSGPPPDYSIDIQISGASLYYGPWSHHEIMPLQKLFSPVVSRDSQ 453

Query: 478  PIKKLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDF 537
            P+++L PGS+RI+T  ++S+ I+ ES WRIPTRE SKD EF+K+F +T D+ RPFGWL+ 
Sbjct: 454  PVEQLTPGSKRIYTRLRLSILIVGESVWRIPTREASKDLEFLKRFRETEDETRPFGWLEV 513

Query: 538  NLNKGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLG 597
            +L++G++  FN ++ PT  G  N  D+HF+  E+ TSVNHDILL ++   + A +GYPLG
Sbjct: 514  SLSEGSEVRFNIAMCPTATGFDNTLDLHFVKPEIRTSVNHDILLSAQTHSMHATMGYPLG 573

Query: 598  WNSQADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGY 657
            WN +A+W FD ++ Q + F+LK+HI+L  D+ SDF S +PTPYELFRPF+Y+ NW+  GY
Sbjct: 574  WNKKAEWVFDSVSNQCQIFILKDHITLLGDIISDFGSGEPTPYELFRPFSYTFNWNFTGY 633

Query: 658  SIYLNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRL 717
            SIYLNVND NIVNNP++FNENCYLS HGD+L ++  +P   I+   T+I + ++TP+FRL
Sbjct: 634  SIYLNVNDANIVNNPVNFNENCYLSFHGDDLRLNFEVPQENIAGNSTKINYELFTPLFRL 693

Query: 718  LLNTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYG 777
             +NTP WNTL EFMKDKEVGR+ +F + GSYL +S LD+DN+DTI +EC S+STTL CYG
Sbjct: 694  NMNTPSWNTLHEFMKDKEVGRSANFSLSGSYLFHSKLDVDNIDTIIIECCSKSTTLKCYG 753

Query: 778  VVIRYLMNVQANYFGDFVHFITSEEYSEILQKNN---KRSNDEQGSFXXXXXXXXXXXXX 834
             V+RY + V+ NYFGDFVHF T+EEY E L+  N   K ++D +                
Sbjct: 754  YVLRYFLGVKMNYFGDFVHFKTTEEYMEELRGTNAVTKTTHDSETEIQEAPKQMDEDSSQ 813

Query: 835  XXXXLYTKEQDLSKP-HVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLF 893
                   +EQ +  P   ++  + R  NE D+WFTF V DG  ILPE LY+ + C +L F
Sbjct: 814  -------REQHIKDPLTAKKTSLKRMVNEKDVWFTFVVEDGCFILPENLYDCDSCYALEF 866

Query: 894  SELMISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDVTIH 953
              L I  R  NYYMD    L  ++I R ++   +E+F   +       +V G LS + IH
Sbjct: 867  DSLDIDLRHINYYMDMQAALSPLRIRRLIDCGCEEVFEQ-KGRALCGELVAGRLSRLHIH 925

Query: 954  AHRMFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVE 1013
             HRMFGLPP + TYFC+W    G+L + S++ F   F   + KLGFG+ + EN + YKV 
Sbjct: 926  THRMFGLPPAEETYFCKWDFSLGTLDLSSDLPFTLGFINAWKKLGFGFRDYENIMNYKVA 985

Query: 1014 SSDDMTLLTLYGEKVLILVSDDVSQKQA-SLEILKLKLNSIDFQNERYSKRINLKIPEFS 1072
               DMT +TL  + + +  +D +  + A  L    +     D +N  YS R++L +   +
Sbjct: 986  PILDMTSVTLAIDAI-VFCTDKIKDETAIQLNAQDISAKFADLENSLYSSRVDLDVANLT 1044

Query: 1073 ISIFDVRNPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPT 1132
             SI D +N + K I   F T I  +NF   +D       Q+ +I  +D+P+HRC F++P 
Sbjct: 1045 ASIID-KNKSNKAI-ASFMTSIKISNFCQLQDLLAHSQQQKVHIASNDAPFHRCPFLIPL 1102

Query: 1133 MYQESFLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKE--YSDLLENPFLNIRSI 1190
              Q S  Y  L+G I P  SIP L +P+    +  + + +LK    S    + +  +  +
Sbjct: 1103 TLQNSSDYKGLFGCIPPGVSIPSLAVPLQTENVKAVFQGYLKAENASKDFVDRWFPVNEV 1162

Query: 1191 NNLDTSSLFN-----EYRVDTYISEKAIFKAEEKNTVNYDPKYEYDNYILNVEYIRVDIN 1245
             N ++SSL +     +  +D   S  + F          DP +E++  ++N+E  R+ I+
Sbjct: 1163 KNKNSSSLKDFKGQLQPILDDNTSLSSSFS---------DPTFEHNTLVVNLENSRLSIS 1213

Query: 1246 PLFSDFIDSMSTKLYS---ENXXXXXXXXXXXXXXXLGSPKKVLLRETNLKLKISYVDIF 1302
            P   + I +   + +    E                + S +K      N+++ +  +D+ 
Sbjct: 1214 PECYEVIGNAVEQCHKKLIEQFIDNIELDVVLHFIKMASRQK---NYKNIRVLMPTLDVL 1270

Query: 1303 WGSRNSEG-------IEIYLDK--LDFEMRQRIFDDFNQRSLEERTILSKLKSLRCSF-- 1351
            + + N E        +++  ++  LD+ +++ +    +    E+ T L K++SL      
Sbjct: 1271 FETYNKENTYDVEGQVKVTANQVSLDWSLKKGLKLPGSDNDPEDTTSLLKIESLDLEVFN 1330

Query: 1352 ---SETQYEEIEYERPPALSLTVEGLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKY 1408
                +T++ E+  +   A   +V+ LE WS  N    +S+ + S + +V   + +WLI +
Sbjct: 1331 KLDKKTKFAEM--DENIAFGCSVKELEAWSYLNGIADSSLYLKSINASVALDKFNWLIDF 1388

Query: 1409 LNKQVEFFYNLKGSVDLLQKRDVTLQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSN 1468
            + K       L   +     +    ++    +++ AS+ YQI HDP VITKPA I RL +
Sbjct: 1389 MRKAFNDSKQLINRLSYCTGQFRKAEQEFFYRISKASDEYQITHDPPVITKPAYITRLPS 1448

Query: 1469 SHVRENRSWRIVTRLRHILNYLPEGWEKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWE 1528
             HVRE+RSW+IVTRLRHILNYLP          ++       S  +  FL +FSNW NW+
Sbjct: 1449 QHVRESRSWKIVTRLRHILNYLPTTLISDIFNDLKNSEYPPRSTAEETFLEIFSNWGNWD 1508

Query: 1529 VSDVARSYIYRRVFLPDIEKNLIN-NTTKIGMESFYFTIYSQRYAVDHNIVVTRINVIID 1587
             SDV + Y+YRRVF   ++  + + ++TKI   +F    +        ++++  +     
Sbjct: 1509 YSDVEKCYMYRRVFTNTLDDTVAHESSTKIETGTFMLNFFDSINTGSDSVILKNLKAQRT 1568

Query: 1588 -QMLSDE--EPKAATANKNDKIYD-ITGTVGTFKGELGD----QLIRLKKLY---SEDKA 1636
             +   DE  E ++  +N  D + + ++  +   +  L D    +L+ +++L+   +E  A
Sbjct: 1569 LEACKDEAAEKRSNMSNAEDDLEERLSCIINKAQISLSDGTLIKLLSVRELFTFEAEHAA 1628

Query: 1637 KIRSEKSTDFSIPKFFKINIVLIVEKGELTLAAANTKLISRIKNGKISGFFENARDVANA 1696
               +EK     +P F +     +V++ ++ L     +   +     ++   EN  + A+A
Sbjct: 1629 VKENEK-----LPAFQQ--YTALVDRCDIQLLCGANRANLKSFGNTLTIVRENKSEDADA 1681

Query: 1697 SGSIVYYATRTELWLKHNELILLDAHLDDLFISVIAELLVKKPTILVNVKSSHLRFKALP 1756
              S  +  +  E  ++H   ILLDA      +        K     +++++   R K   
Sbjct: 1682 F-STAFAWSWFEFGIRHRNTILLDAFSRSSAVGAHG-FSGKNSRRKLDLRAKKFRLKLPS 1739

Query: 1757 NTKNLVVFLREFEREISKI-------TGRLTDKDNKKRHTSTSPIFSTKKXXXXXXXXXX 1809
             +K+   F+   E   + +       TG L +K +       +P F+             
Sbjct: 1740 ESKHYCTFIDSLEESWNNLRLALGPNTGFL-EKPHSAATEKVAPQFALN-------IDIS 1791

Query: 1810 XXXXXXVILSPFTVKHSMKELKIVFNREGDN--DTIFSILDADLYLTSYQNGVQYFRLSY 1867
                   +LS   +  + K+L + + +   +     F  LD D++  S +   QY ++S 
Sbjct: 1792 DLTTDISLLSSLAITKNFKKLTLAYEQSASSALKLAFETLDIDVF--STRTTQQYLKISQ 1849

Query: 1868 QDINLEAML-TDSKSKLITINIVTSLIKLTLADPKKITNSLLQDEKTFEQSLESIKT-LN 1925
             +I+        + +   T+ + +++ KL L DP+ IT  L +D    +  L S+K+   
Sbjct: 1850 SNISFSLHRPKKNNASPPTVKLDSNITKLKLYDPRDITLPLGKDIAQAKACLASLKSCFG 1909

Query: 1926 TLFSSNREVRTSAVDNPYKFMVNF----DLTYFGLLFPVDTSYFILELHSLLA-----TF 1976
             L + N +   S  +  + F  ++     L Y GLL P+ ++ +I EL+ + A      F
Sbjct: 1910 KLNTKNDKDIMSQGNTKFNFSASWIFQVRLNYVGLLIPLGSTSYITELNEISAFITADEF 1969

Query: 1977 SNVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSKVLDFSVNLSTETKILNSKRSFE 2036
            +N      Q    +  +L+  +  F+I    +   +S+V+DF+V++    +     RS +
Sbjct: 1970 TNKASENSQ--GALRGDLSAASIAFLINDRMLPEALSRVVDFAVSIKIAKESEEVIRSLQ 2027

Query: 2037 VESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHTRLQIFKTKKKASVVSENLIGAPLI 2096
            +ES +FR+ L+P SL++IL  V           E +RL   + ++    + E++      
Sbjct: 2028 IESPYFRIALSPFSLVRILFLV----------NELSRLSELQKRQTVGKLPESVEVRETF 2077

Query: 2097 EY-----SIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAYEDSYGKLTVVDGFFSIA 2151
             +     S+  LSYNFC+GWIF+ + S  PGLI GY RLF+A+E  YGKLT++D +FSIA
Sbjct: 2078 RFRRAFRSVQVLSYNFCLGWIFDVNDSPEPGLIWGYQRLFAAHEKPYGKLTLLDAYFSIA 2137

Query: 2152 NGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYGETIDVRFLSNFAT 2211
             G +SD FY+  N  E  NRS+LP++QI YW++      +LF+R  GE +DVRFLS    
Sbjct: 2138 EGSTSDDFYAHKNSFENPNRSFLPSMQIRYWIESKGLTDELFIRINGERLDVRFLSKSID 2197

Query: 2212 IINLTIESVQHFQMIKKETVREMNVEAEKKVGEDDISTKFSLF--FSKVQRINCQCIYDG 2269
            +    ++S+  F  +KK+ V      A  K      ++ FS F   S +QR++C+  Y G
Sbjct: 2198 VAGGLMKSLNMFDELKKQYVDPFKSVANPK--RPSATSTFSKFPGLSTIQRVDCKVQYAG 2255

Query: 2270 GVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDMKKPHWIRSFINIEPTYNTLLSQ 2329
            GVF +Y +     +   + ++ +P V I  DY+  +  K  H +R+++ +  ++NT+   
Sbjct: 2256 GVFRLYSLDDVQNEAGPSFQLESPSVEILFDYRRMVHGKHSHILRAWMIVYSSHNTIFPT 2315

Query: 2330 FASFLTEFGESVHEMVAKFSPKEQPPAPKTVS-PPIDYKRILEDFDVSFSISAGKQKVSL 2388
                L E    + +++  F+   Q  + K+VS   +DY+  L   D+SF I  GKQ++S 
Sbjct: 2316 CVPVLNEMARDIRQLLKGFNRSPQEASHKSVSQESLDYRSFLRGTDISFLIDIGKQQISF 2375

Query: 2389 SCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDIKTSINHEFSTEPTASFSVD 2448
            SCEP AKV A++GFE     + TND D +EPLS S+ + +I     H FS E + S  +D
Sbjct: 2376 SCEPKAKVQADLGFEKLAVKVFTNDLDMSEPLSLSIDIYEITAKSRHIFSREVSTSIKID 2435

Query: 2449 FVDITTLFTHPD---IYGTTLISDVSLYFNIKQLQNLMVFLDIWNLKRLIKLRP----QK 2501
             +    + THPD    YG   I ++ +YFNIKQLQ+L +F++IW     +  +P    + 
Sbjct: 2436 QLSWIFILTHPDTIHTYGIMHIPNIDVYFNIKQLQDLNIFVNIWKPDSYVFTQPELDSEH 2495

Query: 2502 SVPVKKPEXXXXXXXXXXXXXXIIPWSFTVIITDINGDIHXXXXXXXXXXXXXXXWISTN 2561
            S  +   E                PW+F +II+ I GDI                W  T+
Sbjct: 2496 SRALTSEEKPLVAKFKKVSSTTSFPWNFILIISKIKGDIDLGISLGVLSLTTDRIWAITD 2555

Query: 2562 HFQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRYVENEKLDQSPLVDITLNVE 2621
            H+ D  + L    + + L+S GRLGG + + N SW+  +R+   E + +SPLV + + ++
Sbjct: 2556 HYSDWTQKLSLQMEKILLSSDGRLGGTLLLRNFSWMSRIRWPVREGVFESPLVTLDVLLD 2615

Query: 2622 NVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLHLVCDEIDICSTALVASNI 2681
               +K +FDYH+ LI  V  +   L +++D  G   +LL + +  +   +  TAL  +NI
Sbjct: 2616 EFDLKLSFDYHLILIASVEVLKLKLFNKRDPRGISRNLLSVAISSNSTQLFLTALAPANI 2675

Query: 2682 LDISNTISRTRQDSRNSYIETLLESNPPPQKSSISYTDILKSLNLLRTDVGIEIHKMQVQ 2741
            LD+ NTI R R+D+R SY ETL +SN    +S+ +  DIL SL+ LRT++ + +  + +Q
Sbjct: 2676 LDVYNTILRMRKDNRKSYFETLGDSNTKDTRSASTSKDILNSLSFLRTELEVSLKFVHIQ 2735

Query: 2742 ISPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKATLSLSKSNEELDEEAVSE 2801
            I P  LFD+EV+    ++   +S  +  EKL T L+ +I+   ++LS+   +L E+A S+
Sbjct: 2736 IYPSKLFDMEVLTFKAKDFLTQSQIEGDEKLKTHLKWQIHGVKIALSRFKNQLHEKAASQ 2795

Query: 2802 ISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYLFACKFHDKISVRWNLGPV 2861
            I V +Y+ +A K  GG IL IP + +GMTTW    +  +E L++  F  KI +RWNLG +
Sbjct: 2796 IGVKEYIEHARKADGGTILVIPAILIGMTTWHDVATNTVELLYSNSFGGKIGIRWNLGSI 2855

Query: 2862 NFIKEVWATHVKSLAVRRA---QLKGDKEPQLVPGIIGXXXXXXXXXXXXXXXXXXXXXX 2918
            NF++E+WATHV+++A+RR+   Q +G  E + +                           
Sbjct: 2856 NFLREMWATHVRAMALRRSHNGQPRGFFEDEHL--------------------------E 2889

Query: 2919 XXXXXXXXXXKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFPRVTHQTAIILIQ 2978
                      ++ YVPL+EP IE+P+ KDL +ATPP+EWFGVNRK+FP +THQ  I+ +Q
Sbjct: 2890 EKLRDVDLGDEYEYVPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQAMIVPLQ 2949

Query: 2979 KIVHVAQKEYAKVLG 2993
            K+ H+A+ E+A++LG
Sbjct: 2950 KLAHIAETEWARILG 2964

>Kwal_YGOB_56.23808 s56 (712095..712280,712384..721023) [8826 bp, 2941
            aa] {ON} ANNOTATED BY YGOB -
          Length = 2941

 Score = 1632 bits (4227), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1018/3068 (33%), Positives = 1602/3068 (52%), Gaps = 206/3068 (6%)

Query: 3    VDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKYKV 62
            + S+F  + +   + FSWVFL  WVL    SL   FY  RV G   T IL +  WK+Y V
Sbjct: 1    MSSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGV 60

Query: 63   KINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLSSE 122
            K+           G VF KN+++I QD T S L   I WRYWLL+SR+   + Q+     
Sbjct: 61   KV-----------GRVFFKNLTVITQDQTYSILHGSITWRYWLLSSRKTSLESQS----- 104

Query: 123  QSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSSFL 182
                         EK +KLPC   IEC+G E F+YNR  A++N+L    +E++E    F 
Sbjct: 105  -------------EKAAKLPCRFRIECQGLEHFIYNRTQAFDNILSSLPREDQENVKKFF 151

Query: 183  NEHDLGDIVSEDT---NVNSMDKDYFXXXXXXXXXXXXXINDRTYKKNKDERKSILFNFL 239
            +  D     +E+T   N ++  K +              +NDRTY+   +   S L   L
Sbjct: 152  S--DPSPRATEETSTENDSAAQKSHLETSMSSPSASTESLNDRTYQL-PNSMPSFL-RLL 207

Query: 240  PIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNISV 299
            P++  +  GA+ +GN+ T S++V+S+E   G LD    + KIDLYK K+        +S+
Sbjct: 208  PLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPDTKIDLYKIKLQSDITKFQMSL 267

Query: 300  KPNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESMF-- 357
            +PNL YD++   +      +L ++ + + +    +     K Y     K E   + +   
Sbjct: 268  RPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRV----RKRYLSRGSKTESTRKDLRNP 323

Query: 358  VNKWRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVPH 417
            + +WRGL LY    ++      D   ++    EYA++S ++KC +  + Y  D+PG+VPH
Sbjct: 324  LERWRGLGLY---WKENDPAWDDVFHFELPKHEYARYSKVMKCEHMLIEYSHDTPGVVPH 380

Query: 418  GAHQTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQI 477
            GA  T    DGPD+GN G+PP+F +D+QV  A+I+YGPW + ++  + ++ SPVVS++  
Sbjct: 381  GAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPWAHHEIMPIQKVFSPVVSRDSH 440

Query: 478  PIKKLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDF 537
            P ++L  GS R+ T  ++S+ I+ +S WRIPTREPSKD +F+K++ +T DD RPFGWL+ 
Sbjct: 441  PTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDLDFLKRYKETEDDTRPFGWLEL 500

Query: 538  NLNKGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLG 597
            +L +G++   N ++ PT  G  N  D+HF+  E+ TSVNHDILL ++  D+ A IGYPLG
Sbjct: 501  SLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVNHDILLSAETHDIEAQIGYPLG 560

Query: 598  WNSQADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGY 657
            WN++A W FD+ + Q   F+LK+HI+L  D+ SDF + DPTPY+LFRPF Y  NW++ GY
Sbjct: 561  WNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGDPTPYDLFRPFIYEFNWELTGY 620

Query: 658  SIYLNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRL 717
            S+YLNVND NIVNNP+DFNENCYLS HGD+L I   +P   I+   T I +N+YTP+FRL
Sbjct: 621  SMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQDSIAGNSTTIDYNLYTPLFRL 680

Query: 718  LLNTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYG 777
             +NTP WNTL EFMKDKEVGRA DF + GSYL +S LD++N+DTI +EC SR TTL CYG
Sbjct: 681  NMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDVENIDTIIIECKSRMTTLKCYG 740

Query: 778  VVIRYLMNVQANYFGDFVHFITSEEYSEILQKN--NKRSNDEQGSFXXXXXXXXXXXXXX 835
             V+R+L+ V+ NYFGDFVHF T+EEY E L+      ++N EQ +               
Sbjct: 741  YVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKANSEQSANSTETTTAGEGE--- 797

Query: 836  XXXLYTKEQDLSKPH------VRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCS 889
                   +Q+  K H       ++  + R  NE D+WFTF V DG LILP+ LY+ N C 
Sbjct: 798  ------DKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFTFIVEDGCLILPKNLYDCNACF 851

Query: 890  SLLFSELMISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYV--RDPDHNLNIVHGTL 947
            +  F  L I  R  NYYMD    L  + +    +  P  +F     R P        G++
Sbjct: 852  AFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAHLFSGSEGRCPSR---ANFGSI 908

Query: 948  SDVTIHAHRMFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENK 1007
            SD+ IHAHRMFGLPP++ TYFC+W    G L I S++  + SF   ++KL F + + EN 
Sbjct: 909  SDLHIHAHRMFGLPPDEETYFCKWDFSMGVLDISSDLSCILSFGDAWSKLAFSFKDYENI 968

Query: 1008 LVYKVESSDDMTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLK 1067
            + YK+    DMT +  +  ++ + ++D        +E+  +    +DF+NERYS R ++ 
Sbjct: 969  MNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVENVTARGVDFENERYSSRADVD 1028

Query: 1068 IPEFSISIFDVRNPTIKPILLG-FKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRC 1126
            I   ++    V+       L+G F + +  T F   ++F      Q+++I  +D+P+HRC
Sbjct: 1029 IHSITVQ---VKEGGKDGSLIGDFSSSLKITKFCQLKNFLVHSMQQKSHIATNDAPFHRC 1085

Query: 1127 FFILPTMYQESFLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLENPFLN 1186
             F+LP   Q S  Y +L G I P  SIP +  P+ P  +  ++++FLK   + L+     
Sbjct: 1086 SFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENVTMILDEFLKGEKNSLQ----- 1140

Query: 1187 IRSINNLDTSSLFNEYRVDTYISEKAIFKAEEKNTVNYDPKYEYDNYILNVEYIRVDINP 1246
                  +      ++   D Y      F +   ++   D   E ++ ++ +   +  I+ 
Sbjct: 1141 ------MGNEHFCSKKEEDGYAFN---FASGLMSSTENDSNVESESLVVKLIKPQASISA 1191

Query: 1247 LFSDFIDSMSTKLYSENXXXXXXXXXXXXXXXLGSPKKVLLR--ETNLKLK-ISYVDIF- 1302
                   S S + YS                      +V+L   ET LK K    V +F 
Sbjct: 1192 CCIKPFRSFSDQAYSNFVEQLIDSNEI----------EVVLHFIETTLKRKQCKNVKVFS 1241

Query: 1303 ---------WGSRN----SEGIEIYLDKL--DFEMRQRIFDDFNQRS-LEERTILSKLKS 1346
                     +GS N    S+ ++I + ++  D  MR+    + +++S +++ T L K++S
Sbjct: 1242 PTFEMTLSNFGSDNISQTSDTVDIVIKEISVDISMREEPSPNSSEKSTVQDITALVKVES 1301

Query: 1347 LRCSFSETQ----YEEIEYERPPALSLTVEGLEVWSCTNTAQSNSINILSTDITVDGSQT 1402
            L    S T      E I  ++    S +++ LE W  +   + +S N  S D  V   +T
Sbjct: 1302 LALCVSNTSRNGPLENIHEDQ--LCSTSIKDLEFWMTSEDIRKSSFNATSIDTWVHSDKT 1359

Query: 1403 SWLIKYLNKQVEFFYNLKGSVDLLQKRDVTLQKSLISKLTTASEYYQIDHDPYVITKPAL 1462
                 +L         +   V + ++R    Q+    +++TAS+ YQI HDP VITKPA 
Sbjct: 1360 ELCCIFLKNTAANIDTITEVVSVHKERLQKAQRDFFYRISTASDEYQIIHDPPVITKPAY 1419

Query: 1463 IMRLSNSHVRENRSWRIVTRLRHILNYLPEGWEKSSIAFVEARHVYSDSDPKNVFLSVFS 1522
            I RL N HVREN+SW+I+TRLRHILNYLP          +++    + ++   +FL++FS
Sbjct: 1420 ITRLPNQHVRENKSWKIITRLRHILNYLPPSLLAEIYGALKSASFEAPTNAGEIFLNIFS 1479

Query: 1523 NWRNWEVSDVARSYIYRRVFLPDIEKNLINNTTKIGMESFYFTIYSQRYAVDHNIVVTRI 1582
             WR+WE SDV + Y+YR+ F    E        ++ ++S   T+    +     I V  +
Sbjct: 1480 KWRSWESSDVEQCYMYRKAFYSQYEGQAGPLNLRVEVDSCSATVSDSTHKEGDMIAVKGL 1539

Query: 1583 NV---------IIDQMLSDEEPKAATANKNDKIYDITGTVGTFKGELGDQLIRL---KKL 1630
             +         ++  +L+ ++  A   N       ++ ++   K  + +  I+L   ++L
Sbjct: 1540 KLLKKFILKSEMVGSILAIDDGTATDGNS------LSCSLKAVKASISETAIKLLAFREL 1593

Query: 1631 YSEDKAKIRSEKSTDFSIPKFFKI-NIVLIVEKGELTLAAANTKLISRIKNGKISGFFEN 1689
            +    ++     +      K  K+  + L++++ E+ ++  +     +     IS    +
Sbjct: 1594 FESQNSQDILSNTQVLPSGKILKLMELALLIDRCEIKISLDSKTANLKSFGNSISFALVD 1653

Query: 1690 ARDVANASGSIVYYATRTELWLKHNELILLDAHLD----DLFISVIAELLVKKPTILVNV 1745
                 +   S+    +  E  ++HN  I++DA         FIS      + +    V++
Sbjct: 1654 TESARDTGSSMALAWSWFEFDVRHNNAIIVDAFARRGSLGSFISQSESTTLHR----VHL 1709

Query: 1746 KSSHLRFKALPNTKNLVVFLREFEREISKITGRLTDKDNKKRHTSTSPIFSTKKXXXXXX 1805
             S  LR K   +TK+   F+       S +  +L      K  +     FS         
Sbjct: 1710 GSQKLRLKVPSSTKDYCNFINSLSESWSSLAPKLKFNTRSKDLSPEMKNFS----KVAFE 1765

Query: 1806 XXXXXXXXXXVILSPFTVKHSMKELKIVFNREGDNDTIFSILDADLYLTSYQNGVQYFRL 1865
                        LSP ++    K L + F +E ++     + + DL L S     QY ++
Sbjct: 1766 AHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRLKVENFDLDLLSEMTAQQYLKV 1825

Query: 1866 SYQDINLEAMLTDSKSKLIT-INIVTSLIKLTLADPKKITNSLLQDEKTFEQSLESIK-- 1922
            S   + L A + D   K+ + + + ++L K  L DP++I  +L QD    +Q+LE +K  
Sbjct: 1826 SQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREIIETLTQDLVNAKQNLEQLKIH 1885

Query: 1923 --TLNTLF---SSNREVRTSAVDNPYKFMVNFDLTYFGLLFPVDTSYFILELHSLLATFS 1977
               L  LF   S++ EV   A+  P +++   D+ Y GLL P+ T+ +I E++ L ++ S
Sbjct: 1886 LLALGALFGTDSTDEEVFAGAL-WPREWLWQLDMKYVGLLVPLGTTSYISEINELSSSLS 1944

Query: 1978 NVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSKVLDFSVNLSTETKILNSKRSFEV 2037
                        +   L++    F+I   E+   +SKVL+F+  +       NS +S ++
Sbjct: 1945 CDEAAEFSFP-LVHGELSVAGISFLINDKELPEDLSKVLEFAFRIKLAKVAENSMKSLQI 2003

Query: 2038 ESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEH-TRLQIFKTKK--KASVVSENLIGAP 2094
            ES+HFR+ L P SL++IL        S  Y   H + LQ  K     K+S  +++     
Sbjct: 2004 ESTHFRIALCPFSLIRIL--------SLAYEATHLSGLQALKDNAGVKSSDDAKDFFNIS 2055

Query: 2095 LIEYSIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSAYEDSYGKLTVVDGFFSIANGF 2154
               +SI  LSY+FC+GWIF N  +S  GL  GY RLF+A+E  YGKLT++D +F IA G 
Sbjct: 2056 QTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAAHEKPYGKLTLLDAYFFIARGS 2115

Query: 2155 SSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYGETIDVRFLSNFATIIN 2214
            +S+ FY Q +E ++ NRS LP++QI YW +   +  +LFVR  GE +DV FLS    I  
Sbjct: 2116 TSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELFVRINGERLDVSFLSKSIGIAG 2175

Query: 2215 LTIESVQHFQMIKKETVREMNVEAE-KKVGEDDISTKFSLFFSKVQRINCQCIYDGGVFT 2273
                S+  FQ +K++ +     E   K+V      +K  +  S +  +NC+  Y GGVF 
Sbjct: 2176 GFARSLHLFQELKRQYLDPFKPEEPVKRVPAGSAFSKLPI-LSSISHVNCKVRYAGGVFK 2234

Query: 2274 VYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDMKKPHWIRSFINIEPTYNTLLSQFASF 2333
            +Y +      T  + ++ +P V +  +Y   +  K+ H +R+ ++++ ++NTL       
Sbjct: 2235 LYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHLLRALMSVDSSHNTLFPTCVPI 2294

Query: 2334 LTEFGESVHEMVAKFSPKE-QPPAPKTVSPPIDYKRILEDFDVSFSISAGKQKVSLSCEP 2392
            ++E    + +++   +    + P    +   I+Y+ +L+D D+SF ++  KQ++SLSCEP
Sbjct: 2295 ISEMALDIRQLLKDLNKSSVETPRTSNMQEGINYRSLLQDVDISFMMNIDKQQISLSCEP 2354

Query: 2393 VAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDIKTSINHEFSTEPTASFSVDFVDI 2452
             AKV A+VGFE F   + TND D  EPLS SL +++I  +  H FS E + S +++ +  
Sbjct: 2355 KAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITATSRHIFSREVSTSLNIECLSF 2414

Query: 2453 TTLFTHPD---IYGTTLISDVSLYFNIKQLQNLMVFLDIWNLKRLIKLRPQKS----VPV 2505
              + THPD    YG   I  + +YFNIKQLQ+L VF++IW L   I  +P+      +  
Sbjct: 2415 VFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINIWKLDSKILSQPELDNKFVIGP 2474

Query: 2506 KKPEXXXXXXXXXXXXXXIIPWSFTVIITDINGDIHXXXXXXXXXXXXXXXWISTNHFQD 2565
               E                PW+F VI++ I G+I                W  T+H+ D
Sbjct: 2475 TNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDLGISLGVLSLTTEKIWAVTDHYSD 2534

Query: 2566 RRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRYVENEKLDQSPLVDITLNVENVAV 2625
              + L    D LSL+S GRLGG   + N  W+  +++  NE   +SPLV + + ++  AV
Sbjct: 2535 WTQTLSLQLDKLSLSSDGRLGGTFLLQNFRWMSQIKWPLNEGSFESPLVVLNIFLDETAV 2594

Query: 2626 KAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLHLVCDEIDICSTALVASNILDIS 2685
            K  FDYH+ LI  V  +  +L +++D  G + +LL + L  D   +  TAL  +NI D+ 
Sbjct: 2595 KLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSLSSDSTQVFLTALAPANIFDVY 2654

Query: 2686 NTISRTRQDSRNSYIETLLESNPPPQKSSISYTDILKSLNLLRTDVGIEIHKMQVQISPI 2745
            NTI R R+D+R SY+ETL +SN    K S S  +IL SL+ LRT++ + +  + +Q+ P 
Sbjct: 2655 NTILRMRKDNRKSYLETLGDSNTRDTKGSSSSHEILSSLSFLRTELSVMLKFVHIQVYPS 2714

Query: 2746 SLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKATLSLSKSNEELDEEAVSEISVD 2805
            +LFD+EV+     + S  S T+  +KL T L++K++   L+LS    +L E   S+I V 
Sbjct: 2715 TLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVKLALSTYKSQLHERVASQIGVK 2774

Query: 2806 DYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYLFACKFHDKISVRWNLGPVNFIK 2865
            +Y+ +A K+ GG ILS P + +GMTTW    +  +E L++  F  KI VRWNLG +NF++
Sbjct: 2775 EYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLYSNSFGGKIGVRWNLGSINFLR 2834

Query: 2866 EVWATHVKSLAVRRAQLKGDKEPQLVPGIIGXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 2925
            E+WATH +++A+RR+   G  +       +G                             
Sbjct: 2835 EMWATHARAMALRRSH-NGQSKSFFEDEHLG----------------------DKLKDVD 2871

Query: 2926 XXXKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFPRVTHQTAIILIQKIVHVAQ 2985
               ++ Y+PL+EP IE+P+ KDL +ATPP+EWFGVNRK+FP +THQ  I+ +QK+ H+A+
Sbjct: 2872 LGDEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQFPGLTHQGVIVPLQKLAHLAE 2931

Query: 2986 KEYAKVLG 2993
             E+A++LG
Sbjct: 2932 SEWARILG 2939

>Kwal_56.23810 s56 (712732..721023) [8292 bp, 2763 aa] {OFF} YLR087C
            (CSF1) -  [contig 172] PARTIAL
          Length = 2763

 Score = 1514 bits (3920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 945/2849 (33%), Positives = 1499/2849 (52%), Gaps = 172/2849 (6%)

Query: 219  INDRTYKKNKDERKSILFNFLPIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHAN 278
            +NDRTY+   +   S L   LP++  +  GA+ +GN+ T S++V+S+E   G LD    +
Sbjct: 11   LNDRTYQL-PNSMPSFL-RLLPLEYSVQKGALIIGNKKTSSVMVSSFEKLKGHLDACAPD 68

Query: 279  EKIDLYKSKVTMKFQDVNISVKPNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPF 338
             KIDLYK K+        +S++PNL YD++   +      +L ++ + + +    +    
Sbjct: 69   TKIDLYKIKLQSDITKFQMSLRPNLCYDNDEPLKNLPKANRLPKLLHKYYETFLRV---- 124

Query: 339  TKIYHKHMKKKEHDVESMF--VNKWRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSS 396
             K Y     K E   + +   + +WRGL LY    ++      D   ++    EYA++S 
Sbjct: 125  RKRYLSRGSKTESTRKDLRNPLERWRGLGLY---WKENDPAWDDVFHFELPKHEYARYSK 181

Query: 397  ILKCPNFTLSYYLDSPGIVPHGAHQTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPW 456
            ++KC +  + Y  D+PG+VPHGA  T    DGPD+GN G+PP+F +D+QV  A+I+YGPW
Sbjct: 182  VMKCEHMLIEYSHDTPGVVPHGAFPTLEPLDGPDVGNGGAPPDFSLDIQVFGANIHYGPW 241

Query: 457  TNRQVSYLIRMLSPVVSKNQIPIKKLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDK 516
             + ++  + ++ SPVVS++  P ++L  GS R+ T  ++S+ I+ +S WRIPTREPSKD 
Sbjct: 242  AHHEIMPIQKVFSPVVSRDSHPTERLSAGSTRVFTRLRISIMIMSDSIWRIPTREPSKDL 301

Query: 517  EFIKQFVKTNDDFRPFGWLDFNLNKGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVN 576
            +F+K++ +T DD RPFGWL+ +L +G++   N ++ PT  G  N  D+HF+  E+ TSVN
Sbjct: 302  DFLKRYKETEDDTRPFGWLELSLAEGSEVRLNIAMCPTSTGFDNKLDLHFIKPEIRTSVN 361

Query: 577  HDILLKSKEFDVVADIGYPLGWNSQADWKFDIIAKQLETFLLKEHISLFSDMFSDFASED 636
            HDILL ++  D+ A IGYPLGWN++A W FD+ + Q   F+LK+HI+L  D+ SDF + D
Sbjct: 362  HDILLSAETHDIEAQIGYPLGWNAKAKWNFDLKSHQARMFILKDHITLLGDILSDFGTGD 421

Query: 637  PTPYELFRPFTYSLNWDIEGYSIYLNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPN 696
            PTPY+LFRPF Y  NW++ GYS+YLNVND NIVNNP+DFNENCYLS HGD+L I   +P 
Sbjct: 422  PTPYDLFRPFIYEFNWELTGYSMYLNVNDANIVNNPVDFNENCYLSFHGDDLRISFRVPQ 481

Query: 697  LLISQPYTEIAFNIYTPMFRLLLNTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDI 756
              I+   T I +N+YTP+FRL +NTP WNTL EFMKDKEVGRA DF + GSYL +S LD+
Sbjct: 482  DSIAGNSTTIDYNLYTPLFRLNMNTPSWNTLHEFMKDKEVGRACDFSLAGSYLFHSKLDV 541

Query: 757  DNVDTITMECTSRSTTLFCYGVVIRYLMNVQANYFGDFVHFITSEEYSEILQKN--NKRS 814
            +N+DTI +EC SR TTL CYG V+R+L+ V+ NYFGDFVHF T+EEY E L+      ++
Sbjct: 542  ENIDTIIIECKSRMTTLKCYGYVVRFLVGVKMNYFGDFVHFKTTEEYMEELRDAYVEPKA 601

Query: 815  NDEQGSFXXXXXXXXXXXXXXXXXLYTKEQDLSKPH------VRRADVLRTENELDIWFT 868
            N EQ +                      +Q+  K H       ++  + R  NE D+WFT
Sbjct: 602  NSEQSANSTETTTAGEGE---------DKQNAPKNHTTDPVMAKKLSLKRMVNEKDVWFT 652

Query: 869  FRVWDGALILPEGLYNGNLCSSLLFSELMISFRGSNYYMDFLTNLYDMKINRFLNFSPDE 928
            F V DG LILP+ LY+ N C +  F  L I  R  NYYMD    L  + +    +  P  
Sbjct: 653  FIVEDGCLILPKNLYDCNACFAFEFDSLDIDLRYINYYMDLQAALSPVIVRNLSDCDPAH 712

Query: 929  IFRYV--RDPDHNLNIVHGTLSDVTIHAHRMFGLPPNKLTYFCQWSIDFGSLIIDSNIEF 986
            +F     R P        G++SD+ IHAHRMFGLPP++ TYFC+W    G L I S++  
Sbjct: 713  LFSGSEGRCPSR---ANFGSISDLHIHAHRMFGLPPDEETYFCKWDFSMGVLDISSDLSC 769

Query: 987  LSSFFGLFTKLGFGYSNLENKLVYKVESSDDMTLLTLYGEKVLILVSDDVSQKQASLEIL 1046
            + SF   ++KL F + + EN + YK+    DMT +  +  ++ + ++D        +E+ 
Sbjct: 770  ILSFGDAWSKLAFSFKDYENIMNYKIVPILDMTSIIFHAGEIRVKINDVAVDYYIIVEVE 829

Query: 1047 KLKLNSIDFQNERYSKRINLKIPEFSISIFDVRNPTIKPILLG-FKTKIDFTNFVIKEDF 1105
             +    +DF+NERYS R ++ I   ++    V+       L+G F + +  T F   ++F
Sbjct: 830  NVTARGVDFENERYSSRADVDIHSITVQ---VKEGGKDGSLIGDFSSSLKITKFCQLKNF 886

Query: 1106 RNSLNGQRTYITLHDSPYHRCFFILPTMYQESFLYNELYGGITPSFSIPILPIPMLPNTI 1165
                  Q+++I  +D+P+HRC F+LP   Q S  Y +L G I P  SIP +  P+ P  +
Sbjct: 887  LVHSMQQKSHIATNDAPFHRCSFLLPLAIQRSDNYRKLLGSIVPGVSIPGMVEPITPENV 946

Query: 1166 DFLVEDFLKEYSDLLENPFLNIRSINNLDTSSLFNEYRVDTYISEKAIFKAEEKNTVNYD 1225
              ++++FLK   + L+           +      ++   D Y      F +   ++   D
Sbjct: 947  TMILDEFLKGEKNSLQ-----------MGNEHFCSKKEEDGYAFN---FASGLMSSTEND 992

Query: 1226 PKYEYDNYILNVEYIRVDINPLFSDFIDSMSTKLYSENXXXXXXXXXXXXXXXLGSPKKV 1285
               E ++ ++ +   +  I+        S S + YS                      +V
Sbjct: 993  SNVESESLVVKLIKPQASISACCIKPFRSFSDQAYSNFVEQLIDSNEI----------EV 1042

Query: 1286 LLR--ETNLKLK-ISYVDIF----------WGSRN----SEGIEIYLDKL--DFEMRQRI 1326
            +L   ET LK K    V +F          +GS N    S+ ++I + ++  D  MR+  
Sbjct: 1043 VLHFIETTLKRKQCKNVKVFSPTFEMTLSNFGSDNISQTSDTVDIVIKEISVDISMREEP 1102

Query: 1327 FDDFNQRS-LEERTILSKLKSLRCSFSETQ----YEEIEYERPPALSLTVEGLEVWSCTN 1381
              + +++S +++ T L K++SL    S T      E I  ++    S +++ LE W  + 
Sbjct: 1103 SPNSSEKSTVQDITALVKVESLALCVSNTSRNGPLENIHEDQ--LCSTSIKDLEFWMTSE 1160

Query: 1382 TAQSNSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGSVDLLQKRDVTLQKSLISKL 1441
              + +S N  S D  V   +T     +L         +   V + ++R    Q+    ++
Sbjct: 1161 DIRKSSFNATSIDTWVHSDKTELCCIFLKNTAANIDTITEVVSVHKERLQKAQRDFFYRI 1220

Query: 1442 TTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLRHILNYLPEGWEKSSIAF 1501
            +TAS+ YQI HDP VITKPA I RL N HVREN+SW+I+TRLRHILNYLP          
Sbjct: 1221 STASDEYQIIHDPPVITKPAYITRLPNQHVRENKSWKIITRLRHILNYLPPSLLAEIYGA 1280

Query: 1502 VEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVFLPDIEKNLINNTTKIGMES 1561
            +++    + ++   +FL++FS WR+WE SDV + Y+YR+ F    E        ++ ++S
Sbjct: 1281 LKSASFEAPTNAGEIFLNIFSKWRSWESSDVEQCYMYRKAFYSQYEGQAGPLNLRVEVDS 1340

Query: 1562 FYFTIYSQRYAVDHNIVVTRINV---------IIDQMLSDEEPKAATANKNDKIYDITGT 1612
               T+    +     I V  + +         ++  +L+ ++  A   N       ++ +
Sbjct: 1341 CSATVSDSTHKEGDMIAVKGLKLLKKFILKSEMVGSILAIDDGTATDGNS------LSCS 1394

Query: 1613 VGTFKGELGDQLIRL---KKLYSEDKAKIRSEKSTDFSIPKFFKI-NIVLIVEKGELTLA 1668
            +   K  + +  I+L   ++L+    ++     +      K  K+  + L++++ E+ ++
Sbjct: 1395 LKAVKASISETAIKLLAFRELFESQNSQDILSNTQVLPSGKILKLMELALLIDRCEIKIS 1454

Query: 1669 AANTKLISRIKNGKISGFFENARDVANASGSIVYYATRTELWLKHNELILLDAHLD---- 1724
              +     +     IS    +     +   S+    +  E  ++HN  I++DA       
Sbjct: 1455 LDSKTANLKSFGNSISFALVDTESARDTGSSMALAWSWFEFDVRHNNAIIVDAFARRGSL 1514

Query: 1725 DLFISVIAELLVKKPTILVNVKSSHLRFKALPNTKNLVVFLREFEREISKITGRLTDKDN 1784
              FIS      + +    V++ S  LR K   +TK+   F+       S +  +L     
Sbjct: 1515 GSFISQSESTTLHR----VHLGSQKLRLKVPSSTKDYCNFINSLSESWSSLAPKLKFNTR 1570

Query: 1785 KKRHTSTSPIFSTKKXXXXXXXXXXXXXXXXVILSPFTVKHSMKELKIVFNREGDNDTIF 1844
             K  +     FS                     LSP ++    K L + F +E ++    
Sbjct: 1571 SKDLSPEMKNFS----KVAFEAHVDDFTSEISALSPLSISKRFKGLTVQFEKEANSSLRL 1626

Query: 1845 SILDADLYLTSYQNGVQYFRLSYQDINLEAMLTDSKSKLIT-INIVTSLIKLTLADPKKI 1903
             + + DL L S     QY ++S   + L A + D   K+ + + + ++L K  L DP++I
Sbjct: 1627 KVENFDLDLLSEMTAQQYLKVSQSQVELTAKIHDKIEKVASKMQLESALTKFKLCDPREI 1686

Query: 1904 TNSLLQDEKTFEQSLESIK----TLNTLF---SSNREVRTSAVDNPYKFMVNFDLTYFGL 1956
              +L QD    +Q+LE +K     L  LF   S++ EV   A+  P +++   D+ Y GL
Sbjct: 1687 IETLTQDLVNAKQNLEQLKIHLLALGALFGTDSTDEEVFAGAL-WPREWLWQLDMKYVGL 1745

Query: 1957 LFPVDTSYFILELHSLLATFSNVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQVSKVL 2016
            L P+ T+ +I E++ L ++ S            +   L++    F+I   E+   +SKVL
Sbjct: 1746 LVPLGTTSYISEINELSSSLSCDEAAEFSFP-LVHGELSVAGISFLINDKELPEDLSKVL 1804

Query: 2017 DFSVNLSTETKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEH-TRLQ 2075
            +F+  +       NS +S ++ES+HFR+ L P SL++IL        S  Y   H + LQ
Sbjct: 1805 EFAFRIKLAKVAENSMKSLQIESTHFRIALCPFSLIRIL--------SLAYEATHLSGLQ 1856

Query: 2076 IFKTKK--KASVVSENLIGAPLIEYSIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLFSA 2133
              K     K+S  +++        +SI  LSY+FC+GWIF N  +S  GL  GY RLF+A
Sbjct: 1857 ALKDNAGVKSSDDAKDFFNISQTFHSIQILSYDFCLGWIFNNDGASNSGLTWGYQRLFAA 1916

Query: 2134 YEDSYGKLTVVDGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLF 2193
            +E  YGKLT++D +F IA G +S+ FY Q +E ++ NRS LP++QI YW +   +  +LF
Sbjct: 1917 HEKPYGKLTLLDAYFFIARGSTSNDFYIQPDEVDRPNRSSLPSMQICYWFETNGSEDELF 1976

Query: 2194 VRFYGETIDVRFLSNFATIINLTIESVQHFQMIKKETVREMNVEAE-KKVGEDDISTKFS 2252
            VR  GE +DV FLS    I      S+  FQ +K++ +     E   K+V      +K  
Sbjct: 1977 VRINGERLDVSFLSKSIGIAGGFARSLHLFQELKRQYLDPFKPEEPVKRVPAGSAFSKLP 2036

Query: 2253 LFFSKVQRINCQCIYDGGVFTVYPVRGNHIDTEHAIEITTPKVIIDVDYKYRIDMKKPHW 2312
            +  S +  +NC+  Y GGVF +Y +      T  + ++ +P V +  +Y   +  K+ H 
Sbjct: 2037 I-LSSISHVNCKVRYAGGVFKLYSLDDIKRKTGPSFQLESPSVDVIFEYTKMLTGKRKHL 2095

Query: 2313 IRSFINIEPTYNTLLSQFASFLTEFGESVHEMVAKFSPKE-QPPAPKTVSPPIDYKRILE 2371
            +R+ ++++ ++NTL       ++E    + +++   +    + P    +   I+Y+ +L+
Sbjct: 2096 LRALMSVDSSHNTLFPTCVPIISEMALDIRQLLKDLNKSSVETPRTSNMQEGINYRSLLQ 2155

Query: 2372 DFDVSFSISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDIKT 2431
            D D+SF ++  KQ++SLSCEP AKV A+VGFE F   + TND D  EPLS SL +++I  
Sbjct: 2156 DVDISFMMNIDKQQISLSCEPKAKVQADVGFEKFAMKLFTNDFDVLEPLSLSLDIHNITA 2215

Query: 2432 SINHEFSTEPTASFSVDFVDITTLFTHPD---IYGTTLISDVSLYFNIKQLQNLMVFLDI 2488
            +  H FS E + S +++ +    + THPD    YG   I  + +YFNIKQLQ+L VF++I
Sbjct: 2216 TSRHIFSREVSTSLNIECLSFVFMLTHPDTIHTYGIANIPTIDVYFNIKQLQDLNVFINI 2275

Query: 2489 WNLKRLIKLRPQKS----VPVKKPEXXXXXXXXXXXXXXIIPWSFTVIITDINGDIHXXX 2544
            W L   I  +P+      +     E                PW+F VI++ I G+I    
Sbjct: 2276 WKLDSKILSQPELDNKFVIGPTNLEKPLTSKYKKVISNSSFPWNFVVILSRIRGEIDLGI 2335

Query: 2545 XXXXXXXXXXXXWISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRYVE 2604
                        W  T+H+ D  + L    D LSL+S GRLGG   + N  W+  +++  
Sbjct: 2336 SLGVLSLTTEKIWAVTDHYSDWTQTLSLQLDKLSLSSDGRLGGTFLLQNFRWMSQIKWPL 2395

Query: 2605 NEKLDQSPLVDITLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLHL 2664
            NE   +SPLV + + ++  AVK  FDYH+ LI  V  +  +L +++D  G + +LL + L
Sbjct: 2396 NEGSFESPLVVLNIFLDETAVKLTFDYHLVLIASVEKLSLSLFNKRDPRGVIRNLLSVSL 2455

Query: 2665 VCDEIDICSTALVASNILDISNTISRTRQDSRNSYIETLLESNPPPQKSSISYTDILKSL 2724
              D   +  TAL  +NI D+ NTI R R+D+R SY+ETL +SN    K S S  +IL SL
Sbjct: 2456 SSDSTQVFLTALAPANIFDVYNTILRMRKDNRKSYLETLGDSNTRDTKGSSSSHEILSSL 2515

Query: 2725 NLLRTDVGIEIHKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKAT 2784
            + LRT++ + +  + +Q+ P +LFD+EV+     + S  S T+  +KL T L++K++   
Sbjct: 2516 SFLRTELSVMLKFVHIQVYPSTLFDMEVMTFKARDFSTFSQTEGSKKLKTQLKLKVHNVK 2575

Query: 2785 LSLSKSNEELDEEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYLF 2844
            L+LS    +L E   S+I V +Y+ +A K+ GG ILS P + +GMTTW    +  +E L+
Sbjct: 2576 LALSTYKSQLHERVASQIGVKEYIEHASKVDGGTILSTPAILIGMTTWHDVATNKVELLY 2635

Query: 2845 ACKFHDKISVRWNLGPVNFIKEVWATHVKSLAVRRAQLKGDKEPQLVPGIIGXXXXXXXX 2904
            +  F  KI VRWNLG +NF++E+WATH +++A+RR+   G  +       +G        
Sbjct: 2636 SNSFGGKIGVRWNLGSINFLREMWATHARAMALRRSH-NGQSKSFFEDEHLG-------- 2686

Query: 2905 XXXXXXXXXXXXXXXXXXXXXXXXKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNRKK 2964
                                    ++ Y+PL+EP IE+P+ KDL +ATPP+EWFGVNRK+
Sbjct: 2687 --------------DKLKDVDLGDEYTYIPLEEPHIEIPQTKDLGEATPPVEWFGVNRKQ 2732

Query: 2965 FPRVTHQTAIILIQKIVHVAQKEYAKVLG 2993
            FP +THQ  I+ +QK+ H+A+ E+A++LG
Sbjct: 2733 FPGLTHQGVIVPLQKLAHLAESEWARILG 2761

>Ecym_4310 Chr4 (657929..666760) [8832 bp, 2943 aa] {ON} similar to
            Ashbya gossypii AGR088W
          Length = 2943

 Score =  865 bits (2236), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/1571 (33%), Positives = 811/1571 (51%), Gaps = 84/1571 (5%)

Query: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60
            M+  ++F +I +  E+ F WVFL  W    + ++   FYL R  G I T IL+W IWK+Y
Sbjct: 1    MDFQTEFEAIQVPYERRFGWVFLVNWAQLILINVFTTFYLWRAIGYIVTKILNWVIWKRY 60

Query: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSREVEYKVQANLS 120
            KV INI+S+  S +GG V+ KN+SI ++D T+S L+    WRYWLLN R  + K      
Sbjct: 61   KVVINIQSLGFSIIGGKVYFKNISITDRDQTISILKGTFTWRYWLLNPRPTQLK------ 114

Query: 121  SEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLRLFTKEEREKFSS 180
                      NS   ++NSK  C   +EC G E+F+YN+ A YE++L    K +++    
Sbjct: 115  ----------NSNINDENSK--CRFKLECDGVELFIYNKIAVYEDILNELAKSDKDSSRK 162

Query: 181  FL-NEHDLGDIVSEDTNVNSMDKDYFXXXXXXXXXXXXXINDRTYKKNKDERKSILFNFL 239
            F  ++  +   V  D++V     D               +++++          +  +FL
Sbjct: 163  FATDDESIFGRVKTDSSVMFDPLDESSEQSKVGQTILNSVSNQS-------AVPLYLDFL 215

Query: 240  PIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQDVNISV 299
            P ++ L  GAV +GN+ TPS+ +  Y    G++DV+     +D YK +   +     +SV
Sbjct: 216  PAEVILSSGAVVVGNKHTPSVAIIQYARIEGIIDVAGPTSNLDQYKLRSEFELSSTRVSV 275

Query: 300  KPNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMIPNPFTKIYHKHMKKKEHDVESMFVN 359
            KPN+++ +  +++     GK   +W    D +       + I      KK    +  F+ 
Sbjct: 276  KPNISFGNGSSSKKHKIDGKPFNLWQKLKDCLLFT---ISHILAFTGNKKGLTGQEEFLT 332

Query: 360  KWRGLSLYKDNLRDAGRYGLDEASYDFLNREYAKFSSILKCPNFTLSYYLDSPGIVPHGA 419
             W+GL++Y     D      DE  +D  N EYAK+++IL      L Y  D+PG++    
Sbjct: 333  SWKGLAMYDVATSDTFS---DEIPFDLQNHEYAKYTTILNADRIKLLYSYDTPGVIT--- 386

Query: 420  HQTNVKKDGPDIGNSGSPPEFLVDLQVSKASIYYGPWTNRQVSYLIRMLSPVVSKNQIPI 479
             +T +K  G + G+    PE+ +D+Q+  A+ YYGPW +RQ+ Y I+M SP VS++    
Sbjct: 387  -ETLIK--GYENGDIPPSPEYSIDVQLYDANFYYGPWAHRQLQYFIKMFSPAVSRDFSAH 443

Query: 480  KKLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFVKTNDDFRPFGWLDFNL 539
            +K   G  R H  F+  + I+++S WRIPT+EPSKD  F+ ++  TND+ R FGW+D  L
Sbjct: 444  RKPVLGKSREHANFRCEIVIMEDSVWRIPTKEPSKDAAFLDKYKSTNDESRAFGWIDIKL 503

Query: 540  NKGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKSKEFDVVADIGYPLGWN 599
            NK T  +    L  +  G  N F  + ++  + TSVNHD+L  +K   ++A   YP  WN
Sbjct: 504  NKDTNISIELGLQASECGFENTFHANLVNPVIITSVNHDVLFNAKAHQIIARQSYPHQWN 563

Query: 600  SQADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELFRPFTYSLNWDIEGYSI 659
            S   W    I+  LE F+L++H +L  D+F+DFAS D  PYELFRP  Y  +WDI  YS+
Sbjct: 564  SAITWALHFISSDLELFILRDHFNLLVDLFTDFASGDAVPYELFRPVLYQFSWDISNYSL 623

Query: 660  YLNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPYTEIAFNIYTPMFRLLL 719
            YLN ND NIVNNPLDFNENCY+S+HG+   I   +P   IS+    I++ IYTP F + L
Sbjct: 624  YLNANDANIVNNPLDFNENCYISIHGNSARIGVKLPIETISEESITISYEIYTPKFDIQL 683

Query: 720  NTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTITMECTSRSTTLFCYGVV 779
             TPPW+TL EFM  + VGR+ +F   GSYL Y+D+DIDNVDTI +EC +   T   YG +
Sbjct: 684  KTPPWHTLHEFMAQRFVGRSHEFSASGSYLSYNDVDIDNVDTINLECKTNHATFLAYGFL 743

Query: 780  IRYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGSFXXXXXXXXXXXXXXXXXL 839
            +RY+MN++ NYFG+F  F T+EEYSE L + N  + D    F                  
Sbjct: 744  LRYVMNLKLNYFGEFAQFRTTEEYSEELAQRNDVATD---IFNNNDDDQTTELVEPNSYG 800

Query: 840  YTKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLYNGNLCSSLLFSELMIS 899
             +    L    + +A + RT NE DIW TF   DG  +LPE  Y+   C  L F  +   
Sbjct: 801  ESGFDILHGKKIDKASLKRTVNEKDIWVTFFFEDGCFVLPESFYDFKSCFGLHFDNITFD 860

Query: 900  FRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIVHGTLSDVTIHAHRMFG 959
             R  +YY D   ++    I R+ + S + +F          +   G LS+  IH HRMFG
Sbjct: 861  MRYLSYYADLAFSMNSTYIKRYPDVSSNSVFDVCGSNPFITSNYDGYLSEFNIHIHRMFG 920

Query: 960  LPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSNLENKLVYKVESSDDMT 1019
            LPP + TY  +  +  G L  +S+IE L  F    TK  FG+ N E+ L Y++  S D++
Sbjct: 921  LPPAEETYLFKIDVSLGYLSFESDIEALKGFIQFITKFSFGFDNFEDVLHYEMARSFDIS 980

Query: 1020 LLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKRINLKIPEFSISIFDVR 1079
             L+ + + + I +++  + K  SL I  + L  +DF   +YS R N+ IP F   +  + 
Sbjct: 981  CLSFFADDISIRLNNIDTNKFISLSIPNVSLKLLDFGTSKYSLRANIDIPNFDFLVSSMD 1040

Query: 1080 NPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPYHRCFFILPTMYQESFL 1139
            +  I  +L    T I F  F    DF+ + N Q  +I L D+P+ RC F+ P  YQ S L
Sbjct: 1041 DHNI--VLGTISTSISFAIFSRNPDFKTTNNLQTQHILLSDAPFCRCSFLHPQEYQTSDL 1098

Query: 1140 YNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKE-YSDLLENPFLNIRSINNLDTSSL 1198
            Y  LY  I PS SIP+LP P+ PN  D + E+ L + Y D +     +I +   L  +  
Sbjct: 1099 YKLLYASIPPSSSIPLLPEPIGPNNFDTIFENLLGDIYQDYISEGTFDISNDTKLQLN-- 1156

Query: 1199 FNEYRVDTYISEKAIFKAEEKN-TVN-YDPKYEYDNYILNVEYIRVDIN----PLFSDFI 1252
             +E++     SE +  K + KN T++  D  +E  +++  + +I +DI+     +F+D  
Sbjct: 1157 IDEFKKH---SENSFSKHKTKNLTIDIVDELHEVRSFVFELPHINIDIHIDVLEVFADLY 1213

Query: 1253 DSMSTKLYSENXXXXXXXXXXXXXXXLGSPKKVLLRETNLKLKISYVDI---FWGSRNSE 1309
              ++T   S+                      V    T  K+    +D     +     E
Sbjct: 1214 RQLTTFTISDTIDGLGVDIVNNFSKTFFGASSV----TEAKVVCPRIDFRLRMYEYYALE 1269

Query: 1310 GIEIY----LDKLDFEMRQRI----------FDDFNQRSLEERTIL--SKLKSLRCSFSE 1353
             ++ Y    ++KLD  +R R            +  N+ S+  +T L   K+ S       
Sbjct: 1270 DVKHYFVSDINKLDLNLRLRQEYDKESANSEMNSKNKLSVYYKTALINGKMLSKENFIYP 1329

Query: 1354 TQYEEIEYERPPALSLTVEGLEVWSCTNTAQSNSINILSTDITVDGSQTSWLIKYLNKQV 1413
            ++  E  Y+       T E LE ++  +       N+    + ++   +  + +++    
Sbjct: 1330 SESSEFSYKS------TFEELEGYAFYDDDLVTDANLQRGCVFINQEHSDSISEFIKTLY 1383

Query: 1414 EFFYNLKGSVDLLQKRDVTLQKSLISKLTTASEYYQIDHDPYVITKPALIMRLSNSHVRE 1473
              F     SV + +  + ++++ L+ ++  A + Y I HDP VITKPA+I RLS  HVRE
Sbjct: 1384 LKFNTFIKSVTISKNFNKSMKRELLIRIAQAGQDYGIQHDPPVITKPAVITRLSRHHVRE 1443

Query: 1474 NRSWRIVTRLRHILNYLPEGWEKSSIAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVA 1533
            +RSWRIVTRLRH+LNYLP+ W +++   ++     S+ D K  FL +F+ WR+WE +DV 
Sbjct: 1444 SRSWRIVTRLRHVLNYLPQYWYETTSLELQKGKFRSEEDAKLQFLDIFTRWRSWEFADVE 1503

Query: 1534 RSYIYRRVFLP 1544
            R ++Y++ ++P
Sbjct: 1504 RCFLYKKTYIP 1514

 Score =  615 bits (1585), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 393/1201 (32%), Positives = 627/1201 (52%), Gaps = 66/1201 (5%)

Query: 1817 ILSPFTVKHSMKELKIVFNREGDNDTIFSILDADLYLTSYQNGVQYFRLSYQDINLEAML 1876
            +L PF +++S KE +I  +      +  S+ D  + L S +    Y + S+  + L  M 
Sbjct: 1783 LLLPFILRYSCKEFEINVDFGRILQSSLSLQDTSVELLSLEFQEPYMKYSHSYLKLIGMD 1842

Query: 1877 TDSKSKLITINIVTSLIKLTLADPKKITNSLLQDEKTFEQSLESIKTLNTLFSSNREVRT 1936
              +   L  I++ +S  KL++ +PKK     L D    EQ++++I+ L    S+  E ++
Sbjct: 1843 LGNTDNLGRISLDSSFSKLSIFEPKKNMRLFLSD---IEQAVKNIEILR---STMLETKS 1896

Query: 1937 SAVDNPYKF------MVNFDLTYFGLLFPVDTSYFILELHSLLATFSNVYMNPQQLKEKI 1990
            S V N + F       +N ++ Y GLL    T+ ++LE ++L  +FS    +   +    
Sbjct: 1897 STVQNEFPFSRLIPIQLNLNVEYIGLLLDFGTTLYVLEFNNLEFSFSKDKTSSNPVVPTF 1956

Query: 1991 TCNLALQNTLFMIKSPEVNNQVSKVLDFSVNLSTETKILNSKRSFEVESSHFRVCLNPES 2050
            + + + ++  F+IK   V   +SKVLDFS+ +      L + +S ++ESS+    L+P S
Sbjct: 1957 SSDYSSESICFLIKDRRVKETLSKVLDFSLRIKVIRSSLLAIQSLQIESSYLHAVLSPMS 2016

Query: 2051 LLKILQGVFQTSSSFKYYKEHTRLQIFKTKKKASVVSENLIGAPLIEYSIHFLSYNFCIG 2110
            L+++L  V + S     Y +         K +++  +  L   P+   S H LSYN CIG
Sbjct: 2017 LVRLLSFVNEFSIMKSIYHD--------IKPRSTSSNSTLSILPISIKSAHILSYNLCIG 2068

Query: 2111 WIFENSQSSYPGLIMGYDRLFSAYEDSYGKLTVVDGFFSIANGFSSDTFYSQGNEKEKYN 2170
            W+F+   ++  GLI GY+RLF+ Y+  YGKLT++D +FS+A+GFSS T+Y  GNEK   N
Sbjct: 2069 WLFDLGYNANEGLIWGYERLFAVYDKPYGKLTLLDAYFSVAHGFSSSTYYPDGNEKGAMN 2128

Query: 2171 RSYLPNLQILYWLKEVDAMKQLFVRFYGETIDVRFLSNFATIINLTIESVQHFQMIKKET 2230
            RSYLP++QI YWL+E +  K LF+R  GE +DV  L+ + TI++   +S+  F+ +K+  
Sbjct: 2129 RSYLPSMQINYWLEEENGTKDLFIRVNGEELDVSLLAWWFTIVDEATQSLHKFKKLKETI 2188

Query: 2231 VREMNVEAEKKV-GEDDISTKFSLFFSKVQRINCQCIYDGGVFTVYPVRGNHIDTEH--- 2286
            +  + V +   + GE +     +   S V+ INC   Y G    +Y    +  D +H   
Sbjct: 2189 LDPLKVTSNDPILGEWNYLD--NPLASSVRSINCIINYAGSSMKLY----SRDDIQHGTC 2242

Query: 2287 AIEITTPKVIIDVDYKYRIDMKKPHWIRSFINIEPTYNTLLSQFASFLTEFGESVHEMVA 2346
            + EI +P   + +DYKY    KK HWIR+   +  T+NTL       L E   + + M+ 
Sbjct: 2243 SFEIRSPAHTVTIDYKYYPSKKKSHWIRTLATVNTTHNTLFPVCVPLLNEMWLTFNTMLK 2302

Query: 2347 KFSPKEQPPAPKTVSPP--IDYKRILEDFDVSFSISAGKQKVSLSCEPVAKVHANVGFES 2404
                +    AP   S    I+Y+ +LE FD++  I+ GKQ++SL+CEP AK+ A +GFE 
Sbjct: 2303 NSCSQFSNGAPNLASAKAEINYRDLLEAFDIAVIINVGKQEISLTCEPTAKIQATIGFEK 2362

Query: 2405 FVFSIITNDDDPTEPLSCSLTVNDIKTSINHEFSTEPTASFSVDFVDITTLFTHPD---I 2461
            F   I TN   P EPL  S+ ++++  S  H FS E ++S S+  + +    TH +    
Sbjct: 2363 FDIKIFTNSMVPDEPLCLSVDLHNLMASSRHVFSREISSSLSLQQISMVFSLTHSEYIHT 2422

Query: 2462 YGTTLISDVSLYFNIKQLQNLMVFLDIWNLKRLIKLRPQKSVPVKKPEXXXXXXXXXXXX 2521
            YG+TLIS    YFN+KQ+++L +FL+IW++++   +      PV                
Sbjct: 2423 YGSTLISKPLFYFNVKQIEDLNLFLEIWSIEKQKSVNDIILAPVTASSFESVPSMPKLQR 2482

Query: 2522 XXI---IPWSFTVIITDINGDIHXXXXXXXXXXXXXXXWISTNHFQDRRKALRFFTDSLS 2578
              I     W + +II++I  +I                W  ++H  D  + L      + 
Sbjct: 2483 VPINATFSWDYLLIISEIGAEIDLGPSLGLVKVKSDNLWGLSSHNIDWTQKLLISMKEIC 2542

Query: 2579 LTSVGRLGGLIDVANISWILNVRYVENEKLDQSPLVDITLNVENVAVKAAFDYHMFLIGR 2638
            ++S GRLGG + + +I W   + +         PLV+++L +     K +FDYHMF I  
Sbjct: 2543 MSSSGRLGGYVFIKDIVWKSKITWPIINNFHGVPLVELSLALGAFNTKLSFDYHMFFIST 2602

Query: 2639 VHNILFNLESEKDLIGNLPDLLKLHLVCDEIDICSTALVASNILDISNTISRTRQDSRNS 2698
            + N    L +++D  G L DLL + +  D I +  T+L  +N+ DI +TI R R DS  +
Sbjct: 2603 IQNAAIELFNQQDERGFLADLLSVSVSVDNIQVFITSLAYANLFDIYSTIRRMRNDSGRT 2662

Query: 2699 YIETLLESNPPPQKSSISYTDILKSLNLLRTDVGIEIHKMQVQISPISLFDVEVIVTTVE 2758
             ++ LLESN   + SS   + +L SL  LRT++ +    + + I   +L   EV+V    
Sbjct: 2663 NLD-LLESNELKKISSFDNSKMLASLLSLRTELSVNAQLLNLHIFSTTLIGTEVVVLRTR 2721

Query: 2759 NV------SARSVTQSGEKLMTDLQMKIYKATLSLSKSNEELDEEAVSEISVDDYMIYAM 2812
             V       A S T S  K+ T+L  ++   +LSLS    +LDE  + +I V DY+  A 
Sbjct: 2722 KVIANTKNEASSKTTSDAKVQTELTWQLQDMSLSLSSFKHQLDENQLDKIDVIDYVKLAS 2781

Query: 2813 KLSGGKILSIPKLFVGMTTWQLENSKIIEYLFACKFHDKISVRWNLGPVNFIKEVWATHV 2872
             + GG IL  P +FV M TWQ + S +IE L++  F + +S+ WNL P+NFIK++W+ H+
Sbjct: 2782 IIHGGIILEAPSIFVTMNTWQSQYSNVIELLYSSSFGNGVSITWNLRPINFIKDMWSIHI 2841

Query: 2873 KSLAVRRAQLKGDKEPQLVPGIIGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKFIY 2932
             ++ +R  Q KG+     +P                                    K+IY
Sbjct: 2842 NAMKLRHMQ-KGNSSEIHIP--------------------KDEDIEAKLAKVDLGTKYIY 2880

Query: 2933 VPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFPRVTHQTAIILIQKIVHVAQKEYAKVL 2992
             PL+EP IEMPKIKDL DATPP+EWFG+NR +FP +THQ  ++ +QK+  VA+KEY ++L
Sbjct: 2881 KPLEEPNIEMPKIKDLGDATPPVEWFGLNRSRFPGLTHQIVVVPLQKLSAVAEKEYVRIL 2940

Query: 2993 G 2993
            G
Sbjct: 2941 G 2941

>KLLA0F19096g Chr6 complement(1762215..1770986) [8772 bp, 2923 aa]
            {ON} similar to uniprot|Q12150 Saccharomyces cerevisiae
            YLR087C CSF1 Protein required for fermentation at low
            temperature
          Length = 2923

 Score =  754 bits (1947), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/1270 (34%), Positives = 678/1270 (53%), Gaps = 93/1270 (7%)

Query: 1    MEVDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKY 60
            M+  S F  IS+  EK  S  FL  W+L  I  +   FYL R+   + T  L + +W++Y
Sbjct: 1    MDSSSTFRPISISDEKDLSVPFLVDWILAVILCILAPFYLGRILAWVLTKGLDFWVWRQY 60

Query: 61   KVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFLECRIKWRYWLLNSR--EVEYKVQAN 118
            K+KIN++SI+VSFLGG +F KN+++++ DFT+SFLE    WRYWLL++R   +++     
Sbjct: 61   KIKINLQSIKVSFLGGRIFFKNLTVVSNDFTISFLEGSFTWRYWLLHTRIRGIDF----- 115

Query: 119  LSSEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVFVYNRKAAYENVLR----LFTKEE 174
                +S+  DAS      +N+KLPC  L++C G EVFVYN+   YE+VLR      TK+ 
Sbjct: 116  ----ESEDGDAS------ENAKLPCRFLLQCDGLEVFVYNKIDVYESVLRDHFTNVTKDG 165

Query: 175  REKFSSFLNEHDLGDIVSEDTNVNSMDKDYFXXXXXXXXXXXXXINDRTYKKNKDERKSI 234
            +E  S+            +D  +N+ +K                   ++    K   K+ 
Sbjct: 166  QETESN------------DDITINT-EKAAANSKLSNSSRYSYSGRSKSTDAPKLSAKTK 212

Query: 235  LFNFLPIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDVSHANEKIDLYKSKVTMKFQD 294
            LF   PIQL     A+ LGNR T  + V  +E   GV D+  +   +D Y++K+++   D
Sbjct: 213  LF---PIQLEANRAAIVLGNRNTRHVGVFKFEQAKGVYDIFSSISDLDYYRTKISLDLYD 269

Query: 295  VNISVKPNLAYDSEFTNELDIDKGKLSRIWNTF----IDIMDMI-PNPFTKIYHKHMKKK 349
                ++ NL Y ++   +  + +  + +IW T     I I  ++ PN          + K
Sbjct: 270  ALFELRTNLGYQNDNPIKTFVVEKTMDKIWQTVKKQCISISKLLLPN----------QGK 319

Query: 350  EHDVESMFVNKWRGLSLYKDNLRDAGRYGLDEASYD---FLNREYAKFSSILKCPNFTLS 406
              + +  +++ W+GL LY           + E + D      +EYA++S ++K    +L+
Sbjct: 320  TINNQQAYIDSWKGLDLYHHT------KAVQEENVDTTVLHEQEYARYSRVMKAERVSLT 373

Query: 407  YYLDSPGIVPHGAHQTNVKKDGPDIGNSGS---PPEFLVDLQVSKASIYYGPWTNRQVSY 463
            YY D PGIVP  +   N + D  +  N       P F  D+ +  A++YYGPW ++ +  
Sbjct: 374  YYFDIPGIVPANSSSINSQSDRDESLNCNQDDDTPAFGTDIHIYTAAVYYGPWAHKHMQD 433

Query: 464  LIRMLSPVVSKNQIPIKKLEPGSRRIHTVFKMSVHIIDESSWRIPTREPSKDKEFIKQFV 523
            +IR+ SP+VS++Q+   K EPGS RI+  FK+SV   D+S   IPTRE SKD+EFIK++ 
Sbjct: 434  IIRLFSPIVSRDQMKATKPEPGSLRIYENFKLSVDFRDKSVLHIPTRESSKDEEFIKRYK 493

Query: 524  KTNDDFRPFGWLDFNLNKGTQATFNFSLIPTIDGLGNNFDIHFLDMEVTTSVNHDILLKS 583
             T D  R FGWL+ +LN+G +  FN +L    D L N   +  L+ E+ +SVNH++L + 
Sbjct: 494  TTGDTHRAFGWLNVSLNEGGEILFNLALCSQADRLPNELYVLLLNPEIKSSVNHEVLFRC 553

Query: 584  KEFDVVADIGYPLGWNSQADWKFDIIAKQLETFLLKEHISLFSDMFSDFASEDPTPYELF 643
                + A+IGYP GWN QADW F++ ++  E FLL++HISL SD+F+DF++ D   YELF
Sbjct: 554  NTQTIKANIGYPTGWNKQADWLFELDSRTAELFLLRDHISLISDLFTDFSANDALRYELF 613

Query: 644  RPFTYSLNWDIEGYSIYLNVNDRNIVNNPLDFNENCYLSLHGDELHIDSLIPNLLISQPY 703
            RPFTY + W    Y ++LNVND NI+NN LD NENC+LSL GD L+    +P   I +  
Sbjct: 614  RPFTYEIKWVFTEYKLFLNVNDANIINNLLDLNENCFLSLSGDILNTSINLPFTSIVKEP 673

Query: 704  TEIAFNIYTPMFRLLLNTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIYSDLDIDNVDTIT 763
             E  F + +P+ +L ++ P WNTL EF+ +   G   DF + G+Y+ +  +D+DN DTI 
Sbjct: 674  HETTFLLKSPLVKLSIHPPCWNTLHEFLSETTFGECPDFSMTGTYISFPSVDVDNTDTIL 733

Query: 764  MECTSRSTTLFCYGVVIRYLMNVQANYFGDFVHFITSEEYSEILQKNNKRSNDEQGSFXX 823
            ++  S ST    +G V+RYLMN++ NYFGDF HF T+EEYS  L          +     
Sbjct: 734  IDFRSSSTKFLSFGFVLRYLMNIKLNYFGDFNHFKTTEEYSNDLSMEEDTKTKTKNFQEQ 793

Query: 824  XXXXXXXXXXXXXXXLYTKEQDLSKPHVRRADVLRTENELDIWFTFRVWDGALILPEGLY 883
                            Y     +++  + ++ +LRT+NE D+W TF V DG +I+PE LY
Sbjct: 794  PTNDVESLTSSSSDGSYQVADTINENTIHKSSLLRTKNETDVWITFFVNDGCIIIPENLY 853

Query: 884  NGNLCSSLLFSELMISFRGSNYYMDFLTNLYDMKINRFLNFSPDEIFRYVRDPDHNLNIV 943
            +      L F  L    R +NY+MD       + +N    FS + +     +  H+ N  
Sbjct: 854  DCQRSFLLSFRRLEFDMRYTNYFMDLTAFFSRIYLNHSNEFSFNRVVAI--EESHSENT- 910

Query: 944  HGTLSDVTIHAHRMFGLPPNKLTYFCQWSIDFGSLIIDSNIEFLSSFFGLFTKLGFGYSN 1003
             G L D+ +H HRMFG+PP + TY C+W I  GSL  DS+ +FL SF     K+GF Y +
Sbjct: 911  -GYLDDLNLHGHRMFGVPPVEETYLCKWDISIGSLSTDSDGQFLFSFLEAIQKVGFTYKD 969

Query: 1004 LENKLVYKVESSDDMTLLTLYGEKVLILVSDDVSQKQASLEILKLKLNSIDFQNERYSKR 1063
             EN L+Y +   +D+T LT+   +V  +V  +     A+L +  + +NS D  N RYSKR
Sbjct: 970  AENILIYSIHKPEDVTSLTISIGRVSSIVRTN-HGGSATLSLNDITINSWDLSNSRYSKR 1028

Query: 1064 INLKIPEFSISIFDVRNPTIKPILLGFKTKIDFTNFVIKEDFRNSLNGQRTYITLHDSPY 1123
            ++L +   S+   D +    K +L    T ++ T FV++ + +N    Q+  + L+DSP+
Sbjct: 1029 VDLLVAAISVCAIDEK----KTVLFTCDTAVELTKFVVRSNMKNHRVTQQNCVLLNDSPF 1084

Query: 1124 HRCFFILP-TMYQESFLYNELYGGITPSFSIPILPIPMLPNTIDFLVEDFLKEYSDLLEN 1182
            HRC F+L       S LY++L G ITPS S+P L  P+   T D + E  L  Y +L+  
Sbjct: 1085 HRCKFLLAFDQLNHSTLYDDLLGSITPSISLPTLSEPLTFQTFDNIYERLLGSYINLI-- 1142

Query: 1183 PFLNIRSINNLDTSSLFNEYRVDTYISEKAIFKAEEKNTVNYD------PKYEYDNYILN 1236
                     N DT  +  +   D    +K +      NTV+ D       ++E +N  +N
Sbjct: 1143 ---------NFDTDIIDTKNLTDDRPDDKRLLPL--SNTVSNDLSGQLAEEFESENTTVN 1191

Query: 1237 VEYIRVDINP 1246
            +  + V + P
Sbjct: 1192 ISTLSVFVTP 1201

 Score =  573 bits (1476), Expect = e-164,   Method: Compositional matrix adjust.
 Identities = 384/1190 (32%), Positives = 613/1190 (51%), Gaps = 119/1190 (10%)

Query: 1849 ADLYLTSYQNGVQYFRLSYQ----DINLEAMLTDSKSKLITINIVTSLIKLTLADPK--- 1901
             +L L  Y N ++  R+S      D     +LTD       I + T ++KLTL+D +   
Sbjct: 1806 TELLLDFYFNQLKLLRISNSVTKVDYRSNTLLTD-------IGLDTDIVKLTLSDNRVYI 1858

Query: 1902 -KITNSLLQDEKTFEQSLESIKTLNTLFSSNREVRTSAVDNPYKFMVNFDLTYFGLLFPV 1960
             ++T+SL     T  + ++  K  N    ++ E        P  F +N    Y GLL  +
Sbjct: 1859 EELTDSL---NGTVSELIKIFKNKN----ADNEPAAPKF-KPCSFKMN--AIYIGLLTDL 1908

Query: 1961 DTSYFILELH-------SLLATFSNVYMNPQQLKEKITCNLALQNTLFMIKSPEVNNQVS 2013
             T+ ++LE +       S        + N   L+E    +L +QN   ++ +PEV   +S
Sbjct: 1909 KTTNYVLEFNETAFSCASRAEALEETHAN-DNLRE---MSLVIQNVCILVLNPEVLPTLS 1964

Query: 2014 KVLDFSVNLS-TETKILNSKRSFEVESSHFRVCLNPESLLKILQGVFQTSSSFKYYKEHT 2072
            K+ D    L   E  I   K++ ++E+ H RV L P +L+ ++         F   +   
Sbjct: 1965 KIFDIGFALKLIEDDI---KKTLQIETPHSRVMLAPSTLIAVI---------FFIQEAKV 2012

Query: 2073 RLQIFKTKKKASVVSENLIGAPLIE-YSIHFLSYNFCIGWIFENSQSSYPGLIMGYDRLF 2131
             LQ  K K K +  S  +   P  E  S++ LS   C+GWIFE   +   G+++GY+ LF
Sbjct: 2013 SLQKVKQKGKFNSSSNAIEIPPYFETLSVNILSNKLCLGWIFE-EDTDENGIVIGYESLF 2071

Query: 2132 SAYEDSYGKLTVVDGFFSIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQ 2191
            +AYE  YGKLT+VDG+ + A G  S+ F+   N   + NRS+L ++QI +W       K 
Sbjct: 2072 AAYEKPYGKLTIVDGYVATAQGKESNNFFF-ANGVPELNRSHLSSMQINFWFSGQFIEKD 2130

Query: 2192 LFVRFYGETIDVRFLSNFATIINLTIESVQHFQM-------IKKETVREMNVEAEKKVGE 2244
            LFVR   + +DVR L+    I+N+   S++ FQ        IKK ++   NV        
Sbjct: 2131 LFVRMNADKLDVRILTTSVEIVNVMRSSIESFQKKLAKISNIKKSSISTHNVA------- 2183

Query: 2245 DDISTKFSLFFSKVQRINCQCIYDGGVFTVY-PVRGNHIDTEHAIEITTPKVIIDVDYKY 2303
            +++S K S+    ++ INC   Y GG+  +Y P        + ++E+T+P + + +DY +
Sbjct: 2184 ENLSDKVSIL--SIRSINCIAKYGGGIINLYTPDDIAQDSPKSSLELTSPSIEVSLDYMH 2241

Query: 2304 RIDMKKPHWIRSFINIEPTYNTLLSQFASFLTEFGESVHEMVAKFSP-------KEQPPA 2356
                +K HWIRS +N+E T+N L S     L      + + + +F+        K Q   
Sbjct: 2242 NFPSQKQHWIRSLVNVESTHNILFSSCVPVLVNLTTEIQKQMERFNSEKKQLVHKTQEQT 2301

Query: 2357 PKTVSPPIDYKRILEDFDVSFSISAGKQKVSLSCEPVAKVHANVGFESFVFSIITNDDDP 2416
              T     DYK + +  D +  I+ G Q ++L+CEP AK+ A++GF +F  S+ T+  D 
Sbjct: 2302 TNTQRISFDYKNLFKKIDTAIVINVGAQNITLTCEPRAKIQADLGFSNFRISMFTDSPDH 2361

Query: 2417 TEPLSCSLTVNDIKTSINHEFSTEPTASFSVDFVDITTLFTHPDI---YGTTLISDVSLY 2473
            +EPLS SL  ++I+ S  H FS E ++S  ++ V +  + TH +    YG TLISD+  Y
Sbjct: 2362 SEPLSLSLQWSEIEISTRHIFSREISSSAGINEVYLDFMLTHENTIKTYGNTLISDMKFY 2421

Query: 2474 FNIKQLQNLMVFLDIWN--LKRLIKL-----RPQKSVPVKKPEXXXXXXXXXXXXXXIIP 2526
             N+KQLQ + +FLDIW+   K+  KL       QK  P    E               IP
Sbjct: 2422 VNMKQLQEITLFLDIWSPKTKKAQKLGSGPHSGQKCQPQALTEFTTPK----------IP 2471

Query: 2527 WSFTVIITDINGDIHXXXXXXXXXXXXXXXWISTNHFQDRRKALRFFTDSLSLTSVGRLG 2586
            W + +I  + +  I                WIS++H  D   ++ F+ D L+  S GRLG
Sbjct: 2472 WIYQIIFKNTSAVIDMDPSLGSINFKVPTFWISSHHRVDWSHSVSFYLDELNSKSDGRLG 2531

Query: 2587 GLIDVANISWILNVRYVENEKLDQSPLVDITLNVENVAVKAAFDYHMFLIGRVHNILFNL 2646
            GL ++ NI +  ++ +   +   ++PL+++   + +++ K  FDYH FLI RV ++   +
Sbjct: 2532 GLFEIKNIFFDSSISWPVKDNKFEAPLINLAFKMSHLSSKIGFDYHSFLIARVSDLQLAI 2591

Query: 2647 ESEKDLIGNLPDLLKLHLVCDEIDICSTALVASNILDISNTISRTRQDSRNSYIETLLES 2706
             +E+D  G L DLL + +    ++I  TAL ++N+ DI  T +R R +++ SY++TL ES
Sbjct: 2592 RNERDESGLLKDLLIVSMSFGSVNIFLTALASANLYDIYATFARMRIENKKSYVQTLKES 2651

Query: 2707 NPPPQ-KSSISYTDILKSLNLLRTDVGIEIHKMQVQISPISLFDVEVIVTTVENVSARSV 2765
            NP    K   S  ++L  L L RT++  EI   ++ + P +LFD EV+V     ++  + 
Sbjct: 2652 NPESSGKIHFSNNELLAPLRL-RTNLTAEIGSFRLYVFPSTLFDSEVLVLKANKMNVEAA 2710

Query: 2766 TQSGEKLMTDLQMKIYKATLSLSKSNEELDEEAVSEISVDDYMIYAMKLSGGKILSIPKL 2825
            TQ+ +K  TDL  +I    +SL++   EL EE  +E+SV++Y   A  L G  IL+ P +
Sbjct: 2711 TQTEQKTKTDLTWQIRDINISLAQFKNELTEEQFAELSVEEYNRQAALLEGDIILAAPSV 2770

Query: 2826 FVGMTTWQLENSKIIEYLFACKFHDKISVRWNLGPVNFIKEVWATHVKSLAVRRAQLKGD 2885
            FVG+TTWQ      IE+L++  F DK+ ++WNL P+NFI+E+WATHV++L+VRR    G 
Sbjct: 2771 FVGITTWQKIPDTDIEFLYSSSFGDKVDIKWNLDPINFIREMWATHVRALSVRR----GH 2826

Query: 2886 KEPQLVPGIIGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXKFIYVPLKEPQIEMPKI 2945
             EP                                        K+ Y+PL+EP IEMP +
Sbjct: 2827 TEPS-----------------PSKPFFEDENIAEKIKIVNLGTKYKYIPLEEPHIEMPLL 2869

Query: 2946 KDLEDATPPLEWFGVNRKKFPRVTHQTAIILIQKIVHVAQKEYAKVLGDS 2995
            +DL +ATPP+EWFGVNRK+FP + HQ  ++ +QK+++VA+ +Y + LGD+
Sbjct: 2870 RDLGNATPPIEWFGVNRKRFPGMAHQLIVVPLQKLIYVAEDQYNRTLGDN 2919

 Score = 86.3 bits (212), Expect = 1e-15,   Method: Compositional matrix adjust.
 Identities = 56/198 (28%), Positives = 108/198 (54%), Gaps = 10/198 (5%)

Query: 1400 SQTSWLIKYLNKQVEFFYNL-KGSVDLLQKRDVTLQKSLISKLTTASEYYQIDHDPYVIT 1458
            +   W ++YL K  + F    K  ++L + R + +++++I ++    +   ID  PY+IT
Sbjct: 1369 ADVEWTVEYLLKLAKAFCKEGKSCIELGKLRSIDMKETII-RVAELGKISGIDSVPYIIT 1427

Query: 1459 KPALIMRLSNSHVRENRSWRIVTRLRHILNYLPEGWEKSSIAFVEARHVYSDSDPKNVFL 1518
            KPA I RLS  HVR+  SW+I+TRLRH+  +     E +S        V +    K+ FL
Sbjct: 1428 KPAYITRLSKFHVRDTASWKIITRLRHVSKHTSHVSETTSQCDDIPEEVRNICKDKSQFL 1487

Query: 1519 SVFSNWRNWEVSDVARSYIYRRVFLPDI---EKNLINNTTKIGMESFYFTI-YSQRYAVD 1574
             +F +W+NW+V +V +S ++  +F  +    E++L N  + + +E  +  + Y+ + +  
Sbjct: 1488 DIFVDWKNWDVYEVEQSSLFTLLFSGESTVHEEDLFNELS-LSLEMLHLELPYAPQQS-- 1544

Query: 1575 HNIVVTRINVIIDQMLSD 1592
             +I+  +I++ + +M  D
Sbjct: 1545 -SIIAKQIDLCVKKMSHD 1561

>AGR088W Chr7 (892680..901343) [8664 bp, 2887 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR087C (CSF1)
          Length = 2887

 Score =  739 bits (1909), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/1544 (30%), Positives = 755/1544 (48%), Gaps = 141/1544 (9%)

Query: 36   VIFYLPRVFGAIFTFILHWSIWKKYKVKINIESIRVSFLGGTVFIKNMSIINQDFTLSFL 95
             IFY+ RV G I +   +  +WK+Y+V ++I+S+  S L G V  KN+S+ +QD  +S L
Sbjct: 5    AIFYVGRVLGYIVSKAANLVLWKQYRVTVSIQSLVFSPLAGKVHFKNVSVTSQDQLISVL 64

Query: 96   ECRIKWRYWLLNSREVEYKVQANLSSEQSQGSDASNSMTIEKNSKLPCTILIECKGFEVF 155
            +  I WRYWL+      Y+        +S  +D +            C   ++ +GFE F
Sbjct: 65   KGTITWRYWLIG----RYR--------RSGTADGARR----------CRFALKFEGFEYF 102

Query: 156  VYNRKAAYENVLRLFTKEEREKFSSFLNEHDLGDIVSEDT-NVNSMDKDYFXXXXXXXXX 214
            VYNR   Y+ + R               E D  D  +E T +V S+++            
Sbjct: 103  VYNRNGVYDRIAR---------------ELDGEDTSAEPTVSVPSVEE------------ 135

Query: 215  XXXXINDRTYKKNKDERKSILFNFLPIQLRLIHGAVTLGNRFTPSLVVASYENCNGVLDV 274
                       + +D+   ++  FLP++     GA+ LGN+ T S+ + +YE   G + +
Sbjct: 136  --------VIAELQDD--PLIRRFLPVEFLHNKGAIVLGNKQTHSVAIMNYEKLAGTVSI 185

Query: 275  SHANEKIDLYKSKVTMKFQDVNISVKPNLAYDSEFTNELDIDKGKLSRIWNTFIDIMDMI 334
               ++       +   K  +  +++KPN++Y+ +   ++ ++  + +R+W  +  ++  +
Sbjct: 186  EVPDDTRAPSSFRTEAKISNCTVAIKPNISYEVDNPVKIYVEPKRTARLWKKYKTLLGTV 245

Query: 335  PNPFTKIYHKHMKKKEHDVESMFVNKWRGLSLYKDNLRDAGRYGLDE-ASYDFLNREYAK 393
                    H   KK++H     + N WRGLS+Y  NL +     LDE   +D  + EYAK
Sbjct: 246  ---LEATLHAKRKKEQHQTPKWYDN-WRGLSMYDVNLDEE----LDEEVKFDIEHHEYAK 297

Query: 394  FSSILKCPNFTLSYYLDSPGI--VPHGAHQTNVKKDGPDIGNSGSPPEFLVDLQVSKASI 451
             +++LK     ++Y    PG   V    +  N   + P++ +S       VD+ V  A+ 
Sbjct: 298  CTTVLKADQMDVTYSYGMPGTARVTDSDNAENPLLERPELDHS-------VDILVYDANC 350

Query: 452  YYGPWTNRQVSYLIRMLSPVVSKNQIPIKKLEPGSRRIHTVFKMSVHIIDESSWRIPTRE 511
             YGPW NRQV   +R+ SP V +N       E   +     FK+SV I+++S  R+P +E
Sbjct: 351  TYGPWANRQVQQCLRVFSPTVCRNFKLRTPEEIAQQTEPAAFKLSVTIMEDSVLRVPMKE 410

Query: 512  PSKDKEFIKQFVKTNDDFRPFGWLDFNLNKGTQATFNFSLIPTIDGLGNNFDIHFLDMEV 571
             SKD  F++++ +T D+ RPFGW+D  + K +  T   +  PT +G  N    + +D  +
Sbjct: 411  SSKDAAFLEKYKQTRDETRPFGWIDIRIAKESNITVRMAAYPTENGFENILHANLVDTTI 470

Query: 572  TTSVNHDILLKSKEFDVVADIGYPLGWNSQADWKFDIIAKQLETFLLKEHISLFSDMFSD 631
            +TSVNHD LLK+K  D+  D  YP GW  +A+W F++ + Q E F+L++H+ L SD+ +D
Sbjct: 471  STSVNHDTLLKAKSHDITVDFSYPYGWQDKAEWNFNVCSTQAELFVLRDHVYLISDLVTD 530

Query: 632  FASEDPTPYELFRPFTYSLNWDIEGYSIYLNVNDRNIVNNPLDFNENCYLSLHGDELHID 691
            F+  +   YE FRPF Y   WDI GYS YLNVND NI+NNP+DF ENCYLS+HGD+  I 
Sbjct: 531  FSGGEEVLYEQFRPFDYRFRWDIRGYSAYLNVNDANIINNPIDFGENCYLSVHGDDAEIT 590

Query: 692  SLIPNLLISQPYTEIAFNIYTPMFRLLLNTPPWNTLSEFMKDKEVGRAFDFGIEGSYLIY 751
              +P   I Q Y  + FNI+TP F L LN PPW+T SE +  KE+GR+ +F I+GSY  Y
Sbjct: 591  FSLPITSIIQKYVTVDFNIFTPHFSLFLNAPPWHTFSELLHYKEIGRSKNFNIKGSYTSY 650

Query: 752  SDLDIDNVDTITMECTSRSTTLFCYGVVIRYLMNVQANYFGDFVHFITSEEYSEILQKNN 811
            S++D+DNVD + + C +    + CYGV+++ ++NV+ NYFG+ VHF T+EEY E LQ+ N
Sbjct: 651  SEVDVDNVDALNIACETDYIVVLCYGVILKCMLNVKVNYFGEMVHFRTTEEYVEELQRRN 710

Query: 812  KRSNDEQGSFXXXXXXXXXXXXXXXXXLYTKEQDL---------SKPHVRRADVLRTENE 862
            K++      F                 + T+  ++           P ++++ + R+ NE
Sbjct: 711  KQNPSTCRPF------NSDGNVHDSDVVATESNEIIDASFDAFGGPPTIKKSALKRSINE 764

Query: 863  LDIWFTFRVWDGALILPEGLYNGNLCSSLLFSELMISFRGSNYYMDFLTNLYDMKINRFL 922
            LD+WFTF    G    PE +Y  + C    F  L  S R  NYY+D   +L  +   R  
Sbjct: 765  LDVWFTFISKGGCFFFPENIYKFDACLGFYFDNLEASLRFLNYYVDAAVSLDSIYFKRHT 824

Query: 923  NFSPDEIFRYVRDPDHNLNIVHGTLSDVTIHAHRMFGLPPNKLTYFCQWSIDFGSLIIDS 982
            +     +F+ + D    ++     LS  +   H+M G+ P++ +Y C++ +   +L +  
Sbjct: 825  DIDARTLFKVIEDIGIPIDASDAYLSQFSFRLHKMLGIMPSEESYACEFDVRVDTLDVHC 884

Query: 983  NIEFLSSFFGLFTKLGFGYSNLENKLVYKVESSDDMTLLTLYGEKVLILVS--DDVSQKQ 1040
            ++  L +F      L FG+ ++EN L Y+ E   D+  ++   E V + +   D      
Sbjct: 885  DLAVLKAFVNTLRNLAFGFKDVENSLQYEREQVFDLNKISCVIENVTVKLQNVDKDEDIW 944

Query: 1041 ASLEILKLKLNSIDFQNERYSKRINLKIPEFSISIFDVRNPTIKPILLGFKTKIDFTNFV 1100
             SL +    L S D  NERYS+R +L IPE    I+  R  +    L  F T +  T F 
Sbjct: 945  LSLNLPVTTLTSFDLANERYSRRSDLSIPELLFGIY--RGDSESTCLGAFSTGVTVTLFE 1002

Query: 1101 IKEDFRNSLNGQRTYITLHDSPYHRCFFILPTMYQESFLYNELYGGITPSFSIPILPIPM 1160
              E F      QR +I ++D+P+HRC F+LP  Y++  +Y  LYG I PS S+P+ P P+
Sbjct: 1003 RFEQFARCRVLQRKHILVNDAPFHRCSFMLPPEYKKMPIYRSLYGCIPPSSSLPLFPEPI 1062

Query: 1161 LPNTIDFLVEDFLKE-YSDLLENPFLNIRSINNLDTSSLFNEYRVDTYISEKAIFKAEEK 1219
              +  + + E  L E Y +   +    I   +   T   ++   V+  I   +      +
Sbjct: 1063 SADNFEVIFEKLLGEIYQEYASDSSYQITDDSISSTEHDYHNQTVNAAIGTSSSLFIRSQ 1122

Query: 1220 N--------TVNYDPKYEYDNYI-LNVEYIRVDINPLFSDF-----IDSMSTKLYSENXX 1265
            N         V +DP    D Y+ L+     ++I    ++      IDS+   + ++   
Sbjct: 1123 NHQQTLSSFIVEFDP---IDGYLDLSATEFMLEIYKYLTEVSLDEAIDSLEIGIINQFIQ 1179

Query: 1266 XXXXXXXXXXXXXLGSPKKVLLRETNLKLKISYVDIFWGSRNSEGIEIYLDKLDFEMRQR 1325
                         L     + L  TN + K S   +    +N          LD   R +
Sbjct: 1180 TFGEDNGISEVRVLC--PNISLSATNKQSKFSMFKLSSKIKN----------LDITSRIK 1227

Query: 1326 IFDDFNQRSLEERTILSKLKSLRCSFSETQYEEIEYERPPALSLTVEGLEVWSCTNTAQS 1385
              D   +   E+ T+  K+  +R +  +        +     S ++E LE +   +    
Sbjct: 1228 SSDPNLKPDPEKTTLCYKIDYIRANIVQDGIVVPPKQPSQLFSCSIELLEGYLSYDKLSL 1287

Query: 1386 NSINILSTDITVDGSQTSWLIKYLNKQVEFFYNLKGSVDLLQKRDVTLQKSLISK----- 1440
               N+ S  +T+       L ++LN  +  F       DLLQ+   + + +L++      
Sbjct: 1288 LDNNVQSCSVTLSPGTDKLLFEFLNPFISTF-------DLLQRELSSFEDTLLASKREFL 1340

Query: 1441 --LTTASEYYQIDHDPYVITKPALIMRLSNSHVRENRSWRIVTRLRHILNYLPEGWEKSS 1498
              +      Y+I HDP VITKPA I R SN H+R   SWRI+ RLRHILNYLP+ W +S 
Sbjct: 1341 LNILRGGRDYEIQHDPPVITKPANITRFSNRHIRSAESWRIIMRLRHILNYLPQEWHQSF 1400

Query: 1499 IAFVEARHVYSDSDPKNVFLSVFSNWRNWEVSDVARSYIYRRVF 1542
               +  +   S  +    FLS+FS+WR+WE +DV  S+++ +VF
Sbjct: 1401 TRHLGTQDFTSPEEAGKEFLSIFSDWRSWEPTDVQGSFVHEKVF 1444

 Score =  521 bits (1341), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 368/1220 (30%), Positives = 604/1220 (49%), Gaps = 97/1220 (7%)

Query: 1817 ILSPFTVKHSMKELKIVFNREGDNDTIFSILDADLYL--TSYQNGVQYFRLSYQDINLEA 1874
            ILSPF + +  +  ++    E  +  IF +   + Y+  +S +  + YF+ ++  + L  
Sbjct: 1719 ILSPFIILYCAENFEL--QAESTDSVIFDLNSGESYMEISSAKQKLDYFKYTHTCLKLSG 1776

Query: 1875 MLTDSKSKLIT-INIVTSLIKLTLADPKKITNSLLQDEKTFEQSLESIKTLNTLFS-SNR 1932
              T S ++L   I+    ++KL++ D K     LLQD K    +L S+K+L+ + + S  
Sbjct: 1777 --TSSSARLFEHISCDIGILKLSVFDLKTRITDLLQDIKA---ALFSMKSLSDILNISQS 1831

Query: 1933 EVRTSAVDNPYKFM---VNFDLTYFGLLFPVDTSYFILELHSLLATFSNVYMNPQQLKEK 1989
                SA  + +  +   ++   TY GLL     + +ILE ++  A  +   + P  +  +
Sbjct: 1832 SPTASAFGSWFSILPDNLSLQATYAGLLLGFGHTLYILEFNNFEAKHTRDGL-PDAITPR 1890

Query: 1990 --ITCNLALQNTLFMIKSPEVNNQVSKVLDFSVNLSTETKILNSKRSFEVESSHFRVCLN 2047
                 + ++++  F+IK   ++++++KV+DF+VN +         +S ++ES+H ++ L 
Sbjct: 1891 PCFKVDHSIESASFLIKDRRIDDRLAKVVDFAVNFNMVHDTDLCIQSVQIESTHLKITLA 1950

Query: 2048 PESLLKILQGVFQTSSSFKYYKEHTRLQIFKTKKKASVVSENLIGA--PLIEYSIHFLSY 2105
            P +++++L  + +     K + E + +    +    S  +E L  +   LI  S H LS+
Sbjct: 1951 PMTVVRLLSLINEFGIIRKQFTEES-IYTPSSAHNNSTATECLEPSVWRLIIKSGHILSH 2009

Query: 2106 NFCIGWIFENSQSSYPGLIMGYDRLFSAYEDSYGKLTVVDGFFSIANGFSSDT-FYSQGN 2164
            +F I W+F+   SS  GLI GYDRLFS YE  YGKLT+++ +FS A   +S+  FYS   
Sbjct: 2010 DFSIVWLFDIPNSSADGLICGYDRLFSVYEKPYGKLTLLNAYFSAAKILASEADFYSSVV 2069

Query: 2165 EKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYGETIDVRFLSNFATIINLTIESVQHFQ 2224
             K++ N SYL ++Q+ YW  E      LF+R +G  + V   +   T++  TI+S+Q F 
Sbjct: 2070 RKQRINTSYLSDMQLRYWFTEDSENTDLFIRIHGAKLAVDISAEIVTLLEETIQSIQTFN 2129

Query: 2225 MIKKETVREMNVEAEKKVGEDDISTK----FSLFFSKVQRINCQCIYDGGVFTVYPVRGN 2280
             +KK  V     + +    + DIS +     +   + V+ +NC   Y G    ++   G 
Sbjct: 2130 NLKKALVDPFRTKKQ----DSDISKEPYNWNNQLATGVRSLNCIINYAGVTLKLHSHDGR 2185

Query: 2281 HIDTEHAIEITTPKVIIDVDYKYRIDMKKPHWIRSFINIEPTYNTLLSQFASFLTEFGES 2340
                   +E+T+P   + +DYKY  +++K H  R+ I   PT+NT  S  ++FL      
Sbjct: 2186 --GDASPLELTSPSYKVAIDYKYFPNLEKTHRFRTLITATPTHNTFYST-SAFL------ 2236

Query: 2341 VHEMVAKF------SPKEQPPAPKTVSPPI-----DYKRILEDFDVSFSISAGKQKVSLS 2389
            +H++  +F      S  E   +  + S  I     D   +L   D+   ++ GKQ+V+ S
Sbjct: 2237 IHDLCYRFSKLLKTSSTENKSSSASTSSSIKVEGSDNSTLLGSIDLVIILNVGKQEVTFS 2296

Query: 2390 CEPVAKVHANVGFESFVFSIITNDDDPTEPLSCSLTVNDIKTSINHEFSTEPTASFSVDF 2449
            CEP AKV A VGFE F   I  N+ +  E L  ++ + ++ T+  H +S E  AS  +  
Sbjct: 2297 CEPKAKVQATVGFEKFDIKIFNNNINDEESLCLAIEIENLMTNSRHIYSREVCASLKLRH 2356

Query: 2450 VDITTLFTHPD---IYGTTLISDVSLYFNIKQLQNLMVFLDIWNLKRLIKLRPQKS---- 2502
            + +           IYG+TLIS    YFN+KQLQ+L +F+D W         PQK+    
Sbjct: 2357 ISMVFDIMGSQVRRIYGSTLISSPLFYFNMKQLQDLKLFIDQW--------FPQKTPMNT 2408

Query: 2503 ------VPVKKPEXXXXXXXXXXXXXXIIPWSFTVIITDINGDIHXXXXXXXXXXXXXXX 2556
                  V V                     W ++VI+     +I                
Sbjct: 2409 GSYPEGVLVDDISRSIGSKFYKGSSSSSFTWGYSVIVAGSCAEIELGPSLGVLNVTSEDV 2468

Query: 2557 WISTNHFQDRRKALRFFTDSLSLTSVGRLGGLIDVANISWILNVRYVENEKLDQSPLVDI 2616
            W  +    D  + L      L +TS GRLGG   V N    L +++   +   Q PLV +
Sbjct: 2469 WAISKQQVDWSQQLDLNMGKLDVTSSGRLGGNFLVRNAHLSLELKWPNPKDFFQVPLVCV 2528

Query: 2617 TLNVENVAVKAAFDYHMFLIGRVHNILFNLESEKDLIGNLPDLLKLHLVCDEIDICSTAL 2676
             L  + V  K +FDYH F I  +     +L +E+D  G+L DLL + +  + ++I  TAL
Sbjct: 2529 KLGSDTVDTKLSFDYHTFFISSLKQGYASLFNERDEDGSLADLLSVTVSFESVNIFLTAL 2588

Query: 2677 VASNILDISNTISRTRQDSRNSYIETLLESNPP---PQKSSISYTDILKSLNLLRTDVGI 2733
             A+NI DI N+I+R ++D+  SY+ + L S+ P   P++       I  +L+LLRT + +
Sbjct: 2589 AAANISDIKNSITRLKKDNELSYLSSFLASDQPSDEPEEDG----GIFDTLSLLRTQLSL 2644

Query: 2734 EIHKMQVQISPISLFDVEVIVTTVENVSARSVTQSGEKLMTDLQMKIYKATLSLSKSNEE 2793
             +   ++QISP SLFD +V++ T   + A +  Q+  K+ TDL  ++   +L+L   N  
Sbjct: 2645 NLGVFRLQISPTSLFDSDVLILTATKMMANTGIQADIKIKTDLHWQLDDVSLALLPFNNS 2704

Query: 2794 LDEEAVSEISVDDYMIYAMKLSGGKILSIPKLFVGMTTWQLENSKIIEYLFACKFHDKIS 2853
            LDE  ++ + V  Y+  +  + GG I S P + V MTTWQ   S +IE L++  F   + 
Sbjct: 2705 LDESYLATMEVGKYIELSSTIQGGAIFSAPSIVVNMTTWQEPQSNVIELLYSTSFGGTVK 2764

Query: 2854 VRWNLGPVNFIKEVWATHVKSLAVRRAQLKGDKEPQLVPGIIGXXXXXXXXXXXXXXXXX 2913
            +RWNLGP++FIK++W  H+ ++ +R     G  E  +                       
Sbjct: 2765 IRWNLGPISFIKDMWQAHMNAMQLREGYYHGLAESGVA--------------------VT 2804

Query: 2914 XXXXXXXXXXXXXXXKFIYVPLKEPQIEMPKIKDLEDATPPLEWFGVNRKKFPRVTHQTA 2973
                            + Y+PL+EP IEMP+IKDL DATPP+EWFGVNR KFP  THQ  
Sbjct: 2805 PLNSKAVPLEMHLGSDYQYLPLQEPDIEMPRIKDLGDATPPIEWFGVNRTKFPGFTHQFV 2864

Query: 2974 IILIQKIVHVAQKEYAKVLG 2993
            I+ +QK+   A+KEY K+LG
Sbjct: 2865 IVPLQKLARTAEKEYEKILG 2884

>Kwal_56.23808 s56 (712095..712280) [186 bp, 62 aa] {OFF} YLR087C
          (CSF1) -  [contig 173] PARTIAL
          Length = 62

 Score = 53.5 bits (127), Expect = 5e-08,   Method: Composition-based stats.
 Identities = 26/62 (41%), Positives = 34/62 (54%)

Query: 3  VDSQFASISLGREKYFSWVFLAYWVLTCIASLTVIFYLPRVFGAIFTFILHWSIWKKYKV 62
          + S+F  + +   + FSWVFL  WVL    SL   FY  RV G   T IL +  WK+Y V
Sbjct: 1  MSSEFRRVPISTAQDFSWVFLTDWVLILSVSLLSAFYFGRVLGYTITTILEYLAWKRYGV 60

Query: 63 KI 64
          K+
Sbjct: 61 KV 62

>KLLA0C04862g Chr3 (442167..444062) [1896 bp, 631 aa] {ON} highly
            similar to uniprot|P46943 Saccharomyces cerevisiae
            YLR289W GUF1 Mitochondrial GTPase of unknown function
          Length = 631

 Score = 36.6 bits (83), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 59/126 (46%), Gaps = 14/126 (11%)

Query: 2143 VVDGFF----SIANGFSSDTFYSQGNEKEKYNRSYLPNLQILYWLKEVDAMKQLFVRFYG 2198
            +VD FF    S++ G++S  +   G     Y +S +  L++L   K VDA+ Q+  R   
Sbjct: 487  LVDDFFGKLKSVSRGYASLDYEDVG-----YKQSDIVKLELLVNGKSVDALAQVMHRDQT 541

Query: 2199 ETIDVRFLSNFATIIN-----LTIESVQHFQMIKKETVREMNVEAEKKVGEDDISTKFSL 2253
            E I   ++  F   I      + I++  + ++I +ET++    +   K+   DIS +  L
Sbjct: 542  EHIGKEWVKKFKKFIKSQLFEVVIQARANNKIIARETIKAKRKDVLSKLHASDISRRKKL 601

Query: 2254 FFSKVQ 2259
               + Q
Sbjct: 602  LSKQKQ 607

>SAKL0D07480g Chr4 complement(615534..617513) [1980 bp, 659 aa] {ON}
            some similarities with uniprot|P47050 Saccharomyces
            cerevisiae YJL047C RTT101 Cullin family member subunit of
            a complex containing ubiquitin ligase activity binds HRT1
            and is modified by the ubiquitin like protein RUB1
            Regulator of Ty1 Transposition Regulator of Ty1
            Transposition
          Length = 659

 Score = 35.0 bits (79), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 41/162 (25%), Positives = 72/162 (44%), Gaps = 34/162 (20%)

Query: 1574 DHNIVVTRINVIIDQMLSDEEPKAATANKNDKIYD--ITGTVGTFKGELGDQLIRLKKLY 1631
            DH ++      ++DQ+L+ EEP  +     DK+Y   +     T++ E  D  ++LKK  
Sbjct: 6    DHRVIYRSFCRLLDQVLTVEEPLISFNAILDKLYAQCVYLVRATYEDEDADITLKLKKDK 65

Query: 1632 SEDK-------AKIRSEKSTDFSI-----------PKFFKINIVLIVEKGELTLAAANTK 1673
              DK        K  SEK+  F+I           PK +  N+V    +  L +     +
Sbjct: 66   PRDKHTTFNDLVKFASEKAFRFAIEMANDIQYNEDPKIYLQNVVETYRQFTLRM-----E 120

Query: 1674 LISRIKNGKISGFFENARDVANAS--GSIVYYATRTELWLKH 1713
            L+ R+ +     F ++  +  + S   SI+YY+ R   +L+H
Sbjct: 121  LLKRVFD-----FIDHKNNFVDCSNKSSIIYYSKRC--FLQH 155

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.137    0.399 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 319,212,184
Number of extensions: 14767202
Number of successful extensions: 44891
Number of sequences better than 10.0: 57
Number of HSP's gapped: 45448
Number of HSP's successfully gapped: 94
Length of query: 2995
Length of database: 53,481,399
Length adjustment: 128
Effective length of query: 2867
Effective length of database: 38,804,151
Effective search space: 111251500917
Effective search space used: 111251500917
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 75 (33.5 bits)