Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_392.68.262ON45745723140.0
SAKL0H17028g8.262ON5503887923e-99
KAFR0B055408.262ON5193787746e-97
Kwal_56.237998.262ON4883917647e-96
ZYRO0C01650g8.262ON5863547622e-94
TDEL0F038908.262ON4763567393e-92
KLTH0G13684g8.262ON5083707102e-87
YDR110W (FOB1)8.262ON5663817037e-86
Smik_4.3568.262ON5763696977e-85
Suva_2.2708.262ON6323776946e-84
Skud_4.3718.262ON5803696653e-80
AGR086C8.262ON5343976399e-77
NDAI0J013808.262ON6243876275e-74
Ecym_43088.262ON5293706205e-74
Kpol_543.388.262ON4423626051e-72
CAGL0B01771g8.262ON5363866032e-71
NCAS0B038508.262ON5883836036e-71
TPHA0J007408.262ON4083725862e-70
KLLA0F19140g8.262ON5273805943e-70
TBLA0E044308.262ON4813865731e-67
KNAG0H032408.262ON5193554739e-53
TPHA0A018108.262ON4573734234e-46
TBLA0F030708.262ON4453974014e-43
NDAI0D03010na 1ON7781751189e-06
NCAS0A06040na 1ON5882381081e-04
KAFR0B06620singletonON1185174900.024
CAGL0J00693g5.267ON1884101870.053
NDAI0B06160singletonON140344800.37
NDAI0G00550singletonON41263770.67
Kpol_1037.34singletonON129566770.78
Smik_49.2singletonON55060760.82
SAKL0F06809g2singletonON175579761.2
Ecym_5175singletonON1410243761.2
SAKL0B11583g2singletonON175561751.4
SAKL0C11913g1singletonON175561751.5
Suva_14.2552.207ON349149731.7
Skud_12.300singletonON39846731.9
TDEL0E00260singletonON1248218742.0
NCAS0G02330singletonON657282732.1
KNAG0C06675singletonON28262704.2
Kwal_33.139611.204ON37539695.3
Kpol_2001.101.207ON76473697.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_392.6
         (457 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON} co...   895   0.0  
SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]...   309   3e-99
KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa] ...   302   6e-97
Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {...   298   7e-96
ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {...   298   2e-94
TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.2...   289   3e-92
KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]...   278   2e-87
YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleo...   275   7e-86
Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W ...   273   7e-85
Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W ...   271   6e-84
Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W ...   260   3e-80
AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON} S...   250   9e-77
NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {...   246   5e-74
Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}...   243   5e-74
Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON} (84712..8...   237   1e-72
CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly...   236   2e-71
NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {O...   236   6e-71
TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8....   230   2e-70
KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some...   233   3e-70
TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON} Anc_8...   225   1e-67
KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {O...   186   9e-53
TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {O...   167   4e-46
TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {O...   159   4e-43
NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {O...    50   9e-06
NCAS0A06040 Chr1 complement(1193225..1194991) [1767 bp, 588 aa] ...    46   1e-04
KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa]...    39   0.024
CAGL0J00693g Chr10 complement(61246..66900) [5655 bp, 1884 aa] {...    38   0.053
NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON}            35   0.37 
NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {O...    34   0.67 
Kpol_1037.34 s1037 (80237..84124) [3888 bp, 1295 aa] {ON} (80237...    34   0.78 
Smik_49.2 Chr49 (115..1764) [1650 bp, 550 aa] {ON} YNL054W-B (RE...    34   0.82 
SAKL0F06809g2 Chr6 (518357..519658,519660..523625) [5268 bp, 175...    34   1.2  
Ecym_5175 Chr5 (360152..364384) [4233 bp, 1410 aa] {ON} Similar ...    34   1.2  
SAKL0B11583g2 Chr2 (998260..999561,999563..1003528) [5268 bp, 17...    33   1.4  
SAKL0C11913g1 Chr3 complement(1069940..1073905,1073907..1075208)...    33   1.5  
Suva_14.255 Chr14 complement(468747..469796) [1050 bp, 349 aa] {...    33   1.7  
Skud_12.300 Chr12 complement(546310..547503) [1194 bp, 398 aa] {...    33   1.9  
TDEL0E00260 Chr5 complement(46841..49489,49491..50588) [3747 bp,...    33   2.0  
NCAS0G02330 Chr7 complement(413199..415172) [1974 bp, 657 aa] {O...    33   2.1  
KNAG0C06675 Chr3 complement(1300967..1301815) [849 bp, 282 aa] {...    32   4.2  
Kwal_33.13961 s33 (464777..465904) [1128 bp, 375 aa] {ON} YJL146...    31   5.3  
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    31   7.6  

>Kpol_392.6 s392 complement(8453..9826) [1374 bp, 457 aa] {ON}
           complement(8453..9826) [1374 nt, 458 aa]
          Length = 457

 Score =  895 bits (2314), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/457 (96%), Positives = 442/457 (96%)

Query: 1   MRINTRSVQKSKSLKEKNGAVGIVPNLTELXXXXXXXXXXXXXXXEEPAISLPRSHLKEL 60
           MRINTRSVQKSKSLKEKNGAVGIVPNLTEL               EEPAISLPRSHLKEL
Sbjct: 1   MRINTRSVQKSKSLKEKNGAVGIVPNLTELKKSRSKSKDKSKIDDEEPAISLPRSHLKEL 60

Query: 61  VLPEIKNLDELISESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVSR 120
           VLPEIKNLDELISESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVSR
Sbjct: 61  VLPEIKNLDELISESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVSR 120

Query: 121 EKVKWANKSNEKYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAA 180
           EKVKWANKSNEKYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAA
Sbjct: 121 EKVKWANKSNEKYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAA 180

Query: 181 HKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIE 240
           HKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIE
Sbjct: 181 HKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIE 240

Query: 241 IFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYI 300
           IFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYI
Sbjct: 241 IFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYI 300

Query: 301 ESSTINRNDLIAMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWGM 360
           ESSTINRNDLIAMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWGM
Sbjct: 301 ESSTINRNDLIAMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWGM 360

Query: 361 CLKYGKNLHNNLKNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLDNGK 420
           CLKYGKNLHNNLKNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLDNGK
Sbjct: 361 CLKYGKNLHNNLKNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLDNGK 420

Query: 421 SEIYLEDNLTSTPVIDEKNIEPVGYEYYENPINTLTN 457
           SEIYLEDNLTSTPVIDEKNIEPVGYEYYENPINTLTN
Sbjct: 421 SEIYLEDNLTSTPVIDEKNIEPVGYEYYENPINTLTN 457

>SAKL0H17028g Chr8 complement(1495187..1496839) [1653 bp, 550 aa]
           {ON} similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110W FOB1 Nucleolar protein required for DNA
           replication fork blocking and recombinational hotspot
           activities binds to the replication fork barrier site in
           the rDNA region related to retroviral integrases
          Length = 550

 Score =  309 bits (792), Expect = 3e-99,   Method: Compositional matrix adjust.
 Identities = 157/388 (40%), Positives = 232/388 (59%), Gaps = 26/388 (6%)

Query: 75  SGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLI------------LTDKLTPKKVSREK 122
           + LN EL  RG +D  K+  ++ G L+Q  Y+LI            +TD L P       
Sbjct: 40  TDLNVELLERGGRDFIKYLESVKGQLTQAQYELIKTDTLTLETLLAVTDGLIP------- 92

Query: 123 VKWANKSNEKYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAAHK 182
               + +  KY FLK RYYV D    VRD + DD I+C P  + E+++  HL+N H   +
Sbjct: 93  ----SNAEAKYLFLKRRYYV-DSDQIVRDHKRDDTIVCEPELMYELIVSGHLLNNHLHWR 147

Query: 183 SVHRNLHKRYANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIEIF 242
            +HR L  +Y+NI+R   ++   YCS CNP E VKP  K K    Y+GLLP ERIH+EIF
Sbjct: 148 KLHRFLKSQYSNITRDFVQMCARYCSECNPQEEVKPFTKFKHTNAYQGLLPLERIHVEIF 207

Query: 243 KPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYIES 302
           KPFG ++LIE  YSH+LY RDY+SR+VWL PL    F+EL   L  +  ++ + PI++E+
Sbjct: 208 KPFGTDELIEEKYSHVLYCRDYHSRFVWLSPLTGITFQELVPQLTEFLLSLPRLPIFLET 267

Query: 303 STINRNDLIAMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWGMCL 362
           +T++R D+  M + IA KY L IG+G+ NSS+F+ NG+E MK LL  ++ +C  DWGMCL
Sbjct: 268 TTLDRQDMFDMCEYIARKYQLAIGLGLNNSSHFYKNGIERMKYLLQTNKKKCAKDWGMCL 327

Query: 363 KYGKNLHNNLKNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLDNGKSE 422
           KYG   +N   N +++G   +LL N  +S C  K+K K+  +I E F HN++ L +    
Sbjct: 328 KYGSYHNNTAYNPRIMGFSNDLLCNE-VSSCGKKFKLKREKIIHELFAHNVVTLKDTGGM 386

Query: 423 IYLEDNLTSTPVIDEKNIEPVGYEYYEN 450
           +Y+E N  S  +++++++  V  +  E+
Sbjct: 387 VYVE-NENSVFIMEDEDLISVNQDSQES 413

>KAFR0B05540 Chr2 complement(1134547..1136106) [1560 bp, 519 aa]
           {ON} Anc_8.262 YDR110W
          Length = 519

 Score =  302 bits (774), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 155/378 (41%), Positives = 232/378 (61%), Gaps = 14/378 (3%)

Query: 73  SESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVSREKVKWANKSNE- 131
           ++S +N EL  RG +++ KFQ +ING+L++  YDLI TD LTP+ ++    KW   + E 
Sbjct: 60  TDSFMNLELLKRGEREVFKFQQSINGHLTEETYDLIRTDSLTPETLASTNPKWTKITAEP 119

Query: 132 KYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKR 191
           +Y FLK RYY  + G  + D    DKI+C P  V ++++  HL+N H   K +H +L   
Sbjct: 120 RYLFLKRRYYRDNNGL-IHDHLRKDKIVCEPVYVFDMIMGCHLMNNHGFVKKIHHSLSTF 178

Query: 192 YANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLI 251
           Y+NI+R +   +L +CS CNP + +  L+K K   +Y  L+P ER+HIEIF+PF +EK I
Sbjct: 179 YSNITRDLCLKALKFCSVCNPEQKIGKLEKFKHRNIYNELMPLERVHIEIFEPFPNEK-I 237

Query: 252 EGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRNDLI 311
           E  YSHILY RDY+SRY+W+ PLK T FK L  T+ + F +  + PI+IE+++++  D+ 
Sbjct: 238 EKKYSHILYCRDYHSRYIWMLPLKNTKFKHLVPTMASLFLSFIRQPIFIETASLDWQDMF 297

Query: 312 AMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLHNN 371
            + +KIA +YDL+IG+G    + FH  G+  MK  L  H +ECL  W +CLKYG   HN 
Sbjct: 298 DICEKIAFEYDLQIGLGTSKPNTFHAAGIRQMKAKLEAHREECLLSWNLCLKYGSYDHNI 357

Query: 372 LKNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLDNGKSEIYLEDNLTS 431
             N +  G+P + LL+S I ECS+K+K K   +++     +++ +DNG   I+LE     
Sbjct: 358 RHNDRAGGVPGD-LLSSQIQECSLKFKEKIIQILENAVSESVLRVDNGL--IFLE----- 409

Query: 432 TPVIDEKNIEPVGYEYYE 449
              +DE + EP    Y E
Sbjct: 410 ---VDEPHDEPHDEPYDE 424

>Kwal_56.23799 s56 complement(708590..710056) [1467 bp, 488 aa] {ON}
           YDR110W (FOB1) - DNA replication fork blocking protein
           [contig 173] FULL
          Length = 488

 Score =  298 bits (764), Expect = 7e-96,   Method: Compositional matrix adjust.
 Identities = 153/391 (39%), Positives = 237/391 (60%), Gaps = 16/391 (4%)

Query: 76  GLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVSREKVKWANKSNE-KYY 134
           GLN EL  RG  D  K+Q ++ G L+Q  +DL+ +  LT + +     K  + + E K+ 
Sbjct: 34  GLNDELLARGRLDFIKYQESVKGQLTQEQFDLVRSSALTAENLMSTSDKLHSGNIETKFL 93

Query: 135 FLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKRYAN 194
            LK R+YV   GT VRD + DD ++C P  + ++++C HL N H   + +H  L ++YAN
Sbjct: 94  LLKRRFYVDADGT-VRDFKCDDTVVCEPESLFDLIMCGHLKNGHIHWRRLHHYLRRKYAN 152

Query: 195 ISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLIEGT 254
            +R   +I + YCS CNP E ++P +K +   +Y GLLP ER+H+EI  PF   KLIEG 
Sbjct: 153 TTRAFAQICVRYCSECNPEEVLRPYRKFRHTNIYSGLLPLERVHVEIIAPF--PKLIEGL 210

Query: 255 YSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRNDLIAMV 314
           YSH+LY+RDYYSR+VW+ PL      E+T+  +T+  ++ + PI++E+ST+ R DL  + 
Sbjct: 211 YSHVLYLRDYYSRFVWMQPLASERVSEITKAFLTFLLSLPRVPIFVETSTLKRQDLFEVC 270

Query: 315 QKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLHNNLKN 374
           + IA +Y L IG+G+  S+ F  NG+E ++ LL  +E+ CL  W MCLK+G   HN   N
Sbjct: 271 ENIASQYGLSIGLGMSRSTTFQRNGVERLRYLLQQNEEPCLKSWHMCLKFGVTNHNMTYN 330

Query: 375 RKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLDNG---KSEIYLEDNLTS 431
            +VLG+P N LL+S +S+   +++ K+  +I++ F  N++ L N    +  IYLED  ++
Sbjct: 331 ARVLGLPGN-LLHSTVSDYGRQFELKREELIEKLFASNVVELRNEGRRRGMIYLEDESSA 389

Query: 432 TPVIDEKNI------EPVGYEYYENPINTLT 456
             + DE+ I      E  G++Y   P+  LT
Sbjct: 390 FKMPDEEYISAENETENEGFDY--GPMVGLT 418

>ZYRO0C01650g Chr3 complement(117323..119083) [1761 bp, 586 aa] {ON}
           some similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 586

 Score =  298 bits (762), Expect = 2e-94,   Method: Compositional matrix adjust.
 Identities = 147/354 (41%), Positives = 227/354 (64%), Gaps = 6/354 (1%)

Query: 76  GLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVSREKVKWANKSNE-KYY 134
           G+N  L  +G ++  +FQ T+ G L+Q+IY+LI +D L+   + R   KW  +S+E +YY
Sbjct: 54  GMNLNLLEQGAEESLQFQGTVAGQLTQQIYELIRSDTLSIANLERCH-KWKGESSEIEYY 112

Query: 135 FLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKRYAN 194
           +L++RY+VS++   V DR+ DD+I+C P  +  +V+C+HL N H    ++HRNL K YAN
Sbjct: 113 YLRSRYFVSEENGMVCDRKRDDRIVCEPASMFHLVMCSHLQNNHVTSYNIHRNLVKTYAN 172

Query: 195 ISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLIEGT 254
           I+R     ++ YCS CNP    KP +K +   VY  LLP ER+HIE+F+PF  EK I+G 
Sbjct: 173 ITRDYIVTAISYCSKCNPDLKAKPFQKKRHKNVYWELLPLERVHIEVFEPFDGEK-IQGR 231

Query: 255 YSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRNDLIAMV 314
           +SH+LY RDY+SRYVW+ PL+    K + + + ++   + + PI++ES+TI+R  L  + 
Sbjct: 232 FSHLLYFRDYFSRYVWILPLQNDKRKHMIRAMSSFLLGLPRIPIFLESTTIDREHLFDLC 291

Query: 315 QKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLHNNLKN 374
            +IA  Y L++G+G+ NS  FH NG++ MK+LL  H++ECL DW +CLKYG    N   N
Sbjct: 292 GQIAEHYSLKLGLGVKNSQRFHNNGIKDMKELLGSHKEECLQDWNLCLKYGPFHINQNIN 351

Query: 375 RKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLDNGKSEIYLEDN 428
               G P +LL  S + +C+ K+  K+N VI +T    ++ L  G+  ++LE+N
Sbjct: 352 VSSDGRPGDLLFTS-VPDCNRKFVKKRNDVILDTPSQQVVHL--GEGVLFLENN 402

>TDEL0F03890 Chr6 (724664..726094) [1431 bp, 476 aa] {ON} Anc_8.262
           YDR110W
          Length = 476

 Score =  289 bits (739), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 143/356 (40%), Positives = 226/356 (63%), Gaps = 7/356 (1%)

Query: 73  SESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVSREKVKWANKSNE- 131
           + S +N EL  RG QDL K+Q +ING +   IY+LI T+ LTP+ ++    KW   S E 
Sbjct: 52  ANSYMNMELLERGEQDLLKYQESINGQVLHPIYELIRTNSLTPETLASNSDKWDKDSAES 111

Query: 132 KYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKR 191
           KY FL  RYY  +    VRDRR  DKI+C P  + ++++C HL+N+H  ++ ++  L+K 
Sbjct: 112 KYMFLMRRYYAEN--GIVRDRRKGDKIVCEPLCIFDLIMCAHLMNDHMTYRPIYTCLNKI 169

Query: 192 YANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLI 251
           Y+NI+R   ++++ YCS CNP  H +PL+K +   +++GLLP ER+HIEIF+ F +E  I
Sbjct: 170 YSNITRDFVQMAVRYCSSCNPDGHFRPLEKYRHKNIFKGLLPLERVHIEIFEVFDNES-I 228

Query: 252 EGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRNDLI 311
              ++++LY RDY++R+VWL PLK T FK L   + T    +T  PI++ESST+++ DL 
Sbjct: 229 SNKFTNVLYCRDYHTRFVWLAPLKNTKFKHLVSAVGTLLLGMTYVPIFMESSTLDKQDLF 288

Query: 312 AMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLHNN 371
            + +++  KY++++G+G  +SS FH NG++ MK+LL   + +C+ DW MCL+YG    N 
Sbjct: 289 DICEQLCGKYNMKLGLGANSSSQFHINGIKRMKKLLNTRKVDCISDWNMCLRYGPYHLNR 348

Query: 372 LKNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLDNGKSEIYLED 427
             N    G+P +LL +S  +     ++ K+  +IDE    N++ ++ G   +YLED
Sbjct: 349 RHNTLAGGIPNDLLYHSDHTN-RKHFRPKQEMIIDELPAQNVVHVNKGL--LYLED 401

>KLTH0G13684g Chr7 complement(1171645..1173171) [1527 bp, 508 aa]
           {ON} weakly similar to uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 508

 Score =  278 bits (710), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 145/370 (39%), Positives = 220/370 (59%), Gaps = 8/370 (2%)

Query: 75  SGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVSREKVKW-ANKSNEKY 133
           +GLN EL  RG  D  K+Q ++ G L+Q  +DL+ +  LT   +     K  A     K+
Sbjct: 33  NGLNLELLERGRLDFIKYQESVKGQLTQDQFDLVRSCSLTEDNLMTTSDKLHAGNVETKF 92

Query: 134 YFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKRYA 193
             LK RYYV   G  VRD +  D ++C P  + ++++C HL N H   + +H  L   YA
Sbjct: 93  LLLKRRYYVDADGI-VRDYKCSDTVVCEPELMFDLIMCGHLKNGHLHWRRLHSYLRHNYA 151

Query: 194 NISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLIEG 253
           N +R   +I + YCS CNP E ++P KK +   +Y GLLP ER+H+EI  PF +   IEG
Sbjct: 152 NTTRAFAQICVKYCSQCNPEEELRPYKKFRHTNIYSGLLPLERVHVEIISPFSE--AIEG 209

Query: 254 TYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRNDLIAM 313
           TYSH+L+ RDYYSR+VW+ PLK    +++T+ L+     + + PI+IE+STI+R DL   
Sbjct: 210 TYSHVLFFRDYYSRFVWMQPLKGDDVRDITKGLLATLLLLPRIPIFIETSTIDRQDLFEA 269

Query: 314 VQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLHNNLK 373
            + +A +Y L IG+G+  SS F  NG+E ++ LL  +E++CL  W MCLKYG   HN   
Sbjct: 270 CEDVAGQYSLYIGLGMSQSSTFQKNGVERLRYLLQRNEEQCLRSWYMCLKYGATNHNLNY 329

Query: 374 NRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMI---VLDNGKSEIYLEDNLT 430
           N ++LG+P N LL+S + +   +++ K+  +I++ F  N++   V    +  IYLED  +
Sbjct: 330 NARILGVPGN-LLHSTVCDYGRQFELKREDLIEKLFARNVVEIKVSGRRRGIIYLEDETS 388

Query: 431 STPVIDEKNI 440
           +  + DE+ I
Sbjct: 389 AFKMPDEEYI 398

>YDR110W Chr4 (676102..677802) [1701 bp, 566 aa] {ON}  FOB1Nucleolar
           protein that binds the rDNA replication fork barrier
           (RFB) site; required for replication fork blocking,
           recombinational hotspot activity, condensin recruitment
           to RFB and rDNA repeat segregation; related to
           retroviral integrases
          Length = 566

 Score =  275 bits (703), Expect = 7e-86,   Method: Compositional matrix adjust.
 Identities = 153/381 (40%), Positives = 228/381 (59%), Gaps = 4/381 (1%)

Query: 48  PAISLPRSHLKELVLPEIKNLDELISESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDL 107
           P  S   S  + L+LP +        +S LN EL  RG ++   F  ++   L+Q+IY+L
Sbjct: 34  PGESRESSKDRLLILPSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYEL 93

Query: 108 ILTDKLTPKKVSREKVKWANKSNE-KYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVL 166
           I T  LT   + +   K+     E K  FL+ +YYV D+G  VRD RN+DKI C P  V 
Sbjct: 94  IKTKSLTADTLQQISDKYDGVVAENKLLFLQRQYYVDDEGN-VRDGRNNDKIYCEPKHVY 152

Query: 167 EVVLCTHLINEHAAHKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVKPLKKSKKNE 226
           ++V+ THL+N+H   K++H  L   +ANIS  I      +CS CN    +KPLK+ K+ +
Sbjct: 153 DMVMATHLMNKHLRGKTLHSFLFSHFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPD 212

Query: 227 VYEGLLPFERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTL 286
           +Y+ LLP ERIHIE+F+PF  E  IEG YS++L  RDY S ++WL PLK T FK L   +
Sbjct: 213 MYDKLLPMERIHIEVFEPFNGEA-IEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVV 271

Query: 287 VTYFFTITKTPIYIESSTINRNDLIAMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQL 346
            + F T  + PI++ SST++++DL  + ++IA KY LRIG+G+ +S+ FH  G+  ++  
Sbjct: 272 SSLFLTFARVPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYA 331

Query: 347 LLLHEDECLGDWGMCLKYGKNLHNNLKNRKVLGMPINLLLNSGISECSIKYKSKKNTVID 406
           L  ++ ECL DWG CL+YG    N  +N++    P+ +LL S +   + K+++K+  VI+
Sbjct: 332 LNSYKKECLADWGKCLRYGPYRFNRRRNKRTKRKPVQVLL-SEVPGHNAKFETKRERVIE 390

Query: 407 ETFPHNMIVLDNGKSEIYLED 427
            T+  NM  +  GK  IYLED
Sbjct: 391 NTYSRNMFKMAGGKGLIYLED 411

>Smik_4.356 Chr4 (637418..639148) [1731 bp, 576 aa] {ON} YDR110W
           (REAL)
          Length = 576

 Score =  273 bits (697), Expect = 7e-85,   Method: Compositional matrix adjust.
 Identities = 151/369 (40%), Positives = 223/369 (60%), Gaps = 4/369 (1%)

Query: 60  LVLPEIKNLDELISESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVS 119
           L+LP +        +S LN EL  RG ++   F  ++   L+Q+IY+LI T  LT   + 
Sbjct: 48  LILPSMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTKSLTADTLQ 107

Query: 120 REKVKWANKSNE-KYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEH 178
           +   K+     E K  FL+ +YYV D+G  VRD RN+DKI C PN + ++V+ THLIN+H
Sbjct: 108 QISDKYDGVVAENKLLFLQRQYYVDDEGN-VRDGRNNDKIYCEPNHIYDMVMATHLINKH 166

Query: 179 AAHKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIH 238
              K++H  L   +ANIS  I      +CS CN    +KPLK+ K+ ++Y+ LLP ERIH
Sbjct: 167 LRGKTLHSFLFSYFANISHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIH 226

Query: 239 IEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPI 298
           IE+F+PF  E  IEG YS++L  RDY S ++WL PLK T FK L   + + F +  + PI
Sbjct: 227 IEVFEPFSGE-TIEGKYSYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPI 285

Query: 299 YIESSTINRNDLIAMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDW 358
           ++ SST++++DL  + ++IA KY LRIG+G+ +S+ FH  G+  +   L  +++ECL DW
Sbjct: 286 FVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIHYALNSYKEECLADW 345

Query: 359 GMCLKYGKNLHNNLKNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLDN 418
           G CL+YG    N  +N++    P  +LL S I   + K+++K+  VI+ T+  NM     
Sbjct: 346 GKCLRYGPYRFNRRRNKRTKRKPAQVLL-SEIPGHNAKFETKRERVIENTYSRNMFKTAG 404

Query: 419 GKSEIYLED 427
           GK  IYLED
Sbjct: 405 GKGLIYLED 413

>Suva_2.270 Chr2 (470408..472306) [1899 bp, 632 aa] {ON} YDR110W
           (REAL)
          Length = 632

 Score =  271 bits (694), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 149/377 (39%), Positives = 230/377 (61%), Gaps = 6/377 (1%)

Query: 54  RSHLKE--LVLPEIKNLDELISESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTD 111
           R  LK+  L+LP +        +S LN EL  RG ++   F  ++   L+Q+IY+LI T 
Sbjct: 91  RESLKDRLLILPLMGESYTEYVDSYLNLELLERGERETPIFLESLTRQLTQKIYELIKTK 150

Query: 112 KLTPKKVSREKVKWANKSNE-KYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVL 170
            LT + + +   K+   + E K  FL+ +YYV ++G  VRDRRN+DKI C P  + ++V+
Sbjct: 151 SLTAETLQQISDKYDGVAAENKLLFLERQYYVDNEGN-VRDRRNNDKIYCEPKHIYDMVM 209

Query: 171 CTHLINEHAAHKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEG 230
            THL+N+H   K++H  L   +AN S  I      +CS CN    +KPLK+ K+ ++Y+ 
Sbjct: 210 ATHLMNKHLRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDK 269

Query: 231 LLPFERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYF 290
           LLP ERIHIE+F+P+G  K IEG Y ++L  RDY S ++WL PLK T FK L   + + F
Sbjct: 270 LLPMERIHIEVFEPYGG-KAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVVSSLF 328

Query: 291 FTITKTPIYIESSTINRNDLIAMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLH 350
            +  + PI++ SST++++DL  + ++IA KY LRIG+G+ +S+ FH  G+  ++  L  +
Sbjct: 329 LSFARIPIFVTSSTLDKDDLYDICEEIASKYGLRIGLGLKSSARFHTGGILCIQYALNSY 388

Query: 351 EDECLGDWGMCLKYGKNLHNNLKNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFP 410
           ++ECL DWG CL+YG    N  +N++    P  +LL S +   + K+++K+  VI+ T+ 
Sbjct: 389 KEECLADWGKCLRYGPYRFNRRRNKRTKRKPTQVLL-SEVPGHNAKFETKRERVIENTYA 447

Query: 411 HNMIVLDNGKSEIYLED 427
            NM  +  GK  IYLED
Sbjct: 448 RNMFTMAGGKGLIYLED 464

>Skud_4.371 Chr4 (647726..649468) [1743 bp, 580 aa] {ON} YDR110W
           (REAL)
          Length = 580

 Score =  260 bits (665), Expect = 3e-80,   Method: Compositional matrix adjust.
 Identities = 143/369 (38%), Positives = 220/369 (59%), Gaps = 4/369 (1%)

Query: 60  LVLPEIKNLDELISESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVS 119
           L+LP +        +S LN EL  RG ++   F  ++   L+Q+IY+LI T  LT   + 
Sbjct: 49  LILPSMGESYTAYVDSYLNLELLERGERETPIFLESLTRQLTQQIYELIKTKSLTADTLQ 108

Query: 120 REKVKWANKSNE-KYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEH 178
           +   K+     E K  FL+ +YYV ++G  VRD RN+DKI C P  + ++V+ THL+N+H
Sbjct: 109 QISDKYDGVVAENKLLFLQRQYYVDNEGN-VRDGRNNDKIYCEPKHIYDMVMATHLMNKH 167

Query: 179 AAHKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIH 238
              K++H  L   +AN S  I      +CS CN    +KPLK+ K+ ++Y+ LLP ERIH
Sbjct: 168 LRGKTLHSFLFSHFANTSHAIIDWVQQFCSKCNKKGKIKPLKEYKRPDMYDKLLPMERIH 227

Query: 239 IEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPI 298
           IE+F+PF     IEG Y ++L  RDY S ++WL PLK T FK L   + + F +  + PI
Sbjct: 228 IEVFEPFTG-GAIEGKYPYVLLCRDYRSSFMWLLPLKSTKFKHLIPVISSLFLSFARVPI 286

Query: 299 YIESSTINRNDLIAMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDW 358
           ++ SST++++DL  + ++IA KY L IG+G+ +S+ FH  G+  ++  L  +++ECL DW
Sbjct: 287 FVTSSTLDKDDLYDICEEIASKYGLCIGLGLKSSARFHTGGILCIQYALNSYKEECLADW 346

Query: 359 GMCLKYGKNLHNNLKNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLDN 418
           G CL+YG    N  +N++    P  +LL S +   + K+++K+  VI+ T+  NM  +  
Sbjct: 347 GKCLRYGPYRFNRRRNKRTKRKPAQVLL-SEVPGHNAKFETKRERVIENTYSRNMFKMAG 405

Query: 419 GKSEIYLED 427
           GK  IYLED
Sbjct: 406 GKGLIYLED 414

>AGR086C Chr7 complement(888758..890362) [1605 bp, 534 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR110W
           (FOB1)
          Length = 534

 Score =  250 bits (639), Expect = 9e-77,   Method: Compositional matrix adjust.
 Identities = 141/397 (35%), Positives = 224/397 (56%), Gaps = 21/397 (5%)

Query: 74  ESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVSR--EKVKWANKSNE 131
           +  L  E  +RG  +L K   T+ G L+Q IYDLI +D L+ +K+    +KV   N    
Sbjct: 42  DGSLEHEWIDRGRGELRKIMKTVKGQLTQEIYDLIASDTLSTQKLLECCDKVT-PNTVEN 100

Query: 132 KYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKR 191
           KY  LK RY    KG  V DR+  D  +  P+ + ++++  HLIN+H   + V++++   
Sbjct: 101 KYVLLKRRYVA--KGGIVIDRKRKDAPVIEPDSLFDMIMSAHLINDHMPWRKVYQHMKGL 158

Query: 192 YANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKL- 250
           YAN++R +T +   YCS CN    V+   + K   V+E L+P ER H+E+F PF DE + 
Sbjct: 159 YANVTRELTNMVTGYCSHCNMDRSVRRFSRYKHYNVHEKLMPLERCHVEVFAPFDDEGVE 218

Query: 251 -IEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRND 309
            I+G YSH LY RDY+SR++WL PL+  AF+ L   L     T+ + PI++E++T++R D
Sbjct: 219 KIQGKYSHFLYCRDYHSRFIWLLPLEGIAFRYLLPALAQLLCTMIRVPIFLETATLDRQD 278

Query: 310 LIAMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLH 369
           +  + + IA +Y  +IG+G+ + + F  NG++ +KQLL  +++EC  DW MCL+   +  
Sbjct: 279 MFDICEVIARRYKFKIGLGLNSGTEFQKNGIKRVKQLLSEYKEECQDDWNMCLRLVLSRV 338

Query: 370 NNLKNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLDNGKSEIYLEDNL 429
           N     +V G+P +LL N  I   S+K+K K+  +ID+ + H+++        IYLED  
Sbjct: 339 NQTYADRVRGIPSDLLCNE-IPNISMKFKQKQKKIIDQLYAHHVVHFKEAGGMIYLEDEE 397

Query: 430 TS----------TPVIDEKNIEPVGYEYYENPINTLT 456
           ++          TPV +E    PV  +  +N    LT
Sbjct: 398 SAFVMDDPDDDCTPVPEEP---PVASDSIQNSATILT 431

>NDAI0J01380 Chr10 complement(317185..319059) [1875 bp, 624 aa] {ON}
           Anc_8.262 YDR110W
          Length = 624

 Score =  246 bits (627), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 142/387 (36%), Positives = 214/387 (55%), Gaps = 16/387 (4%)

Query: 54  RSHLKELVLPEIKNLDELISESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKL 113
           R H    ++P +        +  ++ +L  RG      FQ +I+G L + +Y+LI T  L
Sbjct: 85  RRHYGSYLIPNVGESYMDYVDPEVDVDLLKRGEVTFLNFQRSIHGQLDEVVYELIRTKSL 144

Query: 114 TPKKVSREKVKWANKSNEKYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTH 173
           T + ++     + +        L  R YV+D    VRD+   ++I+C P  + E+++  H
Sbjct: 145 TEETLA---ANFPHFHAPTRCALFKRRYVADNEGRVRDQLRGNRIVCDPVLLYEMMMTCH 201

Query: 174 LINEHAAHKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLP 233
           L+N+HA ++  H  L   YANI+R     ++ +CS CNPS+ V PL K K    Y+G+LP
Sbjct: 202 LMNDHAQYRRCHVALSSIYANITRDFLYKAVQFCSVCNPSKLVGPLLKFKHVNYYKGMLP 261

Query: 234 FERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTI 293
            ER+HIEIF+PF  +K IEG YSH++Y RDY SRY+ L PLK T FK L   +    F +
Sbjct: 262 LERVHIEIFEPFNGKK-IEGKYSHVIYCRDYRSRYIMLEPLKNTKFKNLVSAIAKLLFNL 320

Query: 294 TKTPIYIESSTINRNDLIAMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDE 353
            + PI+IE+ ++N  D   + + I  KY + +G+G+  +  FH  G++ MK LL  H  E
Sbjct: 321 PRIPIFIETVSLNTQDAFDIFEAIVEKYQINVGLGMKTAKRFHTRGVKQMKILLEGHRKE 380

Query: 354 CLGDWGMCLKYGKNLHNNLKNRKVLGMPINLLLNSGISECSIK---YKS-KKNTVIDETF 409
           CL DW MCLKYG + +N   N +  G+P++LL       C++K   +KS +K   I  T 
Sbjct: 381 CLNDWTMCLKYGPHNYNTKHNDRACGVPVDLLT------CNVKDVTHKSIEKYEQIIRTL 434

Query: 410 PHNMIVLDNGKSEIYLEDNLTSTPVID 436
           P + IV   G   IYLE+ +   P ID
Sbjct: 435 PKDNIV-QIGNGSIYLEEKVKD-PNID 459

>Ecym_4308 Chr4 complement(654030..655619) [1590 bp, 529 aa] {ON}
           similar to Ashbya gossypii AGR086C
          Length = 529

 Score =  243 bits (620), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 130/370 (35%), Positives = 216/370 (58%), Gaps = 9/370 (2%)

Query: 77  LNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVSR--EKVKWANKSNEKYY 134
           L+ +  + G  +L K  +T+ G L+Q IY+LI ++ L+ + +    +KV      N K+ 
Sbjct: 51  LDHDWLDTGRNELIKLINTVKGQLTQDIYELISSNTLSTQTLLECCDKVTAGTVEN-KFV 109

Query: 135 FLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKRYAN 194
            LK RY +  +G  V  +R D  ++  P+ V +V++  HLIN H   + +H++L   YAN
Sbjct: 110 LLKRRYSIL-QGNVVDHKREDLPVI-EPDLVFDVIMAAHLINGHLPWRKIHQHLKNLYAN 167

Query: 195 ISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDE--KLIE 252
           ++R  T +  LYCS CN   ++K   + K   VY+ ++P ER H+EIF PF D+  + IE
Sbjct: 168 VTRDFTNLVTLYCSHCNTDRNMKRFLRYKHYNVYDKVMPLERCHVEIFAPFDDDGNEKIE 227

Query: 253 GTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRNDLIA 312
             YSH+LY RDY+SR+VW+ PL+   F++L   L     ++ + PI++E++T++R D+  
Sbjct: 228 DKYSHVLYCRDYHSRFVWMLPLEGITFRDLVPALTQLLCSMIRLPIFLETATLDRQDMFD 287

Query: 313 MVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLHNNL 372
           + + IA KY L+IG+G+ + + F  NG+  +K L   H+++C+ +W MCL+      N  
Sbjct: 288 VCEYIARKYKLKIGLGLNSGTDFQRNGVTRIKNLFAEHKEQCIKEWNMCLRLVLTRVNQN 347

Query: 373 KNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLDNGKSEIYLEDNLTST 432
            + +V G+P +LL N  IS  + K+K K+  +IDE + H+++        IYLED+  S 
Sbjct: 348 YSDRVRGIPSDLLCNE-ISNIAHKFKLKQRKIIDELYAHHVVQFREAGGMIYLEDD-NSA 405

Query: 433 PVIDEKNIEP 442
            V+DE    P
Sbjct: 406 FVVDEDEHGP 415

>Kpol_543.38 s543 (84712..86040) [1329 bp, 442 aa] {ON}
           (84712..86040) [1329 nt, 443 aa]
          Length = 442

 Score =  237 bits (605), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 133/362 (36%), Positives = 210/362 (58%), Gaps = 9/362 (2%)

Query: 82  FNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVSREKVKWAN-KSNEKYYFLKNRY 140
           F RG     ++  +I G LSQ +Y+LI  D L    +S EK +W+   +N K  +LK RY
Sbjct: 67  FGRGAA--KEYLDSIIGTLSQTVYELIRDDLLDVDTLS-EKTRWSRINANAKCLYLKRRY 123

Query: 141 YVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKRYANISRTIT 200
            ++ KGT + D   ++KI+  P+   + ++ TH++N H  ++ +H+ L   Y+N+SR   
Sbjct: 124 KLTKKGTVI-DLTRENKIVYEPDLRYDYIISTHILNRHLGYQGIHKRLKAIYSNLSRDYI 182

Query: 201 RISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLIEGTYSHILY 260
           ++ L +CS CNP + +  L+K+    +YE  LP ER+ ++IF+PF +EK I+  YSHI+Y
Sbjct: 183 KMVLDFCSHCNPDKVIPNLEKTVHMNIYEKYLPLERVQLDIFEPFENEK-IQNRYSHIIY 241

Query: 261 IRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRNDLIAMVQKIALK 320
           IRDY SR+VW+YPLK T FK L   +      + + PIYI+++TI R D++A+ ++IA K
Sbjct: 242 IRDYRSRFVWIYPLKNTKFKTLASEIGMLLLDLPRIPIYIDTTTIERRDMLAICKRIAEK 301

Query: 321 YDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLHNNLKNRKVLGM 380
           Y++ +GIG    S F+  GL  +K LL  ++D+CL DW MCLK G   +N        G+
Sbjct: 302 YEISLGIGTIEPSSFYSIGLSRLKCLLNENKDKCLKDWNMCLKLGSYYYNKKSITTARGV 361

Query: 381 PINLLLNSGISECS-IKYKSKKNTVIDETFPHNMIVLDNGKSEIYLEDNLTSTPVIDEKN 439
           P  L L+    ECS   ++SK+  +I+     N       K  +Y +D + +T      N
Sbjct: 362 PSELFLDE--MECSATTFESKRTEIINSLPIQNSYKTSTNKGLVYAQDEILTTSKNKSSN 419

Query: 440 IE 441
           +E
Sbjct: 420 ME 421

>CAGL0B01771g Chr2 (163063..164673) [1611 bp, 536 aa] {ON} weakly
           similar to uniprot|O13329 Saccharomyces cerevisiae
           YDR110w FOB1 DNA replication fork blocking protein
          Length = 536

 Score =  236 bits (603), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 133/386 (34%), Positives = 208/386 (53%), Gaps = 20/386 (5%)

Query: 59  ELVLPEIKNL--DELISE-SGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTP 115
           + V+P +     D L+ E S ++ +   RG +D+ +F   + G L+Q  Y L++ + LT 
Sbjct: 59  KFVMPALDETYEDYLVGEDSTIDVDFLKRGEKDMRRFAEGLAGKLTQETYTLLMNNNLTM 118

Query: 116 KKVSREKVKWA-NKSNEKYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHL 174
           + V +    W  N +  KY  L  R+Y  DK   +RD + D+ I+  P+K+  ++L  HL
Sbjct: 119 ETVMKAMNIWPPNAAETKYSNLIKRFY-KDKEGNIRDAKVDNNIVLEPDKLFNLILTAHL 177

Query: 175 INEHAAHKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPF 234
            N H     + + L + YAN +R   + +L YC+ CNP  ++KP++K +   + E LLP 
Sbjct: 178 KNGHLKTAVLFQCLREVYANCTRDFVQTALFYCNRCNPDRYIKPIEKVRHRNINEELLPL 237

Query: 235 ERIHIEIFKPF----GDEKL---------IEGTYSHILYIRDYYSRYVWLYPLKKTAFKE 281
           ER+HIE+F PF    GD K          IEG YSH+ Y RD+ +RYVW +PLK   FK 
Sbjct: 238 ERVHIEVFAPFEKEEGDIKQEDSQNPYIKIEGKYSHVFYCRDFRTRYVWCFPLKNMKFKT 297

Query: 282 LTQTLVTYFFTIT-KTPIYIESSTINRNDLIAMVQKIALKYDLRIGIGIGNSSYFHYNGL 340
           L   + T+F T+    PI++ESSTI+R+DL  + + +A KY L++G+G  N + FH  G+
Sbjct: 298 LVDNIATFFMTVLYDPPIFVESSTIDRDDLKEIFELLASKYGLKLGLGFANFTKFHAQGI 357

Query: 341 ETMKQLLLLHEDECLGDWGMCLKYGKNLHNNLKNRKVLGMPINLLLNSGISECSIKYKSK 400
           +  K  L   + EC  DW MCLK G    N +  R+ LG   N+L    + +     + K
Sbjct: 358 KRFKTHLHRAKSECADDWLMCLKQGTYSANRVIERQ-LGKASNILFTELMGQFERDMRKK 416

Query: 401 KNTVIDETFPHNMIVLDNGKSEIYLE 426
           K   I+++F  N+         I++E
Sbjct: 417 KLKYIEQSFSENIKTYPKSGGCIFIE 442

>NCAS0B03850 Chr2 complement(685424..687190) [1767 bp, 588 aa] {ON}
           Anc_8.262 YDR110W
          Length = 588

 Score =  236 bits (603), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 130/383 (33%), Positives = 209/383 (54%), Gaps = 6/383 (1%)

Query: 52  LPRSHLKELVLPEIKNLDELISESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTD 111
           + R  LK  ++P I    +   +  ++     RG ++  +FQ TING L++  Y+LI T+
Sbjct: 74  IKRLKLKGYLIPNIGEKYKDYVDEDMDLAFVQRGEREFFEFQKTINGQLNESTYELIKTN 133

Query: 112 KLTPKKVSREKVKWAN-KSNEKYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVL 170
            LT + +S   +K    ++  +  FL  RY + ++G  VRD+   ++++C P  + ++++
Sbjct: 134 SLTQETLSATALKMDKFRAASRLVFLNRRYGLDEQGN-VRDKLRQNRMVCEPVFIYDMIM 192

Query: 171 CTHLINEHAAHKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEG 230
             HLIN+H   +  H+ L   Y+NI+R        +CS CNPS+   P KK K    ++G
Sbjct: 193 TWHLINDHGRPRKCHQLLGPMYSNITRFFVERICQFCSVCNPSKETIPFKKYKHINWFKG 252

Query: 231 LLPFERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYF 290
           LLP ER+ +E+F+PF  EKL  G Y  ILY RDY SR++W+ PL+ + F  L   +    
Sbjct: 253 LLPLERVQVEVFEPFPGEKL-GGKYPQILYFRDYRSRFIWMVPLRNSKFGHLVDLISKMI 311

Query: 291 FTITKTPIYIESSTINRNDLIAMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLH 350
           F++ + PI+ E++TI   D   + +KI  KY + IG+G         NGL  +++LL  H
Sbjct: 312 FSMIRIPIFFETTTIENQDFFDIFEKIVEKYQINIGLGTKLGGKRLTNGLPQIRKLLGPH 371

Query: 351 EDECLGDWGMCLKYGKNLHNNLKNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFP 410
           ++ECL DW MCLKYG +  NN  N +  G+P +LL    I +   K   K   ++ +   
Sbjct: 372 KEECLADWIMCLKYGPHTFNNKMNDRACGVPGDLLTGD-IPDLYTKSYDKIEQILQDLPT 430

Query: 411 HNMIVLDNGKSEIYLEDNLTSTP 433
            N++ +  G+  IYLED     P
Sbjct: 431 ENIVKI--GRGCIYLEDRNPEDP 451

>TPHA0J00740 Chr10 (175036..176262) [1227 bp, 408 aa] {ON} Anc_8.262
           YDR110W
          Length = 408

 Score =  230 bits (586), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 121/372 (32%), Positives = 217/372 (58%), Gaps = 10/372 (2%)

Query: 62  LPEIKNLDELISESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLIL-------TDKLT 114
           +PE+  L ++   S ++ E  N G  D  + +S  + +L+Q++Y LI        T +  
Sbjct: 24  IPELDILYKIELGSDIDIERINHGRNDHLQLESVFSSFLTQKMYTLIREKNFNYETFEEA 83

Query: 115 PKKVSREKVKWANKSNEKYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHL 174
            K    +  K+   +N+K+  +++RY +++ G  + D+RND K++ PPN++ ++++  H 
Sbjct: 84  MKSHYTDSGKYMGTANKKFMLMEDRYQLNELGQ-ITDKRNDYKLIVPPNQIYDLIMHCHF 142

Query: 175 INEHAAHKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPF 234
           +N+H     +H +L ++Y+NISR + R+SL  CS CNP    K ++ ++     +    F
Sbjct: 143 LNDHLGSTKIHHSLREKYSNISRALVRLSLQNCSHCNPKSTYKHIEYTRHFSCDKNF-AF 201

Query: 235 ERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTIT 294
           E+IH+EIF+PF D       +SH++YIRDY++RYVWLYPL+K + KEL  TL T+     
Sbjct: 202 EKIHVEIFQPFEDVDTFANKFSHVIYIRDYFTRYVWLYPLEKISVKELANTLATHLLLSL 261

Query: 295 KTPIYIESSTINRNDLIAMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDEC 354
           + PIYIES T++ ++L+ ++++I+   +L +G+G      F  +G+  MK+L + + + C
Sbjct: 262 RIPIYIESLTLDESNLLKILKRISKTTNLILGVGTTKLDEFQASGINHMKELFVQNREYC 321

Query: 355 LGDWGMCLKYGKNLHNNLKNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMI 414
             +W   +   +N +N   N+ + G+P+NL+    +++ +  YK K+   I  T   N I
Sbjct: 322 GNNWNKYVIRCQNHYNTTYNKWIYGIPLNLMAQETLAD-NKTYKKKRQRTILLTLSKNTI 380

Query: 415 VLDNGKSEIYLE 426
           +L NGKS +Y E
Sbjct: 381 LLKNGKSALYKE 392

>KLLA0F19140g Chr6 (1773327..1774910) [1584 bp, 527 aa] {ON} some
           similarities with uniprot|O13329 Saccharomyces
           cerevisiae YDR110W FOB1 Nucleolar protein required for
           DNA replication fork blocking and recombinational
           hotspot activities binds to the replication fork barrier
           site in the rDNA region related to retroviral integrases
          Length = 527

 Score =  233 bits (594), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 130/380 (34%), Positives = 213/380 (56%), Gaps = 16/380 (4%)

Query: 59  ELVLPEIKNLDELISESG-LNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKK 117
           + VLP +K  D L S  G L++++   G   L K  +T+ G L+Q IYDL+ +D LT + 
Sbjct: 56  KFVLP-VKGFD-LGSFCGELDQDMLIEGRLQLEKEINTVKGQLTQPIYDLLHSDALTKEN 113

Query: 118 VSREKVKWANKSNE-KYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLIN 176
           + R   K  N + E K+  LK RYYV +    + D +  D ++  PN++ ++++  H++N
Sbjct: 114 LLRASDKVTNSTVENKFVLLKRRYYVQE--NLLHDVKRKDLVVYEPNELFDLIMSVHVLN 171

Query: 177 EHAAHKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFER 236
            H + K ++  L   YAN++++  ++   +CS CN S +    KK K   ++  L+P  R
Sbjct: 172 SHVSSKGIYNELSTFYANVTQSFCKLVTSFCSKCNESGNKISYKKFKHENIHANLIPLGR 231

Query: 237 IHIEIFKPFG---------DEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLV 287
            H+EIF PF          DE  IEG Y  +LY RDYYSRYVWL PLK     +L   + 
Sbjct: 232 CHVEIFAPFDSAYQGNDNTDELKIEGKYPFVLYCRDYYSRYVWLEPLKSVTLSDLLPVMT 291

Query: 288 TYFFTITKTPIYIESSTINRNDLIAMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLL 347
              F++ + PI+I++ T++R D+  + + IA  Y ++IG+G+ +S+ F   G++ MK L 
Sbjct: 292 KLLFSMIRMPIFIDTCTLDRQDMFDVCENIARIYKIKIGLGMNSSTSFQKTGIKRMKSLF 351

Query: 348 LLHEDECLGDWGMCLKYGKNLHNNLKNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDE 407
           L H++ECL DW MCLK   +  N   + +V G+P +LL ++   +   K+++ +  VI  
Sbjct: 352 LQHKEECLHDWNMCLKLVVSRLNQNYSDRVRGVPSDLLCSTQ-QDLHKKFRTLQRNVISR 410

Query: 408 TFPHNMIVLDNGKSEIYLED 427
              H+++  +     IYLED
Sbjct: 411 LLGHHVVQFEEAGGMIYLED 430

>TBLA0E04430 Chr5 (1136737..1138182) [1446 bp, 481 aa] {ON}
           Anc_8.262 YDR110W
          Length = 481

 Score =  225 bits (573), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 135/386 (34%), Positives = 216/386 (55%), Gaps = 18/386 (4%)

Query: 58  KELVLPEIKNLDELISESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKK 117
           K+L +     LDE    S +N EL  +G++D+ ++ S     L+Q   D++ T  L+P+ 
Sbjct: 33  KDLGISYTDYLDE--KNSNVNIELLEKGYKDMQRYHSIKAAVLTQEYCDMLNTGTLSPEN 90

Query: 118 VSREKVKWANKSN--EKYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLI 175
           + +   K  N S   EKY F   RYY+++    + D+R   +I+C P  + ++V+  HL 
Sbjct: 91  IIKYDTKLTNHSKALEKYNFTSRRYYLNEDNNII-DKRKPGRIICEPKYMYDIVIAYHL- 148

Query: 176 NEHAAHKSVHRNLHKRYANISRTITRISLLYCSFCNP--SEHVK------PLKKSKKNEV 227
             H+++ +V   L K ++N+ R        YCS C P  +EH+K        K  + N +
Sbjct: 149 KLHSSY-AVSERLKKFFSNVGRQYIDYCAKYCSKCFPDETEHMKLFTDDITFKNIRNNII 207

Query: 228 YEGLLPFERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLV 287
              L P ERIHIEIF PF D K IE  Y  ILYIRDY +RY+W + LKK   K +T  L 
Sbjct: 208 DRPLFPMERIHIEIFNPFDDLK-IENKYQRILYIRDYSTRYIWTFTLKKLKLKHITNILT 266

Query: 288 TYFFTI-TKTPIYIESSTINRNDLIAMVQKIALKYDLRIGIGIGNS-SYFHYNGLETMKQ 345
            +F +I T  PI+++SSTI+  DL  + +KI+ +Y + +G+G  N   +FH +G+E  KQ
Sbjct: 267 EFFLSIATNVPIFLQSSTIDNTDLFDICEKISREYHISLGLGTNNKHDHFHLSGIEMFKQ 326

Query: 346 LLLLHEDECLGDWGMCLKYGKNLHNNLKNRKVLGMPINLLLNSGISECSIKYKSKKNTVI 405
           L+ L++ +CL  W   L +G  LHNN  N ++L  PI+++  + +++   K++ ++  +I
Sbjct: 327 LVNLNKSKCLKSWSNFLVFGSVLHNNKFNSRILSKPIDIINCNNLAQGKKKFRDRRLRII 386

Query: 406 DETFPHNMIVLDNGKSEIYLEDNLTS 431
            +T   N + L N  S I++ED  TS
Sbjct: 387 KQTITDNYVKLGNVASIIFIEDEATS 412

>KNAG0H03240 Chr8 complement(603920..605479) [1560 bp, 519 aa] {ON}
           Anc_8.262 YDR110W
          Length = 519

 Score =  186 bits (473), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 108/355 (30%), Positives = 191/355 (53%), Gaps = 8/355 (2%)

Query: 73  SESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVSR-EKVKWANKSNE 131
           ++  L+ E   RG +D+  +  T  G +SQ +Y L   D +T + ++R      +   + 
Sbjct: 47  ADEKLDIEFCKRGERDITAYAPTQPGRMSQELYALFKNDDVTKENIARLYPTDRSGDESR 106

Query: 132 KYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKR 191
           K  ++  RYY  D    +RD   +++I+  P    ++++  HL+N+H   + V+R L + 
Sbjct: 107 KMMYITRRYY-KDANGMIRDATMNNRIVYDPIHTFDIIMSCHLMNKHLGSERVYRCLREF 165

Query: 192 YANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLI 251
           YAN    + + +L YCS CNPS  + P K   K  ++E  LP ERI IEI +PF +EK +
Sbjct: 166 YANGGPLLIKRTLEYCSVCNPSLKLTP-KVQPKPYLFEKALPLERITIEIIEPFPNEK-V 223

Query: 252 EGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINRNDLI 311
           EG YS+++ ++D+  R+ WL PLK T FK +   +     +  + PI++ES+T++ +DL 
Sbjct: 224 EGKYSNMVVMKDFIGRFEWLEPLKNTKFKNIVPVVAKMILSFPRVPIWVESNTLDWSDLF 283

Query: 312 AMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWGMCLKYGKNLHNN 371
            + + I  KY ++IG+G    S         + + L  H DECL D+  CLKYG   +N 
Sbjct: 284 DIFEMIVTKYGIKIGLGCTTRSS-AAQATARINRDLNDHHDECLFDFNNCLKYGPTKYNQ 342

Query: 372 LKNRKVLGMPINLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLDNGKSEIYLE 426
           +K       P +++ +S  ++   K+++K+  ++  +   +  V++ G   +YLE
Sbjct: 343 IKYLGFHKSPCDIISHSE-TQLKAKFRAKRAFILKHS--PSSCVMNRGMGTLYLE 394

>TPHA0A01810 Chr1 complement(365982..367355) [1374 bp, 457 aa] {ON}
           Anc_8.262 YDR110W
          Length = 457

 Score =  167 bits (423), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 113/373 (30%), Positives = 193/373 (51%), Gaps = 13/373 (3%)

Query: 61  VLPEI-KNLDELISESGLNKELFNRGHQDLAKFQSTINGYLSQRIYDLILTDKLTPKKVS 119
           ++P I +  D LI+   L+K+L  +G   +A  ++    YLS+ +YDL+  D LT K V+
Sbjct: 32  IIPRIGQKYDSLIT-PLLDKQLLQKGEIAVANSKT---NYLSKELYDLVKNDDLTRKNVA 87

Query: 120 REKVKWANKSNEKYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHA 179
                    +  +   LK+RYY  D    V DR   +KI+  P     +V+ THL+N+H 
Sbjct: 88  VALNLDEKNAITRLIPLKHRYY-RDSKLMVHDRSKQNKIVIDPAHRFRMVMTTHLLNDHL 146

Query: 180 AHKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHI 239
              +++R L K +AN+S    + S+ YCS CN ++     KK  +      +L +ER+ +
Sbjct: 147 TRGAIYRTLSKCFANLSDPFIKTSIEYCSICNSNKKNIRRKKEPQLSNSPDILFYERLIL 206

Query: 240 EIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIY 299
           ++  PFG +K I+  Y+HIL I D++++++W +PLK    + +   +  +   +   P++
Sbjct: 207 DVVAPFGAKK-IQKRYTHILTITDFHTKFMWSFPLKNLKLRTIISKVTEFIVALPVKPVF 265

Query: 300 IESSTINRNDLIAMVQKIALKYDLRIGIGIGNSSYFHYNGLETMKQLLLLHEDECLGDWG 359
           I S T++ ND+  +   +A +Y++ IG+G  N     Y+    + ++L  H+ ECL  W 
Sbjct: 266 ISSFTLSLNDIFELCCYLAREYNISIGLGTRNMQK-AYSKNPYVTRILNSHKTECLKSWF 324

Query: 360 MCLKYGKNLHNNLKNRKVLGMPI--NLLLNSGISECSIKYKSKKNTVIDETFPHNMIVLD 417
           MCLK+   L +   N K    P   N  L SG+++   KY+ +   +I      N I +D
Sbjct: 325 MCLKW---LADRQSNSKFDIRPPNKNYGLFSGMTDFLKKYEERSKMIIGRLPSENFINID 381

Query: 418 NGKSEIYLEDNLT 430
            G   IY ED  +
Sbjct: 382 EGSHFIYSEDEFS 394

>TBLA0F03070 Chr6 complement(745795..747132) [1338 bp, 445 aa] {ON}
           Anc_8.262 YDR110W
          Length = 445

 Score =  159 bits (401), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 113/397 (28%), Positives = 206/397 (51%), Gaps = 26/397 (6%)

Query: 57  LKELVLPEIKNLDELISESGLNKELFNRGHQDLAKFQSTINGYLSQRIY------DLILT 110
           + +   P I + DE+  +S ++ ++  RG ++  +F++T+  +++  +Y       L+  
Sbjct: 25  IDDFFCPPIGDDDEIYYDSYIDSDMLKRGEKETMEFRNTLKKHITSDLYYAMRDESLLED 84

Query: 111 DKLTPKKVSREKVKWANKSNEKYYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVL 170
           D   P  +   K+K + K      +L+ RY  +  G  +  + N  K+LC P  + ++ +
Sbjct: 85  DAPIPASL---KIKTSKK-----MYLQIRYSKNSDGDLIETKTN--KLLCEPKYIYKLTM 134

Query: 171 CTHLINEHAAHKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVKPLKKS--KKNEVY 228
             H +N H     ++RNL  +Y NI   +  + L YCS CN +  ++ ++ +  ++N+ Y
Sbjct: 135 KAHFMNNHMRSNKLYRNLSMKYCNIPNLLVVLVLQYCSHCNTTGKIRDIRSNYGQRNQ-Y 193

Query: 229 EGLLPFERIHIEIFKPFGDEKL-IEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLV 287
              LP ER+ I+I KPF D  + I   YSHIL IRDY+SRY W++PLK    K ++  L 
Sbjct: 194 IDYLPLERLQIDITKPFNDSDIKIANKYSHILLIRDYHSRYSWIFPLKSPNIKNISTELG 253

Query: 288 TYFFTITKTPIYIESSTINRNDLIAMVQKIALKY--DLRIGIGIGNSSYFHYNGLETMKQ 345
            +  T+ +TPI++ S  I  + LI ++ KI L+Y   +RIGIG      F   G+  +  
Sbjct: 254 KFLVTLPRTPIFLHSIGIPESQLIKILTKILLEYKIKIRIGIGGIKGRMFLRKGISRLVY 313

Query: 346 LLLLHE--DECLGDWGMCLKYGKNLHNNLKNRKVLGMPINLLLNSGISECSIKYKSKKNT 403
           LL L E  ++C  DW  C++       N +  +  G   N L+    +E +  +++K++ 
Sbjct: 314 LLNLKENKEKCKSDWYQCIR-NTTFKENRRFDRNTGSFANFLIGKQKAELNKVFENKRDA 372

Query: 404 VIDETFPHNMIVLDNGKSEIYLEDNLTSTPVIDEKNI 440
           ++ +    N++ +    S IY ++N  S   +DEK++
Sbjct: 373 LLSDLLEENVLKIGECGSIIYFDNN-NSGKELDEKDV 408

>NDAI0D03010 Chr4 complement(712188..714524) [2337 bp, 778 aa] {ON} 
          Length = 778

 Score = 50.1 bits (118), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 46/175 (26%), Positives = 74/175 (42%), Gaps = 27/175 (15%)

Query: 158 ILCPPNKVLEVVLCTH--------LINEHAAHKSVHRNLHKRYANISRTITRISLLYCSF 209
           I CPP  +  V+ C H         + +H     +   L  +Y NIS+ +    +  C  
Sbjct: 154 IWCPPTLLHYVIACVHENWDCDDYTLRKHRDENEIQSILAAKYHNISKFLIHDVVAACPD 213

Query: 210 CNPSEHVKPLKKSKKNEVYEGLLP-----FERIHIEIFKPFGDEKLI----EGTYSHILY 260
           C      KPL   K N     +LP     F+R+ ++I     D   +      T + ILY
Sbjct: 214 C------KPLSSKKFNITRVNVLPLTRYSFQRLQVKILS-AADYSCVCPKDNCTKNAILY 266

Query: 261 IRDYYSRYVWLYPLK-KTAFKELTQTLVTYFFTITKTP--IYIESSTINRNDLIA 312
           I DY+S  VWL+ L  +    ++   L  +   +  TP  I +++  I R++ IA
Sbjct: 267 IGDYHSGAVWLFALDGEEDATDILLVLEMFLNVVLITPKHIQVDNQKIFRDENIA 321

>NCAS0A06040 Chr1 complement(1193225..1194991) [1767 bp, 588 aa]
           {ON} 
          Length = 588

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 58/238 (24%), Positives = 98/238 (41%), Gaps = 51/238 (21%)

Query: 104 IYDLILTDKLTPKK------------------VSREKVKWANKSNEKYYFLKNRYYVSDK 145
           I DL+L +K  P+                   +SR K K  N  +    ++  RY V D+
Sbjct: 65  IADLLLANKFNPESLKAAVFSKYTGAENKGTAISRSKRKLKNFCD----YITARYVVIDE 120

Query: 146 GTTVRDRRNDD---KILCPPNKVLEVVLCTHL---INEH---AAHKSV---HRNLHKRYA 193
               R     D   K+ CPP+ +   ++  H    I+E    A H+ V   H  + ++ +
Sbjct: 121 KIYARKASKGDESPKMWCPPSLMTFFIIRYHRRQDIDESERKARHRGVAATHDAIGEKMS 180

Query: 194 NISRTITRISLLYCSFCNPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFK--------PF 245
            I+R + +     C  CN ++ V  +     N   E  +PFE + I+I          P 
Sbjct: 181 GITRQLIQDVTYDCLKCNVTKGVPIIYVPDDNPKAE--VPFENLLIDIIDLKDRSCRCPK 238

Query: 246 GDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQ--TLVTYFFTITKTPIYIE 301
            ++K      S IL+I D Y+ Y WLY L  T    +     ++ Y F ++   +Y++
Sbjct: 239 DNKK-----KSQILHIMDQYTEYTWLYILDDTHHDAIAMIFEVLLYHFPLSTKHVYVD 291

>KAFR0B06620 Chr2 complement(1376088..1379645) [3558 bp, 1185 aa]
           {ON} 
          Length = 1185

 Score = 39.3 bits (90), Expect = 0.024,   Method: Compositional matrix adjust.
 Identities = 44/174 (25%), Positives = 72/174 (41%), Gaps = 32/174 (18%)

Query: 233 PFERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTA-------FKELTQT 285
           PF+ IH ++F P  D      TY   +   D  +R+ W+YPL+  +       F++L   
Sbjct: 666 PFQYIHTDLFGPMSDVSATTPTY--FISFVDENTRFRWVYPLRSKSAEHILLVFRKLVNF 723

Query: 286 LVTYFFTITKTPIYIESSTINRNDLIAMVQKIALKYDLRIGIGI----GNSSYFHYNGLE 341
           + T F T  K    ++  +  RN+L+          D  I  GI      ++    NG+ 
Sbjct: 724 IRTQFSTKVKA-FQMDRGSEYRNELLD---------DFFIDKGIKSIYNTAADSASNGVA 773

Query: 342 TMKQLLLLHEDECLGDWGMCLKYGKNLHNNLKNRKVLGMPI--NLLLNSGISEC 393
               LL L  ++C       L    NL NN+    V    +  N ++NS I++ 
Sbjct: 774 ERTNLLFL--NDC-----RTLLKATNLPNNMWYHAVEFATLIRNTMINSSINDS 820

>CAGL0J00693g Chr10 complement(61246..66900) [5655 bp, 1884 aa] {ON}
            similar to uniprot|P08964 Saccharomyces cerevisiae
            YHR023w MYO1
          Length = 1884

 Score = 38.1 bits (87), Expect = 0.053,   Method: Compositional matrix adjust.
 Identities = 26/101 (25%), Positives = 51/101 (50%), Gaps = 5/101 (4%)

Query: 66   KNLDELISESGLNKELFNRGHQDLAKFQSTINGYLSQ--RIYDLILTDKLTPKKVSREKV 123
            + ++EL + +    E+    + D  KF+ T+  Y  Q  ++   I   ++  KKV RE +
Sbjct: 1783 RTINELEARNASQVEVIETANGDRTKFEETVMKYNEQMHQLEKYISQQEIDMKKVVRENM 1842

Query: 124  KWANKSNE---KYYFLKNRYYVSDKGTTVRDRRNDDKILCP 161
            ++  K NE   +    K RY+V+  GT    +RN+++++  
Sbjct: 1843 EYQEKMNEMERELMLWKQRYHVASGGTNNFSQRNEEEVMVQ 1883

>NDAI0B06160 Chr2 (1494425..1498636) [4212 bp, 1403 aa] {ON} 
          Length = 1403

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 15/44 (34%), Positives = 23/44 (52%), Gaps = 2/44 (4%)

Query: 233 PFERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKK 276
           PFE IH ++F P     +    Y   +   D  +R+ W++PLKK
Sbjct: 375 PFEYIHTDLFGPVSGVDITSPKY--FISFTDENTRFRWVFPLKK 416

>NDAI0G00550 Chr7 complement(116985..118223) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score = 34.3 bits (77), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 29/63 (46%), Gaps = 5/63 (7%)

Query: 233 PFERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELT---QTLVTY 289
           PFE IH ++F P     +    Y   +   D  +R+ W++PLKK     +    Q LV Y
Sbjct: 290 PFEYIHTDLFGPVSGVDITSPKY--FISFTDENTRFRWVFPLKKKDADHILPIFQQLVNY 347

Query: 290 FFT 292
             T
Sbjct: 348 IKT 350

>Kpol_1037.34 s1037 (80237..84124) [3888 bp, 1295 aa] {ON}
           (80237..84124) [3888 nt, 1296 aa]
          Length = 1295

 Score = 34.3 bits (77), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 19/66 (28%), Positives = 30/66 (45%), Gaps = 9/66 (13%)

Query: 234 FERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKK-------TAFKELTQTL 286
           FE +H ++F P  +      TY   +   D  SR+ W++PL+        T F+ +  T 
Sbjct: 226 FEFLHTDLFGPVPNMPTSSPTY--FISFTDEQSRFRWVFPLRSKDASTVTTVFRNIVATF 283

Query: 287 VTYFFT 292
            T F T
Sbjct: 284 GTQFDT 289

>Smik_49.2 Chr49 (115..1764) [1650 bp, 550 aa] {ON} YNL054W-B
           (REPEAT)
          Length = 550

 Score = 33.9 bits (76), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 21/60 (35%), Positives = 31/60 (51%), Gaps = 6/60 (10%)

Query: 215 HVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPL 274
           HVK   + K  E YE   PF+ +H +IF P     L +   S+ +   D  +R+ W+YPL
Sbjct: 222 HVKG-SRLKYQESYE---PFQYLHTDIFGPV--HHLPKSAPSYFISFTDEKTRFQWVYPL 275

>SAKL0F06809g2 Chr6 (518357..519658,519660..523625) [5268 bp, 1755
           aa] {ON} Retrotransposon Gag and Pol genes
          Length = 1755

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 24/79 (30%), Positives = 38/79 (48%), Gaps = 10/79 (12%)

Query: 215 HVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPL 274
           HVK   + K  + YE   PF+ +H +IF P     L +   S+ +   D  +R+ W+YPL
Sbjct: 650 HVKG-SRVKYQDSYE---PFQYLHTDIFGPV--HNLPKSAPSYFITFTDEKTRFQWVYPL 703

Query: 275 KKTAFKELTQTLVTYFFTI 293
                    Q+++  F TI
Sbjct: 704 ----HDRREQSILEVFTTI 718

>Ecym_5175 Chr5 (360152..364384) [4233 bp, 1410 aa] {ON} Similar to
            Saccharomyces cerevisiae YGR109W-B Retrotransposon TYA
            Gag and TYB Pol genes; transcribed/translated as one
            unit; polyprotein is processed to make a
            nucleocapsid-like protein (Gag), reverse transcriptase
            (RT), protease (PR), and integrase (IN); similar to
            retroviral genes [Saccharomyces cerevisiae S288c]
          Length = 1410

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 52/243 (21%), Positives = 102/243 (41%), Gaps = 24/243 (9%)

Query: 155  DDKILCPPNKVLEVVLCTH---LINEHAAHKSVHRN--LHKRYANISRTITRISLLYCSF 209
            +++I+ P +KV EV+   H   L   H   ++ +    L+  +  +SR +    +  C+ 
Sbjct: 1133 ENRIIVPRSKVQEVLNIYHDHFLTGGHFGIEATYNKIALYYYWPKMSRDVKEY-VRTCTD 1191

Query: 210  CNPSEHVKPLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYV 269
            C   +H +P  + K   + +    ++ + ++      +     G    IL + D +S+Y 
Sbjct: 1192 CQIRKHHRPNSQGKIMPLPQATGRWKELSMDFLTGIPESV---GGNDMILVVVDRFSKYA 1248

Query: 270  WLYPLKKTAFKE-LTQTLVTYFFTITKTPIYIESSTINRNDLIAMVQKIALKYDLRIGIG 328
            W  P KKT   E + Q L    F+    P     + ++  D+    +K     +L  G+G
Sbjct: 1249 WFIPCKKTITGEQVFQLLAGNIFSHKGVP----DTLVSDRDIRFEGKKYQ---ELTKGLG 1301

Query: 329  I----GNSSYFHYNG-LETMKQLL--LLHEDECLGDWGMCLKYGKNLHNNLKNRKVLGMP 381
            I      + +   +G  E + Q L  LL +     +W   L + +  +NN  N+ +  MP
Sbjct: 1302 IKLLRSTAGHPQTDGQTERVMQPLTRLLKQYAQSPNWDTHLWHVQIAYNNAYNQAIKDMP 1361

Query: 382  INL 384
              +
Sbjct: 1362 ARV 1364

>SAKL0B11583g2 Chr2 (998260..999561,999563..1003528) [5268 bp, 1755
           aa] {ON} Retrotransposon Gag and Pol genes
          Length = 1755

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 6/61 (9%)

Query: 233 PFERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFT 292
           PF+ +H +IF P     L +   S+ +   D  +R+ W+YPL         Q+++  F T
Sbjct: 664 PFQYLHTDIFGPV--HNLPKSAPSYFITFTDEKTRFQWVYPL----HDRREQSILEVFTT 717

Query: 293 I 293
           I
Sbjct: 718 I 718

>SAKL0C11913g1 Chr3 complement(1069940..1073905,1073907..1075208)
           [5268 bp, 1755 aa] {ON} Retrotransposon Gag and Pol
           genes
          Length = 1755

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 18/61 (29%), Positives = 30/61 (49%), Gaps = 6/61 (9%)

Query: 233 PFERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFT 292
           PF+ +H +IF P     L +   S+ +   D  +R+ W+YPL         Q+++  F T
Sbjct: 664 PFQYLHTDIFGPV--HNLPKSAPSYFITFTDEKTRFQWVYPL----HDRREQSILEVFTT 717

Query: 293 I 293
           I
Sbjct: 718 I 718

>Suva_14.255 Chr14 complement(468747..469796) [1050 bp, 349 aa] {ON}
           YNL084C (REAL)
          Length = 349

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 37/149 (24%), Positives = 57/149 (38%), Gaps = 29/149 (19%)

Query: 167 EVVLCTHLINEHAAHKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVKPLKKSKKNE 226
           E V+C  LI                +  +++ I+ +      +  P   VK +K+ KK E
Sbjct: 64  EFVICMRLI----------------FDMVNKNISSVPDELPDWLVPGSKVKLIKERKKRE 107

Query: 227 VYEG--LLPFERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQ 284
             E   L P + I ++ +    D    E  YS    + D               F EL+ 
Sbjct: 108 QIENADLPPKKEIKVDWYMSPEDLDQYEKIYSSCAKLTD-----------GTITFNELST 156

Query: 285 TLVTYFFTITKTPIYIESSTINRNDLIAM 313
            L T FF I+KT +    S IN  DL ++
Sbjct: 157 KLSTKFFNISKTDLNKVWSLINPQDLPSV 185

>Skud_12.300 Chr12 complement(546310..547503) [1194 bp, 398 aa] {ON}
           YNL054W-B (REPEAT)
          Length = 398

 Score = 32.7 bits (73), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 15/46 (32%), Positives = 24/46 (52%), Gaps = 2/46 (4%)

Query: 229 EGLLPFERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPL 274
           E   PF+ +H +IF P     L +   S+ +   D  +R+ W+YPL
Sbjct: 228 ESYQPFQYLHTDIFGPV--HHLPKSAPSYFISFTDEKTRFKWVYPL 271

>TDEL0E00260 Chr5 complement(46841..49489,49491..50588) [3747 bp,
           1248 aa] {ON} 
          Length = 1248

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 46/218 (21%), Positives = 86/218 (39%), Gaps = 34/218 (15%)

Query: 133 YYFLKNRYYVSDKGTTVRDRRNDDKILCPPNKVLEVVLCTHLINEHAAHKSVHRNLHKRY 192
           Y++L ++Y +  + T ++   N        NKV   V   H +  H   KS+  ++  R 
Sbjct: 491 YFWLSSKYLIKPQKTIIQKANN-------VNKVKYSVDYLHRLFGHVNVKSIKDSIKDRS 543

Query: 193 -ANISRT---ITRISLLYCSFCNPSEHVKPLKKSKKNEVYEG-LLPFERIHIEIFKPFGD 247
            A I       T +    C  C   +  K          Y+    PF+ IH ++F P   
Sbjct: 544 IAGIEVDEVDWTNLEKFQCEICMMGKSTKGRHLMNSRLKYQKEYKPFQFIHTDLFGPV-- 601

Query: 248 EKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLVTYFFTITKTPIYIESSTINR 307
           +        ++L   D  +RY W++PL++      +Q++   F  + +   +IE+     
Sbjct: 602 QVTAVNVPRYLLAFTDECTRYKWVFPLREKD----SQSITARFSELVR---FIET----- 649

Query: 308 NDLIAMVQKIALKYDLRIGIGIGN---SSYFHYNGLET 342
                 ++   L + +  G    N   + +FH NG+ T
Sbjct: 650 -----QLETKVLCFQMDQGTEFTNKTITQFFHDNGIIT 682

>NCAS0G02330 Chr7 complement(413199..415172) [1974 bp, 657 aa] {ON} 
            retrotransposon
          Length = 657

 Score = 32.7 bits (73), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 55/282 (19%), Positives = 107/282 (37%), Gaps = 52/282 (18%)

Query: 108 ILTDKLT-PKKVSREKVKWANKSNEKYYFLKNRYYVSDKGTTVRDRRND-DKILCPPNKV 165
           IL+D  T P+K ++    +A  ++  YYFL    Y         DR  +  K+    ++V
Sbjct: 222 ILSDSATIPRKFTKVIKSFAIINDTLYYFLDGNLYNIINDAEYMDRATELHKLFHASHRV 281

Query: 166 LEVVLCT--------HLINEHAAHKSVHRNLHKRYANISRTITRISLLYCSFCNPSEHVK 217
           L+ ++ T         L+         H  +H+R+ ++  T+            PS    
Sbjct: 282 LKQMMLTDKIWSPNGELLTLDVTRTCRHCEVHQRFVDLPVTL------------PSIIKV 329

Query: 218 PLKKSKKNEVYEGLLPFERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKT 277
           P+              F R H++   P   + +    Y H L   DY S +V + P  + 
Sbjct: 330 PV--------------FSRWHLDFAGPLPKDNI----YRHFLIAVDYTSNFVVVQP-ARA 370

Query: 278 AFKELTQTLVTYFFTITKTPIYIESSTINRNDLIAMVQKIALKYDLRIGIGIGNSSYFHY 337
           A  +  + ++ +  ++   P      TI  ++  +   ++      ++GI   +SS +H 
Sbjct: 371 ADADTVKDMILHILSMFGKP-----DTIVTDNAKSFENQVVRPLTTKLGIKYLHSSVYHP 425

Query: 338 NGLE------TMKQLLLLHEDECLGDWGMCLKYGKNLHNNLK 373
            G         M + +L H      DW   + +  N+ N+ +
Sbjct: 426 RGNSKAERSVQMVKKVLSHIHPNYKDWSSNIYWAGNIVNSTR 467

>KNAG0C06675 Chr3 complement(1300967..1301815) [849 bp, 282 aa] {ON}
          Length = 282

 Score = 31.6 bits (70), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 4/62 (6%)

Query: 228 YEGLLPFERIHIEIFKPFGDEKLIEGTYSHILYIRDYYSRYVWLYPLKKTAFKELTQTLV 287
           ++   P + + +++   F  E+ ++      L IRD YSRY ++ PLK  A    TQ L+
Sbjct: 83  FKATAPLQLVQVDLCGGFRYEEYVDS--KCFLTIRDSYSRYYFVIPLKNKA--AATQALI 138

Query: 288 TY 289
            +
Sbjct: 139 NW 140

>Kwal_33.13961 s33 (464777..465904) [1128 bp, 375 aa] {ON} YJL146W
           (IDS2) - (putative) involved in meiosis [contig 108]
           FULL
          Length = 375

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 20/39 (51%)

Query: 108 ILTDKLTPKKVSREKVKWANKSNEKYYFLKNRYYVSDKG 146
           I T + TPK   RE V  +  S   Y  LK+ Y +SD G
Sbjct: 32  ISTPRGTPKSSGRESVSTSTGSPVDYQLLKHHYAISDDG 70

>Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON}
           (30724..33018) [2295 nt, 765 aa]
          Length = 764

 Score = 31.2 bits (69), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 24/73 (32%), Positives = 40/73 (54%), Gaps = 6/73 (8%)

Query: 360 MCLKY---GKNLHNNLKNRKVLGMPINLL--LNSGISECSIKYKSKKNTVIDETFPHNMI 414
           +CL +   GKNL+  LK  +  G+ I+L+  ++S + +C    K  K    D   P N++
Sbjct: 451 LCLVFEVLGKNLYEVLKQNRFHGLTISLIRKISSQLLDCLCMLKDNKIVHCDLK-PENIL 509

Query: 415 VLDNGKSEIYLED 427
           +  +GKSEI + D
Sbjct: 510 LTGSGKSEIKVID 522

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.136    0.397 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,342,895
Number of extensions: 2387952
Number of successful extensions: 7361
Number of sequences better than 10.0: 59
Number of HSP's gapped: 7559
Number of HSP's successfully gapped: 59
Length of query: 457
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 344
Effective length of database: 40,524,141
Effective search space: 13940304504
Effective search space used: 13940304504
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)