Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_392.58.263ON51251225400.0
NCAS0B050208.263ON56849018480.0
TDEL0F039008.263ON55948918330.0
YLR089C (ALT1)8.263ON59248718290.0
Skud_12.1578.263ON59248918210.0
Smik_12.1488.263ON59248718180.0
KLLA0F19162g8.263ON52848717980.0
Suva_10.1738.263ON59248718010.0
KNAG0G020408.263ON59148817980.0
NDAI0B019908.263ON58848617780.0
ZYRO0C01628g8.263ON53448817620.0
CAGL0L12254g8.263ON57449517600.0
TPHA0J007508.263ON52249217320.0
SAKL0H17006g8.263ON53148517260.0
KAFR0B027308.263ON53949116880.0
TBLA0E044408.263ON56248416860.0
KLTH0G13662g8.263ON51948316670.0
Smik_4.3578.263ON50748916590.0
Skud_4.3728.263ON50748616550.0
KAFR0B055308.263ON51449016460.0
Kwal_56.237918.263ON51848216420.0
YDR111C (ALT2)8.263ON50748616350.0
Suva_2.2718.263ON50748616120.0
KNAG0M012108.263ON52148616000.0
NCAS0B038408.263ON49748515810.0
NDAI0J013608.263ON50149015700.0
KAFR0B05520singletonON51049015650.0
Kpol_543.398.263ON49248715510.0
TPHA0A018008.263ON49849415400.0
AGR085W8.263ON52148415150.0
Ecym_43078.263ON53448415150.0
TBLA0F030608.263ON50049115010.0
TBLA0G01630singletonON50049314220.0
TPHA0O014501.321ON4431841331e-07
Kwal_34.160181.472ON3791691322e-07
ZYRO0G20636g1.321ON4533701312e-07
Suva_6.1361.321ON4442011294e-07
Skud_10.1561.321ON4602011269e-07
KLTH0G19646g1.472ON3791521251e-06
NDAI0G057601.321ON4483921251e-06
YJL060W (BNA3)1.321ON4442011214e-06
Smik_10.1801.321ON4442011188e-06
KNAG0B053201.321ON4332011171e-05
KLLA0F10021g3.511ON4972161161e-05
CAGL0J05126g1.321ON4333921152e-05
Kpol_1035.231.321ON4441991134e-05
Kwal_14.25741.321ON443681124e-05
TDEL0D019001.321ON4432021125e-05
NDAI0B045502.102ON5651621081e-04
SAKL0D11528g1.472ON3831531062e-04
AEL170C1.321ON458761053e-04
SAKL0F02156g3.511ON4981521054e-04
Ecym_62921.321ON4302271045e-04
ADL249W2.252ON3871781026e-04
KAFR0A017101.321ON4352011036e-04
KLTH0H10648g1.321ON443721028e-04
Ecym_6319singletonON3542251019e-04
SAKL0D06886g1.321ON4472011000.001
NCAS0A092001.321ON4453831000.001
KNAG0B006603.511ON4961551000.001
Kpol_278.23.511ON498156980.002
Kpol_1035.302.102ON501159980.002
NCAS0G040501.472ON384166960.004
NCAS0E006703.511ON497166960.005
KLLA0F03509g2.252ON387124950.005
AFR548C3.511ON497152950.005
Kpol_1039.222.252ON386158940.005
TPHA0D033703.511ON497122940.006
KAFR0D014203.511ON492157930.009
KNAG0E018502.252ON384125920.010
NDAI0I028303.511ON500122930.010
YHR137W (ARO9)2.102ON513271910.015
TDEL0A016008.204ON475187910.017
KLLA0F01617g1.321ON444186900.018
KNAG0G005501.472ON38765900.019
SAKL0E12188g2.102ON530187900.021
Ecym_32902.252ON386122890.027
TPHA0O015202.102ON50344880.036
SAKL0E08492g2.252ON384125880.036
CAGL0G01254g3.511ON504122880.039
NCAS0B072202.102ON51044880.042
Skud_8.1982.102ON517166880.042
KLTH0G09614g2.252ON389125850.079
Kpol_480.11.472ON380167840.098
Kpol_1032.398.204ON453190840.099
Smik_7.693.511ON500122840.10
YIL116W (HIS5)2.252ON385126840.11
KLLA0A04906gna 1ON480160840.12
Kwal_47.189823.511ON49691840.13
Kwal_23.48882.252ON389125820.17
ZYRO0C06028g3.511ON496158820.21
Smik_8.2182.102ON513265820.22
NDAI0B037302.252ON386126810.24
KLTH0G02002g3.511ON49657810.24
Suva_5.2818.204ON45097810.25
Smik_5.3198.204ON44370810.26
SAKL0H18612g8.204ON445191810.28
KLTH0G19624gsingletonON46832800.36
KLTH0B06270g2.102ON525131800.36
KLLA0E00969g8.204ON44532800.36
KLTH0B00176g8.204ON44832790.39
ZYRO0G05346g2.102ON50444790.43
ZYRO0B11088g8.204ON45033780.53
CAGL0I06578g8.204ON43633780.61
ZYRO0A01672g2.252ON386148770.79
KAFR0J015802.252ON383126770.82
Suva_15.3342.102ON560269770.88
NCAS0B064402.252ON385144760.99
NDAI0C059608.204ON47867761.1
YER152C8.204ON44333761.1
Suva_7.613.511ON500122761.2
TDEL0D057903.511ON49758761.2
AGR141C8.204ON43832751.2
KNAG0G016808.204ON45233751.2
Ecym_55428.204ON44638751.4
KLTH0E07678gna 1ON492189741.6
Skud_7.693.511ON500122741.6
Suva_10.2098.314ON22776731.8
YGL202W (ARO8)3.511ON500122741.9
Skud_5.2908.204ON44333742.0
TPHA0F012602.252ON392122732.2
KLTH0D05478g2.475ON421199722.6
NCAS0A038308.204ON44632722.7
Smik_4.7045.541ON98982733.0
TDEL0C040902.252ON38354713.7
Kwal_47.17462na 1ON492122713.8
Ecym_83654.53ON44453713.8
Skud_12.1908.314ON22731694.8
NDAI0D028804.53ON44763704.9
YLR118C8.314ON22731695.0
Suva_16.4033.372ON68028705.7
Kwal_8.5858.204ON44655705.8
Smik_16.3183.372ON68028705.8
Suva_9.782.252ON386127697.0
KLLA0D11110g2.102ON53044689.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_392.5
         (512 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)...   983   0.0  
NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {O...   716   0.0  
TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {O...   710   0.0  
YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON} ...   709   0.0  
Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {...   706   0.0  
Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {...   704   0.0  
KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]...   697   0.0  
Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {...   698   0.0  
KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {O...   697   0.0  
NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {O...   689   0.0  
ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} simila...   683   0.0  
CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa...   682   0.0  
TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {...   671   0.0  
SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} high...   669   0.0  
KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {O...   654   0.0  
TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa] ...   654   0.0  
KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} simi...   646   0.0  
Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON...   643   0.0  
Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON...   642   0.0  
KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON}            638   0.0  
Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089...   637   0.0  
YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}  ...   634   0.0  
Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON...   625   0.0  
KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8....   620   0.0  
NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.2...   613   0.0  
NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8....   609   0.0  
KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON} Anc_8...   607   0.0  
Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}...   602   0.0  
TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.2...   597   0.0  
AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic ho...   588   0.0  
Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar t...   588   0.0  
TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.2...   582   0.0  
TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON}              552   0.0  
TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {...    56   1e-07
Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060...    55   2e-07
ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]...    55   2e-07
Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON...    54   4e-07
Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {...    53   9e-07
KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]...    53   1e-06
NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON} Anc_1...    53   1e-06
YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}  BNA3Kynur...    51   4e-06
Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060...    50   8e-06
KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON} Anc_1...    50   1e-05
KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} simila...    49   1e-05
CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa] ...    49   2e-05
Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {O...    48   4e-05
Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {O...    48   4e-05
TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.3...    48   5e-05
NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON} Anc_2...    46   1e-04
SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {...    45   2e-04
AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON} S...    45   3e-04
SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly...    45   4e-04
Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar t...    45   5e-04
ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic ho...    44   6e-04
KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {O...    44   6e-04
KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {...    44   8e-04
Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}...    44   9e-04
SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {...    43   0.001
NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa] ...    43   0.001
KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.5...    43   0.001
Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)...    42   0.002
Kpol_1035.30 s1035 (69909..71414) [1506 bp, 501 aa] {ON} (69909....    42   0.002
NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {O...    42   0.004
NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511     42   0.005
KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} simila...    41   0.005
AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}...    41   0.005
Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON} (68736....    41   0.005
TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {O...    41   0.006
KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.5...    40   0.009
KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.2...    40   0.010
NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {O...    40   0.010
YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromat...    40   0.015
TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.2...    40   0.017
KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {...    39   0.018
KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472       39   0.019
SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} simi...    39   0.021
Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar t...    39   0.027
TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2....    39   0.036
SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {...    39   0.036
CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly...    39   0.039
NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON} Anc_2...    39   0.042
Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W ...    39   0.042
KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} simila...    37   0.079
Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357) [...    37   0.098
Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {O...    37   0.099
Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W (...    37   0.10 
YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}  HIS5Histid...    37   0.11 
KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} simila...    37   0.12 
Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]...    37   0.13 
Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W...    36   0.17 
ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly...    36   0.21 
Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W ...    36   0.22 
NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {O...    36   0.24 
KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly...    36   0.24 
Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON...    36   0.25 
Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON...    36   0.26 
SAKL0H18612g Chr8 (1655787..1657124) [1338 bp, 445 aa] {ON} high...    36   0.28 
KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]...    35   0.36 
KLTH0B06270g Chr2 (508642..510219) [1578 bp, 525 aa] {ON} simila...    35   0.36 
KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} simila...    35   0.36 
KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar ...    35   0.39 
ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {...    35   0.43 
ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {...    35   0.53 
CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} simila...    35   0.61 
ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly...    34   0.79 
KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {...    34   0.82 
Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137...    34   0.88 
NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa] ...    34   0.99 
NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa] ...    34   1.1  
YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON} P...    34   1.1  
Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W (...    34   1.2  
TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa] ...    34   1.2  
AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}...    33   1.2  
KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {O...    33   1.2  
Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar...    33   1.4  
KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} simila...    33   1.6  
Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W (...    33   1.6  
Suva_10.209 Chr10 complement(392668..393351) [684 bp, 227 aa] {O...    33   1.8  
YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromat...    33   1.9  
Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON...    33   2.0  
TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {O...    33   2.2  
KLTH0D05478g Chr4 (488881..490146) [1266 bp, 421 aa] {ON} simila...    32   2.6  
NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204     32   2.7  
Smik_4.704 Chr4 complement(1246246..1249215) [2970 bp, 989 aa] {...    33   3.0  
TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {O...    32   3.7  
Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202...    32   3.8  
Ecym_8365 Chr8 complement(732418..733752) [1335 bp, 444 aa] {ON}...    32   3.8  
Skud_12.190 Chr12 complement(367635..368318) [684 bp, 227 aa] {O...    31   4.8  
NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53      32   4.9  
YLR118C Chr12 complement(384725..385408) [684 bp, 227 aa] {ON} A...    31   5.0  
Suva_16.403 Chr16 complement(700071..702113) [2043 bp, 680 aa] {...    32   5.7  
Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C - Hy...    32   5.8  
Smik_16.318 Chr16 complement(569893..571935) [2043 bp, 680 aa] {...    32   5.8  
Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W (...    31   7.0  
KLLA0D11110g Chr4 (948248..949840) [1593 bp, 530 aa] {ON} simila...    31   9.0  

>Kpol_392.5 s392 (6873..8411) [1539 bp, 512 aa] {ON} (6873..8411)
           [1539 nt, 513 aa]
          Length = 512

 Score =  983 bits (2540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/512 (93%), Positives = 479/512 (93%)

Query: 1   MLRSGNCXXXXXXXXXXXXXXXXXXXYEHKHNVYPAQKLRMDDLNKNVLKAKYAVRGSIP 60
           MLRSGNC                   YEHKHNVYPAQKLRMDDLNKNVLKAKYAVRGSIP
Sbjct: 1   MLRSGNCSISLVRRVGVRRLTLSTTLYEHKHNVYPAQKLRMDDLNKNVLKAKYAVRGSIP 60

Query: 61  LRAEELKLYLEAGQKLPFDTVINANIGNPQQLKQKPLTFYRQVLSILQYPELLESGSNIF 120
           LRAEELKLYLEAGQKLPFDTVINANIGNPQQLKQKPLTFYRQVLSILQYPELLESGSNIF
Sbjct: 61  LRAEELKLYLEAGQKLPFDTVINANIGNPQQLKQKPLTFYRQVLSILQYPELLESGSNIF 120

Query: 121 KKDAIERARKLLKEIGSVGSYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASS 180
           KKDAIERARKLLKEIGSVGSYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASS
Sbjct: 121 KKDAIERARKLLKEIGSVGSYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASS 180

Query: 181 AVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVI 240
           AVDYLLSILCKNEKSGVLIPIPQYP              PYYLDESKGWSTDINEIEEVI
Sbjct: 181 AVDYLLSILCKNEKSGVLIPIPQYPLYTATLALNNAHALPYYLDESKGWSTDINEIEEVI 240

Query: 241 NDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAK 300
           NDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAK
Sbjct: 241 NDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAK 300

Query: 301 FHSMKKVLRNLQKAFPGEYDTVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILK 360
           FHSMKKVLRNLQKAFPGEYDTVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILK
Sbjct: 301 FHSMKKVLRNLQKAFPGEYDTVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILK 360

Query: 361 LCSISLCPVVTGQALVDLMVSPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEG 420
           LCSISLCPVVTGQALVDLMVSPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEG
Sbjct: 361 LCSISLCPVVTGQALVDLMVSPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEG 420

Query: 421 VSCQKPEGAMYLFPKIDLPFKVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPG 480
           VSCQKPEGAMYLFPKIDLPFKVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPG
Sbjct: 421 VSCQKPEGAMYLFPKIDLPFKVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPG 480

Query: 481 TYHLRTTFLAPGTEWIDRWNKFHAEFYDKYRD 512
           TYHLRTTFLAPGTEWIDRWNKFHAEFYDKYRD
Sbjct: 481 TYHLRTTFLAPGTEWIDRWNKFHAEFYDKYRD 512

>NCAS0B05020 Chr2 complement(931456..933162) [1707 bp, 568 aa] {ON} 
          Length = 568

 Score =  716 bits (1848), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/490 (69%), Positives = 404/490 (82%), Gaps = 8/490 (1%)

Query: 31  HNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYL-EAGQKLPFDTVINANIGNP 89
           +N  PA +L + +LN NVLKAKYAVRG+IP+RAEELK+ L E    LPFD ++NANIGNP
Sbjct: 79  NNFLPADQLTLAELNDNVLKAKYAVRGAIPMRAEELKIQLQEDPSSLPFDHIVNANIGNP 138

Query: 90  QQLKQKPLTFYRQVLSILQYPELLES------GSNIFKKDAIERARKLLKEIG-SVGSYS 142
           QQL QKPL+FYRQVLS+LQYPE+L+        S +FKKDA+ERA+ LL EIG +VG+YS
Sbjct: 139 QQLNQKPLSFYRQVLSLLQYPEILKQDESKLVASGLFKKDALERAKTLLHEIGGTVGAYS 198

Query: 143 SSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIP 202
           +SQG+  IRKTVANFITKRD+GE + P DIFLTAGAS+AV YLLSILCK  ++GVLIPIP
Sbjct: 199 ASQGVYGIRKTVANFITKRDNGEPAYPEDIFLTAGASAAVMYLLSILCKGPETGVLIPIP 258

Query: 203 QYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPT 262
           QYP              PYYLDE  GWST+  EIEEV+  + DK I+P+ LV+INPGNPT
Sbjct: 259 QYPLYTASLALNNSHALPYYLDEKSGWSTNPKEIEEVVLAAKDKKIRPSVLVVINPGNPT 318

Query: 263 GSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTV 322
           G++LS +S+E I E+AA +GIV+IADEVYQENVFN  KFHSMKKVLRNLQK  PG YD V
Sbjct: 319 GAVLSEKSIEHIFEIAAKYGIVVIADEVYQENVFNEVKFHSMKKVLRNLQKKHPGVYDMV 378

Query: 323 QLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSP 382
           QLASLHSTSKGVSGECGQRGGYMELTGF  E++ VILKL SISLCPVVTGQALVDLMVSP
Sbjct: 379 QLASLHSTSKGVSGECGQRGGYMELTGFTHEVRSVILKLASISLCPVVTGQALVDLMVSP 438

Query: 383 PQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKV 442
           P+KGDES+EQDQ ER  I ++L  RA+ L++ FN++EG+ CQKP+GAMYLFP++DLPFK 
Sbjct: 439 PKKGDESFEQDQAERKHIKSELHTRAMQLYKNFNTLEGIECQKPQGAMYLFPRLDLPFKA 498

Query: 443 LQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKF 502
           +QK+Q L+++PDEFYCK+LLEATGICTVPGSGFGQ+PGTYHLRTTFLAPGTEWI++W  F
Sbjct: 499 VQKAQHLEMSPDEFYCKSLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIEKWKIF 558

Query: 503 HAEFYDKYRD 512
           H +FY+ YRD
Sbjct: 559 HQDFYNTYRD 568

>TDEL0F03900 Chr6 complement(726159..727838) [1680 bp, 559 aa] {ON}
           Anc_8.263 YDR111C
          Length = 559

 Score =  710 bits (1833), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/489 (68%), Positives = 400/489 (81%), Gaps = 8/489 (1%)

Query: 32  NVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG-QKLPFDTVINANIGNPQ 90
           + YPA+ L + DLN+NVLKAKYAVRGSIP+RAEEL+  L+     LPFD ++NANIGNPQ
Sbjct: 71  DFYPAESLTVRDLNENVLKAKYAVRGSIPMRAEELQEQLKRDPSSLPFDKIVNANIGNPQ 130

Query: 91  QLKQKPLTFYRQVLSILQYPELLESGS------NIFKKDAIERARKLLKEIG-SVGSYSS 143
           QL QKPL+FYRQVLSILQYPE+LE G        +FK+DAIERA+++L+++G SVG+YSS
Sbjct: 131 QLNQKPLSFYRQVLSILQYPEVLEQGEEELISKGVFKRDAIERAKRILRDVGGSVGAYSS 190

Query: 144 SQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQ 203
           SQG+  IRKTVA+FIT+RD GE + P DIFLTAGAS+AV YLLSILC+ +++GVLIPIPQ
Sbjct: 191 SQGVYGIRKTVADFITERDSGEPAYPEDIFLTAGASAAVSYLLSILCRGQETGVLIPIPQ 250

Query: 204 YPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTG 263
           YP              PYYLDE  GWST+  EIE V+ +S++ GI+P+ LV+INPGNPTG
Sbjct: 251 YPLYTATLALNNSHVLPYYLDEESGWSTNTAEIEGVVTESIESGIRPSVLVVINPGNPTG 310

Query: 264 SILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQ 323
           S+LSVE++EKI +VAA +GIV+IADEVYQEN+F  ++FHSMKKVLR LQK  PG YD VQ
Sbjct: 311 SVLSVEAIEKIFQVAAKYGIVVIADEVYQENIFAGSEFHSMKKVLRQLQKEHPGIYDNVQ 370

Query: 324 LASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPP 383
           L SLHSTSKGVSGECGQRGGYMELTGF  EI+QV+LKL SISLCPVVTGQALVDLMV PP
Sbjct: 371 LVSLHSTSKGVSGECGQRGGYMELTGFTHEIRQVVLKLASISLCPVVTGQALVDLMVCPP 430

Query: 384 QKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVL 443
           + GDESYEQD+ ER  I  +L +RA LL + FNS+EG+ CQKP GAMYLFP+I LP+K +
Sbjct: 431 KPGDESYEQDRKEREMIHEELDHRAGLLHDTFNSLEGIECQKPRGAMYLFPQIKLPYKAI 490

Query: 444 QKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFH 503
           Q +Q L+ TPDEFYC+ LLEATGICTVPGSGFGQ+PGTYHLRTTFLAPGTEWI +W  FH
Sbjct: 491 QAAQHLEKTPDEFYCQKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEDFH 550

Query: 504 AEFYDKYRD 512
            +FYD+YRD
Sbjct: 551 KKFYDQYRD 559

>YLR089C Chr12 complement(318237..320015) [1779 bp, 592 aa] {ON}
           ALT1Alanine transaminase (glutamic pyruvic
           transaminase); involved in alanine biosynthetic and
           catabolic processes; the authentic, non-tagged protein
           is detected in highly purified mitochondria in
           high-throughput studies
          Length = 592

 Score =  709 bits (1829), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/487 (68%), Positives = 402/487 (82%), Gaps = 8/487 (1%)

Query: 34  YPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG-QKLPFDTVINANIGNPQQL 92
           YPA++L ++D+N+NVLKAKYAVRG+IP+RAEELK  LE   Q LPFD +INANIGNPQQL
Sbjct: 106 YPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDRIINANIGNPQQL 165

Query: 93  KQKPLTFYRQVLSILQYPELLESG------SNIFKKDAIERARKLLKEIG-SVGSYSSSQ 145
           +QKPLT+YRQVLS+LQYPELL         S +FK DAI+RA+ L+++IG SVG+YSSSQ
Sbjct: 166 QQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSSSQ 225

Query: 146 GIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYP 205
           G+  IRK+VA FITKRD+GEIS P DIFLTAGAS+AV+YLLSI C+  ++GVLIPIPQYP
Sbjct: 226 GVEGIRKSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYP 285

Query: 206 XXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSI 265
                         PYYLDE+ GWST+  EIE V+ +++   IKPT LV+INPGNPTG++
Sbjct: 286 LYTATLALNNSQALPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAV 345

Query: 266 LSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLA 325
           LS ES+ +I EVAA +G V+IADEVYQEN+F   KFHSMKK+LR+LQ+  PG++D VQLA
Sbjct: 346 LSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLA 405

Query: 326 SLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQK 385
           SLHSTSKGVSGECGQRGGYMELTGF+ E++QVILKL SISLCPVVTGQALVDLMV PP +
Sbjct: 406 SLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVE 465

Query: 386 GDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQK 445
           G+ES+E DQ ER++I   L  RA+ L+E FNS+EG+ CQKP+GAMYLFPKIDLPFK +Q+
Sbjct: 466 GEESFESDQAERNSIHEKLITRAMTLYETFNSLEGIECQKPQGAMYLFPKIDLPFKAVQE 525

Query: 446 SQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAE 505
           ++ L++TPDEFYCK LLE+TGICTVPGSGFGQ+PGTYHLRTTFLAPG EWI +W  FH E
Sbjct: 526 ARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWESFHKE 585

Query: 506 FYDKYRD 512
           F+D+YRD
Sbjct: 586 FFDQYRD 592

>Skud_12.157 Chr12 complement(301427..303205) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  706 bits (1821), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/489 (67%), Positives = 402/489 (82%), Gaps = 8/489 (1%)

Query: 32  NVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG-QKLPFDTVINANIGNPQ 90
           + YPA++L ++D+N+NVLKAKYAVRG+IP+RAEELK  LE   Q LPFD +INANIGNPQ
Sbjct: 104 DFYPAEQLTLEDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFDKIINANIGNPQ 163

Query: 91  QLKQKPLTFYRQVLSILQYPELLESG------SNIFKKDAIERARKLLKEIG-SVGSYSS 143
           QL+QKPLT+YRQVLS+LQYPELL         S +FK DAI+RA+ L+++IG SVG+YSS
Sbjct: 164 QLQQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEDIGGSVGAYSS 223

Query: 144 SQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQ 203
           SQG+  IRK+VA FITKRDDGEIS P DIFLTAGAS+AV+YLLSI C+  ++GVLIPIPQ
Sbjct: 224 SQGVEGIRKSVAEFITKRDDGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQ 283

Query: 204 YPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTG 263
           YP              PYYLDE  GWST+  EIE V+ +++   IKPT LV+INPGNPTG
Sbjct: 284 YPLYTATLALNNSQALPYYLDEQSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTG 343

Query: 264 SILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQ 323
           ++LS ES+ +I EVAA +G V+IADEVYQEN+F   KFHSMKK+LR LQ+  PG++D VQ
Sbjct: 344 AVLSPESVSQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRTLQREHPGKFDNVQ 403

Query: 324 LASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPP 383
           LASLHSTSKGVSGECGQRGGYMELTGF+ E++QVILKL SISLCPVVTGQALVDLMV PP
Sbjct: 404 LASLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPP 463

Query: 384 QKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVL 443
            +G+ES+E DQ ER++I   L  RA+ L++ FNS+EG+ CQKP+GAMYLFPKIDLPFK +
Sbjct: 464 VEGEESFELDQAERNSIHEKLITRAMTLYDTFNSLEGIECQKPQGAMYLFPKIDLPFKAV 523

Query: 444 QKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFH 503
           Q+++ L++TPDEFYCK+LLE+TGICTVPGSGFGQ+PGTYHLRTTFLAPG EWI +W  FH
Sbjct: 524 QEARHLELTPDEFYCKSLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFH 583

Query: 504 AEFYDKYRD 512
            EF+D+YRD
Sbjct: 584 KEFFDQYRD 592

>Smik_12.148 Chr12 complement(298127..299905) [1779 bp, 592 aa] {ON}
           YLR089C (REAL)
          Length = 592

 Score =  704 bits (1818), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/487 (67%), Positives = 401/487 (82%), Gaps = 8/487 (1%)

Query: 34  YPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG-QKLPFDTVINANIGNPQQL 92
           YPA++L +DD+N+NVLKAKYAVRG+IP+RAEELK  LE   Q LPF+ +INANIGNPQQL
Sbjct: 106 YPAEQLTLDDVNENVLKAKYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQL 165

Query: 93  KQKPLTFYRQVLSILQYPELLESG------SNIFKKDAIERARKLLKEIG-SVGSYSSSQ 145
           +QKPLT+YRQVLS+LQYPELL         S +FK DAI+RA+ L++EIG SVG+YSSSQ
Sbjct: 166 QQKPLTYYRQVLSLLQYPELLNQNEQQLVDSKLFKLDAIKRAKSLMEEIGGSVGAYSSSQ 225

Query: 146 GIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYP 205
           G+  IR++VA FITKRD+GEIS P DIFLTAGAS+AV+YLLSI C+  ++GVLIPIPQYP
Sbjct: 226 GVEGIRRSVAEFITKRDEGEISYPEDIFLTAGASAAVNYLLSIFCRGPETGVLIPIPQYP 285

Query: 206 XXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSI 265
                         PYYLDES GWST+  EIE V+ ++++  IK T LV+INPGNPTG++
Sbjct: 286 LYTATLALNNSQALPYYLDESSGWSTNPEEIETVVKEAIENEIKSTVLVVINPGNPTGAV 345

Query: 266 LSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLA 325
           LS ES+ +I EVAA +G V+IADEVYQEN+F   KFHSMKK+LR+LQ+  PG++D VQLA
Sbjct: 346 LSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTKFHSMKKILRHLQREHPGKFDNVQLA 405

Query: 326 SLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQK 385
           SLHSTSKGVSGECGQRGGYMELTGF+ E++QVILKL SISLCPVVTGQALVDLMV PP +
Sbjct: 406 SLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPLE 465

Query: 386 GDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQK 445
           G+ES+E DQ ER++I   L  RA+ L++ FNS+EG+ CQKP+GAMYLFPKIDLPF+ +Q+
Sbjct: 466 GEESFESDQAERNSIHEKLITRAMTLYKTFNSLEGIECQKPQGAMYLFPKIDLPFRAVQE 525

Query: 446 SQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAE 505
           ++ L++TPDEFYCK LLE+TGICTVPGSGFGQ+PGTYHLRTTFLAPG EWI +W  FH E
Sbjct: 526 ARHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGLEWIKKWETFHKE 585

Query: 506 FYDKYRD 512
           F+D YRD
Sbjct: 586 FFDHYRD 592

>KLLA0F19162g Chr6 complement(1775240..1776826) [1587 bp, 528 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089C ALT1 putative alanine transaminase (glutamyc
           pyruvic transaminase)
          Length = 528

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/487 (68%), Positives = 396/487 (81%), Gaps = 6/487 (1%)

Query: 32  NVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG-QKLPFDTVINANIGNPQ 90
            V PA KL +DD+N+NVLKAKYAVRG IP+RAEEL+  L+     LPF  +I+ANIGNPQ
Sbjct: 42  TVKPAPKLSLDDVNENVLKAKYAVRGRIPMRAEELRDQLKKDPSSLPFSKIISANIGNPQ 101

Query: 91  QLKQKPLTFYRQVLSILQYPELLESG----SNIFKKDAIERARKLLKEIG-SVGSYSSSQ 145
           QL QKPLTFYR+VLS+LQ+PELLE        ++K D+I+RA++LL E+G SVG+YS SQ
Sbjct: 102 QLDQKPLTFYREVLSLLQHPELLEEADEALQTLYKTDSIKRAKRLLSEVGGSVGAYSQSQ 161

Query: 146 GIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYP 205
           G+  IR+TVA+FITKRDDGEIS P DI+LTAGAS+AV Y+LSILCK   +GVLIPIPQYP
Sbjct: 162 GVQGIRETVADFITKRDDGEISYPEDIYLTAGASAAVSYILSILCKGPNTGVLIPIPQYP 221

Query: 206 XXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSI 265
                         PYYL E + WSTD  EIE+V+ D++ KGIKPT LV+INPGNPTG+I
Sbjct: 222 LYTASLALNNSRPLPYYLREEQNWSTDPEEIEQVVLDAIQKGIKPTCLVVINPGNPTGAI 281

Query: 266 LSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLA 325
           LS +S++KI EVAA +GIV+IADEVYQENVF  +KF+SMKKVLRNLQK + G+YD +QLA
Sbjct: 282 LSEQSIQKIFEVAAKYGIVVIADEVYQENVFKGSKFYSMKKVLRNLQKTYHGQYDNIQLA 341

Query: 326 SLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQK 385
           SLHSTSKGVSGECGQRGGYMEL GFN +I+QV LKL SISLCPVVTGQALVDLMVSPPQ 
Sbjct: 342 SLHSTSKGVSGECGQRGGYMELVGFNHDIRQVFLKLASISLCPVVTGQALVDLMVSPPQP 401

Query: 386 GDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQK 445
           GDESYEQDQ ER  I + L  RA  L+E F+ +EG+ C+KP+GAMYL+PK+DLP+KV+Q+
Sbjct: 402 GDESYEQDQQEREDIHDALDERASKLFETFSRLEGIECRKPQGAMYLYPKLDLPYKVIQE 461

Query: 446 SQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAE 505
           +Q L++ PDEFYCKALLE TGICTVPGSGFGQ PGTYHLRTTFL PGTEW++ W KFH  
Sbjct: 462 AQHLEMEPDEFYCKALLENTGICTVPGSGFGQVPGTYHLRTTFLPPGTEWVETWEKFHKA 521

Query: 506 FYDKYRD 512
           F+DKYRD
Sbjct: 522 FFDKYRD 528

>Suva_10.173 Chr10 complement(323066..324844) [1779 bp, 592 aa] {ON}
           YDR111C (REAL)
          Length = 592

 Score =  698 bits (1801), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/487 (67%), Positives = 401/487 (82%), Gaps = 8/487 (1%)

Query: 34  YPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG-QKLPFDTVINANIGNPQQL 92
           YPA++L +DD+N+NVLKA+YAVRG+IP+RAEELK  LE   Q LPF+ +INANIGNPQQL
Sbjct: 106 YPAEQLTLDDVNENVLKARYAVRGAIPMRAEELKAQLEKDPQSLPFNKIINANIGNPQQL 165

Query: 93  KQKPLTFYRQVLSILQYPELLES------GSNIFKKDAIERARKLLKEIG-SVGSYSSSQ 145
           +QKPLT+YRQVLS+LQYPELL        GS +FK DAI+RA+ L+K+IG SVG+YSSSQ
Sbjct: 166 QQKPLTYYRQVLSLLQYPELLNHNEQELVGSKLFKIDAIKRAKSLIKDIGGSVGAYSSSQ 225

Query: 146 GIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYP 205
           G+  IRK+VA+FITKRD GE + P DIFLTAGAS+AV YLLSI C+  ++GVLIPIPQYP
Sbjct: 226 GVEGIRKSVADFITKRDGGETAYPEDIFLTAGASAAVTYLLSIFCRGPETGVLIPIPQYP 285

Query: 206 XXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSI 265
                         PYYLDE+ GWST+  EIE V+ +++   IKPT LV+INPGNPTG++
Sbjct: 286 LYTATLALNNSQPLPYYLDENSGWSTNPEEIETVVKEAIQNEIKPTVLVVINPGNPTGAV 345

Query: 266 LSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLA 325
           LS ES+ +I EVAA +G V+IADEVYQEN+F   +F+SMKKVLR+LQ+  PG++D VQLA
Sbjct: 346 LSPESIAQIFEVAAKYGTVVIADEVYQENIFPGTEFNSMKKVLRHLQRDHPGKFDNVQLA 405

Query: 326 SLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQK 385
           SLHSTSKGVSGECGQRGGYMELTGF+ E++QVILKL SISLCPVVTGQALVDLMV PP +
Sbjct: 406 SLHSTSKGVSGECGQRGGYMELTGFSHEMRQVILKLASISLCPVVTGQALVDLMVRPPVE 465

Query: 386 GDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQK 445
           G+ES+E DQ ER++I   L+ RA+ L+E FNS+EG+ CQKP+GAMYLFPKID+PFK +Q+
Sbjct: 466 GEESFESDQSERNSIHEKLNTRAMTLYETFNSLEGIECQKPQGAMYLFPKIDVPFKAIQE 525

Query: 446 SQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAE 505
           +  L++TPDEFYCK LLE+TGICTVPGSGFGQ+PGTYHLRTTFLAPG EW+ +W  FH E
Sbjct: 526 AHHLELTPDEFYCKKLLESTGICTVPGSGFGQEPGTYHLRTTFLAPGVEWMKKWEIFHKE 585

Query: 506 FYDKYRD 512
           F+D+YRD
Sbjct: 586 FFDQYRD 592

>KNAG0G02040 Chr7 complement(463058..464833) [1776 bp, 591 aa] {ON}
           Anc_8.263 YDR111C
          Length = 591

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/488 (67%), Positives = 401/488 (82%), Gaps = 10/488 (2%)

Query: 35  PAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYL-EAGQKLPFDTVINANIGNPQQLK 93
           PA ++++ DLN+NVLKAKYAVRGSIP+RAE+L+  L E  + LPFD +INANIGNPQQL 
Sbjct: 104 PAAQVKIADLNENVLKAKYAVRGSIPMRAEQLQHQLQEDPRSLPFDKIINANIGNPQQLN 163

Query: 94  QKPLTFYRQVLSILQYPELLES-------GSNIFKKDAIERARKLLKEIG-SVGSYSSSQ 145
           QKPL+FYRQVLS+LQ+PELL S        ++++K DA+ RA KLL++IG SVG+YS+SQ
Sbjct: 164 QKPLSFYRQVLSLLQFPELLNSLKENPAAATSLYKADAVRRAEKLLEDIGGSVGAYSTSQ 223

Query: 146 GIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYP 205
           G+  IRKTVA+FIT+RD+ E + P DIFLTAGAS+AV YLLSI CK EK+GVLIPIPQYP
Sbjct: 224 GVMGIRKTVADFITRRDNNEPAYPEDIFLTAGASAAVSYLLSIFCKGEKTGVLIPIPQYP 283

Query: 206 XXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSI 265
                         PYYLDE  GWST+  EI+ V+ D++D+ IKP+ LV+INPGNPTG++
Sbjct: 284 LYTATLALNNSHTLPYYLDEKSGWSTNTKEIDSVVLDAIDRNIKPSVLVVINPGNPTGAV 343

Query: 266 LSVESMEKIIEVAATHGIVIIADEVYQENVFN-NAKFHSMKKVLRNLQKAFPGEYDTVQL 324
           LS +++ +I E+AA +GIV+IADEVYQEN+F+ + KFHSMKKVLR LQ+  PG++D VQL
Sbjct: 344 LSEKAIAEIFEIAAKYGIVVIADEVYQENIFDEDVKFHSMKKVLRKLQQEHPGKFDEVQL 403

Query: 325 ASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQ 384
           ASLHSTSKGVSGECGQRGG+MELTGF+ EI+QVILKL SISLCPVVTGQALVDLMV PPQ
Sbjct: 404 ASLHSTSKGVSGECGQRGGFMELTGFSHEIRQVILKLASISLCPVVTGQALVDLMVHPPQ 463

Query: 385 KGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQ 444
           +G+ESYE DQ ERS I ++L  RA  LWE FN +EG+ CQKP+GAMYLFP+++LPFK +Q
Sbjct: 464 EGEESYELDQAERSHIHSELHKRANKLWETFNRLEGIQCQKPQGAMYLFPRLNLPFKAVQ 523

Query: 445 KSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHA 504
           K+Q +++T DEFYCK LLE TGICTVPGSGFGQ PGTYHLRTTFLAPGTEWID W KFH 
Sbjct: 524 KAQHMEMTADEFYCKELLENTGICTVPGSGFGQVPGTYHLRTTFLAPGTEWIDLWEKFHK 583

Query: 505 EFYDKYRD 512
           EFY+KYRD
Sbjct: 584 EFYNKYRD 591

>NDAI0B01990 Chr2 complement(493160..494926) [1767 bp, 588 aa] {ON}
           Anc_8.263 YDR111C
          Length = 588

 Score =  689 bits (1778), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/486 (67%), Positives = 393/486 (80%), Gaps = 8/486 (1%)

Query: 35  PAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG-QKLPFDTVINANIGNPQQLK 93
           PA++L + DLN+NVLKAKYAVRGSIP+RAEELK+ LE     LPF  ++NANIGNPQQLK
Sbjct: 103 PAEQLTLADLNENVLKAKYAVRGSIPMRAEELKVQLENNPSTLPFSQIVNANIGNPQQLK 162

Query: 94  QKPLTFYRQVLSILQYPELLESG------SNIFKKDAIERARKLLKEIG-SVGSYSSSQG 146
           QKPL+FYRQVLSILQYP++L+        + ++K+DAI+RA+ LL EIG SVG+YS+SQG
Sbjct: 163 QKPLSFYRQVLSILQYPDILKENEQNLIDAKVYKRDAIDRAKLLLSEIGGSVGAYSASQG 222

Query: 147 IPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPX 206
           +  IRKTVANFIT+RD GE + P DIFLT        YLLSILC+  K+GVLIPIPQYP 
Sbjct: 223 VYGIRKTVANFITERDGGEPAYPEDIFLTVWCFRCCCYLLSILCQGPKTGVLIPIPQYPL 282

Query: 207 XXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSIL 266
                        PYYLDE  GWST+  EIEEV+ D++++ I P+ LV+INPGNPTG++L
Sbjct: 283 YTATLALNNSHALPYYLDEKSGWSTNPKEIEEVVQDAMERAINPSVLVVINPGNPTGAVL 342

Query: 267 SVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLAS 326
           + ES+E I E+AA +GIV+IADEVYQEN+ +  KF+SMKKVLR LQK+ PG++D VQLAS
Sbjct: 343 TEESIEHIFEIAAKYGIVVIADEVYQENIADGVKFYSMKKVLRKLQKSHPGKFDNVQLAS 402

Query: 327 LHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQKG 386
           LHSTSKGVSGECGQRGGYMEL GF  E+++VILKL SISLCPVVTGQALVDLMVSPP+KG
Sbjct: 403 LHSTSKGVSGECGQRGGYMELIGFTHEVRKVILKLASISLCPVVTGQALVDLMVSPPKKG 462

Query: 387 DESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQKS 446
           D SYEQDQ ER  I ++LS RA  L+E F  +EG+ CQKP+GAMYLFPK+DLPFK +Q++
Sbjct: 463 DASYEQDQAERRHIKSELSIRASQLYETFVGLEGIECQKPQGAMYLFPKLDLPFKAVQEA 522

Query: 447 QELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAEF 506
           Q L++TPDEFYCK+LL+ATGICTVPGSGFGQ+PGTYHLRTTFLAPGTEWI +W  FH EF
Sbjct: 523 QHLEMTPDEFYCKSLLDATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIKKWEAFHKEF 582

Query: 507 YDKYRD 512
           YD YRD
Sbjct: 583 YDNYRD 588

>ZYRO0C01628g Chr3 (115665..117269) [1605 bp, 534 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 534

 Score =  683 bits (1762), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/488 (67%), Positives = 392/488 (80%), Gaps = 8/488 (1%)

Query: 33  VYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG-QKLPFDTVINANIGNPQQ 91
           VYPA+KL + ++N+NVLKAKYAVRG+IP+ A EL   L+     LPFD +++ANIGNPQ 
Sbjct: 47  VYPAEKLGLSEVNENVLKAKYAVRGAIPMLAAELNAKLKKDPHSLPFDNIVSANIGNPQH 106

Query: 92  LKQKPLTFYRQVLSILQYPELLESG------SNIFKKDAIERARKLLKEIGS-VGSYSSS 144
           LKQKPLTFYRQVLS+LQYP LLE        S +++KDAI RAR+LL +IGS VG+YS+S
Sbjct: 107 LKQKPLTFYRQVLSLLQYPGLLEENEQVLIDSKLYQKDAIARARRLLNDIGSSVGAYSTS 166

Query: 145 QGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQY 204
           QGI  IR+TVA FIT+RD GE +   DIFLTAGASSAV YLLSILCK +++GVLIPIPQY
Sbjct: 167 QGIQGIRETVAQFITERDGGEKAYAEDIFLTAGASSAVSYLLSILCKGQETGVLIPIPQY 226

Query: 205 PXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGS 264
           P              PYYLDE  GWST+  EIE+V+N+++++ IKP+ LV+INPGNPTG+
Sbjct: 227 PLYTASLALNNSHPLPYYLDEKSGWSTNPTEIEDVVNNAIEQNIKPSVLVVINPGNPTGA 286

Query: 265 ILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQL 324
           +LS E + +I  +AA +GIV+IADEVYQENVF+ A+FHSMKK+LR LQK+ PG +D VQL
Sbjct: 287 VLSEEDISQIFAIAAKYGIVVIADEVYQENVFDGAEFHSMKKILRKLQKSNPGVFDNVQL 346

Query: 325 ASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQ 384
           ASLHSTSKGVSGECGQRGGYME+TGFN +I+QVILKL SISLCPVVTGQALVDLMVSPP+
Sbjct: 347 ASLHSTSKGVSGECGQRGGYMEITGFNNDIRQVILKLASISLCPVVTGQALVDLMVSPPK 406

Query: 385 KGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQ 444
            GDESYE DQ ER +I   L+ RA  L   FNS+EG+ CQKPEGAMYLFP++ LPFK +Q
Sbjct: 407 PGDESYELDQQERKSIHEALAERAGKLHATFNSLEGIECQKPEGAMYLFPRLLLPFKAIQ 466

Query: 445 KSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHA 504
            ++   +TPD FYCK LLEATGICTVPGSGFGQ+PGTYHLRTTFLAPGTEWI+RW  FH 
Sbjct: 467 SAEHEGMTPDAFYCKKLLEATGICTVPGSGFGQEPGTYHLRTTFLAPGTEWIERWENFHK 526

Query: 505 EFYDKYRD 512
            FY++YRD
Sbjct: 527 AFYEEYRD 534

>CAGL0L12254g Chr12 complement(1327111..1328835) [1725 bp, 574 aa]
           {ON} similar to uniprot|P52893 Saccharomyces cerevisiae
           YLR089c
          Length = 574

 Score =  682 bits (1760), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/495 (66%), Positives = 397/495 (80%), Gaps = 9/495 (1%)

Query: 27  YEHKHN---VYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYL-EAGQKLPFDTVI 82
           + H HN     PA++  + D+N+ VL AKYAVRG+IP+RAEELK  L E    LPF+ +I
Sbjct: 80  HHHSHNNLPFLPAEQATLKDVNECVLNAKYAVRGAIPMRAEELKTQLMENPHSLPFNDII 139

Query: 83  NANIGNPQQLKQKPLTFYRQVLSILQYPELLESGSN----IFKKDAIERARKLLKEIG-S 137
           NANIGNPQQLKQKPL+FYRQVLS+LQYPEL+ +  N    + K+DAI+RA++LL +IG S
Sbjct: 140 NANIGNPQQLKQKPLSFYRQVLSLLQYPELIPTLENNPQTMIKQDAIDRAKRLLDDIGGS 199

Query: 138 VGSYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGV 197
           VG+YSSSQG+  IRKTVA+FIT RDDG I+ P DIFLTAGASSAVDYLLSI C+ E++GV
Sbjct: 200 VGAYSSSQGVLGIRKTVADFITNRDDGIIAYPEDIFLTAGASSAVDYLLSIFCRGEETGV 259

Query: 198 LIPIPQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIIN 257
           LIPIPQYP              PYYL+E  GWSTD  E+E +I DS++  IKP+ LV+IN
Sbjct: 260 LIPIPQYPLYTATLALQNSHALPYYLNEETGWSTDPEELESIILDSIENNIKPSVLVVIN 319

Query: 258 PGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPG 317
           PGNPTG++LS E++E+I  +AA +GI++IADEVYQENVF + KFHSMKKVLR LQ   PG
Sbjct: 320 PGNPTGAVLSEEAIEQIFTLAAKYGIIVIADEVYQENVFEDVKFHSMKKVLRQLQMKQPG 379

Query: 318 EYDTVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVD 377
            YD VQLASLHSTSKGVSGECGQRGGYMEL GF  +I+QV+LKL SISLCPVVTGQALVD
Sbjct: 380 LYDNVQLASLHSTSKGVSGECGQRGGYMELVGFTHDIRQVVLKLASISLCPVVTGQALVD 439

Query: 378 LMVSPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKID 437
           LMV PPQKG+ESYEQDQ ER  I  +L  RA LL +AF  ++G+SCQKP+GAMYLFPK++
Sbjct: 440 LMVCPPQKGEESYEQDQEERRNIHKELHKRATLLHDAFVKLDGISCQKPQGAMYLFPKLE 499

Query: 438 LPFKVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWID 497
           LP+K +Q++   D++PDEFYCK+LLE TGICTVPGSGFGQ+PGTYHLRTTFLAPGT+WI+
Sbjct: 500 LPYKAIQEALHQDMSPDEFYCKSLLEKTGICTVPGSGFGQEPGTYHLRTTFLAPGTKWIE 559

Query: 498 RWNKFHAEFYDKYRD 512
            W  FH EFY+K+++
Sbjct: 560 DWVDFHQEFYNKFKN 574

>TPHA0J00750 Chr10 complement(176561..178129) [1569 bp, 522 aa] {ON}
           Anc_8.263 YDR111C
          Length = 522

 Score =  671 bits (1732), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 333/492 (67%), Positives = 396/492 (80%), Gaps = 8/492 (1%)

Query: 28  EHKHNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYL-EAGQKLPFDTVINANI 86
           +HK N  PA KL ++DLN+NVLKAKYAVRG IP RAE LK  L +    LPF  VINANI
Sbjct: 32  KHK-NFKPADKLTINDLNENVLKAKYAVRGKIPARAEVLKQQLIDNPSSLPFKKVINANI 90

Query: 87  GNPQQLKQKPLTFYRQVLSILQYPELLE---SGSN--IFKKDAIERARKLLKEIGSVGSY 141
           GNPQQL QKPLTFYRQVLS+LQYP +L+   SG+   ++K+DAIERA+++L +IGS    
Sbjct: 91  GNPQQLNQKPLTFYRQVLSLLQYPMVLDETFSGNTKTLYKQDAIERAKRILNDIGSSVGS 150

Query: 142 SSSQG-IPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIP 200
            SS   +  +RKTVA +I++RD GE +   DIFLTAGASSAV YLL+ILCK ++SGVLIP
Sbjct: 151 YSSSQGVFGLRKTVAEYISRRDGGEKAYAEDIFLTAGASSAVSYLLNILCKGKESGVLIP 210

Query: 201 IPQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGN 260
           IPQYP              PYYL+E+ GWST++ EIE V+++++ + I P  LV+INPGN
Sbjct: 211 IPQYPLYTATLALNNTNALPYYLEENSGWSTNMEEIENVVHNAIREKIIPRVLVVINPGN 270

Query: 261 PTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYD 320
           PTG+ILSVES+EKI +VAA HGIV+IADEVYQEN+F   +FHSMKKVLR+LQ+  PG+Y+
Sbjct: 271 PTGAILSVESIEKIFDVAAHHGIVVIADEVYQENIFPGNEFHSMKKVLRDLQRRVPGKYE 330

Query: 321 TVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMV 380
            VQLASLHSTSKGVSGECGQRGGYMELTGF+ EIK  ILKLCSISLCPVVTGQALVDLM 
Sbjct: 331 NVQLASLHSTSKGVSGECGQRGGYMELTGFSTEIKHEILKLCSISLCPVVTGQALVDLMT 390

Query: 381 SPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPF 440
            PP+KG+ SYEQDQ+ERSTI ++L  RA  LW+AFN MEGVSCQKP+G+MYLFPKID+P 
Sbjct: 391 CPPKKGEASYEQDQMERSTIHSELYERATYLWKAFNEMEGVSCQKPQGSMYLFPKIDIPH 450

Query: 441 KVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWN 500
           K L+K+QELDITPDE YC  LLEATGICTVPGSGFGQ+PGT+HLRTTFLAPGT WID+W 
Sbjct: 451 KALEKAQELDITPDELYCAELLEATGICTVPGSGFGQKPGTFHLRTTFLAPGTSWIDQWR 510

Query: 501 KFHAEFYDKYRD 512
           +FH  F +KYRD
Sbjct: 511 EFHQIFCNKYRD 522

>SAKL0H17006g Chr8 (1493272..1494867) [1596 bp, 531 aa] {ON} highly
           similar to gnl|GLV|KLLA0F19162g Kluyveromyces lactis
           KLLA0F19162g and similar to YLR089C uniprot|P52893
           Saccharomyces cerevisiae YLR089C ALT1 putative alanine
           transaminase (glutamyc pyruvic transaminase)
          Length = 531

 Score =  669 bits (1726), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/485 (66%), Positives = 388/485 (80%), Gaps = 7/485 (1%)

Query: 35  PAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAGQK-LPFDTVINANIGNPQQLK 93
           PA KL ++DLN+NVL+AKYAVRG IP +AEELK  L    K LPFD +INANIGNPQQL 
Sbjct: 47  PADKLSLEDLNENVLRAKYAVRGKIPQKAEELKNQLARDPKSLPFDRIINANIGNPQQLD 106

Query: 94  QKPLTFYRQVLSILQYPELLE-----SGSNIFKKDAIERARKLLKEIG-SVGSYSSSQGI 147
           QKPLTFYRQVLS+LQ P++LE       S I+K DAI+RA +LL  IG SVG+YS SQG+
Sbjct: 107 QKPLTFYRQVLSLLQNPDMLEEIPREQLSQIYKPDAIDRAARLLSNIGGSVGAYSHSQGV 166

Query: 148 PAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXX 207
              RKTVA+FITKRD GE +   DIFLTAGAS+AV Y+LSILC+  ++GVLIPIPQYP  
Sbjct: 167 YGFRKTVADFITKRDGGEEAYAEDIFLTAGASAAVSYILSILCRGPQTGVLIPIPQYPLY 226

Query: 208 XXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILS 267
                       PYYLDE   WST+  EIE+V+ +S+ KG++P  LV+INPGNPTG+ILS
Sbjct: 227 TASLALNNSHALPYYLDEESNWSTNPEEIEKVVTNSIAKGVEPKCLVVINPGNPTGAILS 286

Query: 268 VESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLASL 327
            ES+EKI EVAA +GIV+IADEVYQENVFN A+FHSM+KVL++LQ+   G++D +QLASL
Sbjct: 287 PESIEKIFEVAAKYGIVVIADEVYQENVFNGAEFHSMRKVLKDLQRKHHGKFDNIQLASL 346

Query: 328 HSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQKGD 387
           HSTSKGVSGECGQRGGYMEL GF+ +++QV LKL SISLCPVVTGQALVDLMV PP+ GD
Sbjct: 347 HSTSKGVSGECGQRGGYMELLGFSHDVRQVFLKLASISLCPVVTGQALVDLMVCPPKPGD 406

Query: 388 ESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQKSQ 447
            SYEQDQ ERS I + L  RA +L+E FN +EG+ CQKP+GAMYLFP++DL +K +QK++
Sbjct: 407 ASYEQDQKERSEIHDALDARASMLYETFNRLEGIECQKPQGAMYLFPRLDLSYKAVQKAE 466

Query: 448 ELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAEFY 507
            L ++PDEFYC+ LLEATGICTVPGSGFGQ PGTYHLRTTFLAPGT+WI  W +FH +FY
Sbjct: 467 HLSLSPDEFYCQELLEATGICTVPGSGFGQVPGTYHLRTTFLAPGTDWIKAWEEFHKKFY 526

Query: 508 DKYRD 512
           ++YRD
Sbjct: 527 NEYRD 531

>KAFR0B02730 Chr2 complement(558858..560477) [1620 bp, 539 aa] {ON}
           Anc_8.263 YDR111C
          Length = 539

 Score =  654 bits (1688), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/491 (65%), Positives = 390/491 (79%), Gaps = 8/491 (1%)

Query: 28  EHKHNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYL-EAGQKLPFDTVINANI 86
           +H  N  PA +L + DLN+NVLKAKYAVRG IP RAEELK  L E    LPFD +INANI
Sbjct: 47  KHNLNFKPAGQLTIGDLNENVLKAKYAVRGKIPTRAEELKRQLAEKPNSLPFDKIINANI 106

Query: 87  GNPQQLKQKPLTFYRQVLSILQYPELLES------GSNIFKKDAIERARKLLKEIG-SVG 139
           GNPQQL+Q+PL+FYRQVLS+LQYP LL +       S ++KKDAI RA+K+LK+IG SVG
Sbjct: 107 GNPQQLQQQPLSFYRQVLSLLQYPTLLHAIETKPGSSAVYKKDAILRAKKILKDIGGSVG 166

Query: 140 SYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLI 199
           +YS SQG+  IR+TVANFIT+RD GE + P DIFLTAGAS+AV+YLLSILCK EK+GVLI
Sbjct: 167 AYSESQGVYGIRRTVANFITERDGGEPAYPEDIFLTAGASAAVNYLLSILCKGEKTGVLI 226

Query: 200 PIPQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPG 259
           PIPQYP              PY+LDE  GWS +  EIE VI  ++   IKP  LV+INPG
Sbjct: 227 PIPQYPLYTATLALNNSHALPYFLDEMNGWSINPIEIENVIKKAVQDNIKPDVLVVINPG 286

Query: 260 NPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEY 319
           NPTG++LS E++  I+E+AA +GIV+IADEVYQEN+F+  KFHS+K VLR LQ+  PG++
Sbjct: 287 NPTGAVLSKEAIVSILEIAAKYGIVVIADEVYQENIFDGMKFHSVKGVLRRLQREIPGKF 346

Query: 320 DTVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLM 379
           D VQLASLHSTSKGVSGECGQRGGYME+ GF  E++QVILKL SISLCPVVTGQALVDLM
Sbjct: 347 DNVQLASLHSTSKGVSGECGQRGGYMEIIGFTHEVRQVILKLASISLCPVVTGQALVDLM 406

Query: 380 VSPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLP 439
           VSPP++G+ES+  DQ +R TI + LS RA LLW+ FNS++G+ CQKP GAMYLFPK++LP
Sbjct: 407 VSPPKRGEESFALDQAQRKTIHSQLSQRAELLWKTFNSLDGIECQKPNGAMYLFPKLNLP 466

Query: 440 FKVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRW 499
           ++ +Q++Q L+++PDEFYCK LLE TGICTVPGSGFGQ  GTYHLRTTFLAPG EWID W
Sbjct: 467 YRAIQEAQRLELSPDEFYCKELLEHTGICTVPGSGFGQVAGTYHLRTTFLAPGIEWIDSW 526

Query: 500 NKFHAEFYDKY 510
            +FH EF +KY
Sbjct: 527 KQFHIEFMEKY 537

>TBLA0E04440 Chr5 complement(1138820..1140508) [1689 bp, 562 aa]
           {ON} Anc_8.263 YDR111C
          Length = 562

 Score =  654 bits (1686), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 309/484 (63%), Positives = 382/484 (78%), Gaps = 6/484 (1%)

Query: 34  YPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKL-YLEAGQKLPFDTVINANIGNPQQL 92
           Y A++L  +DLN NV+KAKYAVRG+IP  A++LK+  L+    LPF++VIN+NIGNPQQL
Sbjct: 79  YFAERLEPEDLNPNVVKAKYAVRGAIPSYADKLKIQLLKHPGTLPFESVINSNIGNPQQL 138

Query: 93  KQKPLTFYRQVLSILQYPELLESGSNI-----FKKDAIERARKLLKEIGSVGSYSSSQGI 147
            QKPL+F RQVLSIL+YP LL+    +     +  D+IERA+ LL +IGS+G+YS+SQG+
Sbjct: 139 GQKPLSFGRQVLSILEYPALLDHERTLVDSMGYAPDSIERAKTLLTDIGSIGAYSNSQGV 198

Query: 148 PAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXX 207
             IR+TVA+FIT RDDGE++ P+DIFLTAGASSAV  +LSILCK +++GVLIPIPQYP  
Sbjct: 199 HGIRQTVADFITNRDDGEVAYPDDIFLTAGASSAVSTILSILCKGQQTGVLIPIPQYPLY 258

Query: 208 XXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILS 267
                       PYYLDES GWSTDINEI +V  DSL+ GIKPT LV+INPGNPTGS+L+
Sbjct: 259 TATLTLNDATALPYYLDESNGWSTDINEISKVAQDSLEAGIKPTCLVVINPGNPTGSVLT 318

Query: 268 VESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLASL 327
           VE+++ + +VAA +G+V+IADEVYQ+N+F  ++FHSMKK+LR LQK  P +YD +QLASL
Sbjct: 319 VEAIKNVFDVAAKYGLVVIADEVYQDNIFPGSEFHSMKKILRILQKEVPNKYDNIQLASL 378

Query: 328 HSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQKGD 387
           HS SKG+ GECG RGGY E  GF PE+KQVI KL SISLC  V GQALVDLM  PP+KG+
Sbjct: 379 HSCSKGLLGECGHRGGYCEFIGFTPEVKQVITKLSSISLCSSVIGQALVDLMCCPPKKGE 438

Query: 388 ESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQKSQ 447
            SYE DQ ER TI  +   R+  L+E FNS+EGV+CQKP+GAMY+FP I LPF  ++ +Q
Sbjct: 439 PSYELDQHERQTIRTNHKKRSNKLYEMFNSLEGVTCQKPQGAMYMFPNIQLPFNAIKMAQ 498

Query: 448 ELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAEFY 507
            LDITPDEFYC+ LL+ATGICTVPGSGFGQQPGTYH+RTTFLAPG EW+ RW KFH EF+
Sbjct: 499 NLDITPDEFYCRELLKATGICTVPGSGFGQQPGTYHVRTTFLAPGVEWMKRWEKFHIEFF 558

Query: 508 DKYR 511
           +KYR
Sbjct: 559 EKYR 562

>KLTH0G13662g Chr7 (1169989..1171548) [1560 bp, 519 aa] {ON} similar
           to uniprot|P52893 Saccharomyces cerevisiae YLR089C ALT1
           putative alanine transaminase (glutamyc pyruvic
           transaminase)
          Length = 519

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/483 (65%), Positives = 380/483 (78%), Gaps = 10/483 (2%)

Query: 38  KLRMDDLNKNVLKAKYAVRGSIPLRAEEL--KLYLEAGQKLPFDTVINANIGNPQQLKQK 95
           K  + D+N+ VL AKYAVRG IPLRAEEL  KL  E G  LPF+ +INANIGNPQQL QK
Sbjct: 39  KKTLRDVNQCVLNAKYAVRGPIPLRAEELRHKLVEEPGS-LPFNKIINANIGNPQQLDQK 97

Query: 96  PLTFYRQVLSILQYPELLESG-----SNIFKKDAIERARKLLKEIG-SVGSYSSSQGIPA 149
           PLTFYRQVLS+LQ P L+ES        +FK DA+ERA+K+LK++G SVG+YS+SQG+  
Sbjct: 98  PLTFYRQVLSLLQNPALIESLPTGELHKLFKPDAVERAKKMLKQVGGSVGAYSASQGVAG 157

Query: 150 IRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXX 209
            R++VA FI +RD GE ++ NDIFLTAGASSAV  +LS+ C   ++G LIPIPQYP    
Sbjct: 158 FRQSVAEFIEERD-GEPASANDIFLTAGASSAVSAILSMFCTGSENGALIPIPQYPLYTA 216

Query: 210 XXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVE 269
                     PYYLDE+ GWS D  ++E+V+ D++ KG++PT LV+INPGNPTG+ILS E
Sbjct: 217 TLALNDAHALPYYLDEASGWSMDTEQVEQVVKDAIRKGVRPTCLVVINPGNPTGAILSPE 276

Query: 270 SMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLASLHS 329
           ++EKI+ VAA + +V+IADEVYQEN F++A F SMKKVLR LQK  PG+YD VQLASLHS
Sbjct: 277 AIEKILTVAAKYSLVVIADEVYQENGFDDADFVSMKKVLRVLQKTEPGKYDNVQLASLHS 336

Query: 330 TSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQKGDES 389
           TSKGVSGECGQRGGYMEL GF+ E+KQV LKL SISLCPVVTGQALVDLMV PP+KGD S
Sbjct: 337 TSKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALVDLMVRPPKKGDAS 396

Query: 390 YEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQKSQEL 449
           YE D+ ER+ I N L  ++ LL+E F S+EGVSCQKP+GAMYLFPK+DL  K ++K++ L
Sbjct: 397 YELDRQERNAIHNSLHQKSTLLYETFQSLEGVSCQKPQGAMYLFPKLDLSRKAIRKAESL 456

Query: 450 DITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAEFYDK 509
            + PDE+YCK LLEATGICTVPGSGF Q PGTYHLRTTFLAPGTEW+D W KFH +F D+
Sbjct: 457 GMAPDEYYCKELLEATGICTVPGSGFRQVPGTYHLRTTFLAPGTEWVDSWKKFHQKFVDE 516

Query: 510 YRD 512
           +RD
Sbjct: 517 HRD 519

>Smik_4.357 Chr4 complement(639561..641084) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/489 (62%), Positives = 377/489 (77%), Gaps = 8/489 (1%)

Query: 32  NVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAGQK-LPFDTVINANIGNPQ 90
           N  PA K+   DLN  V KA+YAVRG+IP RA+ELK  L+     LPFD +INANIGNPQ
Sbjct: 19  NFKPAAKITKKDLNAGVTKAEYAVRGAIPTRADELKEELKRKPGVLPFDDIINANIGNPQ 78

Query: 91  QLKQKPLTFYRQVLSILQYPELLESGS------NIFKKDAIERARKLLKEIG-SVGSYSS 143
           QL QKPLTF RQVLSIL+YPE+L  G       N+F+KDA+ RA  LL++IG S+G+YS 
Sbjct: 79  QLDQKPLTFTRQVLSILEYPEILRVGPDKLASLNLFRKDALGRAEHLLEDIGGSIGAYSH 138

Query: 144 SQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQ 203
           SQG+P IR++VA FITKRDDGE + P +I+LT GASSA   LLS+LCK+ ++G+LIPIPQ
Sbjct: 139 SQGVPGIRQSVAEFITKRDDGEPAAPENIYLTTGASSAATSLLSLLCKDVQTGLLIPIPQ 198

Query: 204 YPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTG 263
           YP              PYYLDE   WST  +EIE+V+ D+L+KGIKP+ L++INPGNPTG
Sbjct: 199 YPLYTASASLFNAQVLPYYLDEGSNWSTKSDEIEKVVKDALEKGIKPSVLIVINPGNPTG 258

Query: 264 SILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQ 323
           ++LS +++ KI  +AA +GI II+DEVYQENVFN  KFHSMKKVLR LQ+ +PG++D VQ
Sbjct: 259 AVLSEDTIAKICLIAAKYGIAIISDEVYQENVFNGVKFHSMKKVLRKLQRLYPGKFDNVQ 318

Query: 324 LASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPP 383
           LASLHS SKG  GECGQRGGYME+ GF+ +I+  + KL SIS+C VVTGQA+VDLMV PP
Sbjct: 319 LASLHSISKGFMGECGQRGGYMEVVGFSKDIRDALFKLMSISICSVVTGQAVVDLMVKPP 378

Query: 384 QKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVL 443
           Q GDESY+QD  ER  I +++  RA LL E FN +EG+ CQKP+GAMYLFP++ LP K L
Sbjct: 379 QPGDESYDQDHSERMKIFHEMYTRATLLHETFNELEGIECQKPQGAMYLFPRLVLPEKAL 438

Query: 444 QKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFH 503
           ++S+ L I PDEFYC +LLE+TGICTVPGSGFGQQPGTYH+RTTFLAPGT+WI  W  FH
Sbjct: 439 RESERLGIEPDEFYCTSLLESTGICTVPGSGFGQQPGTYHVRTTFLAPGTQWIQDWKHFH 498

Query: 504 AEFYDKYRD 512
            +F++KYRD
Sbjct: 499 QDFFNKYRD 507

>Skud_4.372 Chr4 complement(649872..651395) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  642 bits (1655), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/486 (62%), Positives = 380/486 (78%), Gaps = 8/486 (1%)

Query: 35  PAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAGQKL-PFDTVINANIGNPQQLK 93
           PA K+   DLN +V KA+YAVRGSIP RA+ELK  L+    L PFD +INANIGNPQQL 
Sbjct: 22  PAAKITKKDLNGSVTKAEYAVRGSIPTRADELKEELKKNPGLLPFDDIINANIGNPQQLD 81

Query: 94  QKPLTFYRQVLSILQYPELLE------SGSNIFKKDAIERARKLLKEIG-SVGSYSSSQG 146
           QKPLTF RQVLSIL+YPE+L+      +  N+F KDA++RA  LLK+IG SVG+YS SQG
Sbjct: 82  QKPLTFTRQVLSILEYPEILQVDHEKLASLNLFSKDALKRAECLLKDIGGSVGAYSHSQG 141

Query: 147 IPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPX 206
           +P IR+TVA+FIT RD GE +TP DI+LT GASSA   LLS+LCK+ ++G+LIPIPQYP 
Sbjct: 142 VPGIRQTVADFITARDGGEPATPEDIYLTTGASSAATSLLSLLCKDTRTGLLIPIPQYPL 201

Query: 207 XXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSIL 266
                        PYYLDE   WST+ +EIE+V+ D+L+KGI+P+ L++INPGNPTG++L
Sbjct: 202 YTASASLFNAQVLPYYLDEECNWSTESDEIEKVVQDALEKGIRPSVLIVINPGNPTGAVL 261

Query: 267 SVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLAS 326
           + E++ +I  +AA +GI +I+DEVYQENVFN+ KFHSMKKVLR LQ  +PG++D VQLAS
Sbjct: 262 TEETIARICLIAAKYGIAVISDEVYQENVFNDFKFHSMKKVLRKLQHCYPGKFDNVQLAS 321

Query: 327 LHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQKG 386
           LHS SKG  GECGQRGGYME+ GF+ +I+  + KL SIS+C VVTGQA+VDLMV+PPQ G
Sbjct: 322 LHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVVTGQAIVDLMVNPPQPG 381

Query: 387 DESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQKS 446
           DESYEQD+ ERS I N++  RA LL+E FN +EG+ CQ P+GAMYLFP++ LP K  ++S
Sbjct: 382 DESYEQDRQERSKIFNEMRTRANLLYETFNGLEGIECQNPQGAMYLFPRLILPDKAFRES 441

Query: 447 QELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAEF 506
           + L + PDEFYC +LLE+TGICTVPGSGFGQ+PGTYH+RTTFLAPGT+WI  W  FH  F
Sbjct: 442 ERLGVEPDEFYCASLLESTGICTVPGSGFGQKPGTYHVRTTFLAPGTQWIQNWKNFHQSF 501

Query: 507 YDKYRD 512
           +++YRD
Sbjct: 502 FNEYRD 507

>KAFR0B05530 Chr2 (1132895..1134439) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  638 bits (1646), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/490 (62%), Positives = 378/490 (77%), Gaps = 10/490 (2%)

Query: 31  HNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYL---EAGQKLPFDTVINANIG 87
           HN  PA+K+ +DDLN+NVLK++YAVRGSIP RAEEL+  L   ++   L F+ +++ANIG
Sbjct: 26  HNFKPAKKITLDDLNQNVLKSEYAVRGSIPRRAEELEFELLNNDSSDSLAFENIVHANIG 85

Query: 88  NPQQLKQKPLTFYRQVLSILQYPELLES-----GSNIFKKDAIERARKLLKEIG-SVGSY 141
           NPQQL QKPLTF RQV+SILQYPELL        + IFK DA+ERA  LL  IG SVG+Y
Sbjct: 86  NPQQLDQKPLTFSRQVISILQYPELLNQRNILVSTGIFKSDAMERAETLLCHIGGSVGAY 145

Query: 142 SSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPI 201
           SSSQG+  IR+TVAN+IT RD+GE ++P+DIFLT GAS A  YLLS+LCK++ +GVLIPI
Sbjct: 146 SSSQGVYGIRETVANYITARDNGETASPDDIFLTEGASKAASYLLSLLCKDKNTGVLIPI 205

Query: 202 PQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNP 261
           PQYP              PYYL+E  GWST+ NEIE+V+ D++   +KP+ +V+INPGNP
Sbjct: 206 PQYPLYTATITLCDAKMLPYYLNEESGWSTNTNEIEKVVLDAIADNVKPSVMVVINPGNP 265

Query: 262 TGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDT 321
           TGS+LS + +  II + A +GIV+IADEVYQEN+F+  +FHSMKKVLR+LQK +PG+YD 
Sbjct: 266 TGSVLSKDDIIHIINIGAKYGIVLIADEVYQENIFD-GEFHSMKKVLRSLQKQYPGKYDA 324

Query: 322 VQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVS 381
           VQLASLHSTSKGVSGECGQRGGYMEL GF  EI+Q ILKL SISLC V+TGQALVDLMV+
Sbjct: 325 VQLASLHSTSKGVSGECGQRGGYMELVGFKDEIRQAILKLASISLCSVITGQALVDLMVN 384

Query: 382 PPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFK 441
           PP+KGDESYE D  ER  I   L  RA  L+  F  ++GV CQKP+GAMYLFPK+  P  
Sbjct: 385 PPKKGDESYELDNFERKNIHETLKERAEKLYNLFCQLKGVECQKPQGAMYLFPKLHFPQT 444

Query: 442 VLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNK 501
           ++ ++   +++PDEFYC ALLEATGICTVPGSGFGQ+ GTYHLRTTFLAPG +W ++W  
Sbjct: 445 LITEAINQNMSPDEFYCHALLEATGICTVPGSGFGQKEGTYHLRTTFLAPGNQWTEKWKL 504

Query: 502 FHAEFYDKYR 511
           FH EF+ KY+
Sbjct: 505 FHEEFFSKYQ 514

>Kwal_56.23791 s56 (706946..708502) [1557 bp, 518 aa] {ON} YLR089C -
           Hypothetical ORF [contig 173] FULL
          Length = 518

 Score =  637 bits (1642), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/482 (64%), Positives = 376/482 (78%), Gaps = 8/482 (1%)

Query: 38  KLRMDDLNKNVLKAKYAVRGSIPLRAEELKL-YLEAGQKLPFDTVINANIGNPQQLKQKP 96
           K  + D+N+ VL AKYAVRG IPLRAEELK   LE    LPFD +INANIGNPQQL QKP
Sbjct: 38  KKTLQDINECVLNAKYAVRGLIPLRAEELKQKLLEEPGSLPFDKIINANIGNPQQLDQKP 97

Query: 97  LTFYRQVLSILQYPEL---LESGS--NIFKKDAIERARKLLKEIG-SVGSYSSSQGIPAI 150
           LTFYRQVL++LQ P+L   L SG     FK DA+ERA+K+LK++G SVG+YS+SQG+   
Sbjct: 98  LTFYRQVLALLQNPDLISDLSSGELHKFFKPDAVERAKKMLKQVGGSVGAYSNSQGVAGF 157

Query: 151 RKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXX 210
           R++VA FI +RD GE ++  DIFLT GAS AV Y+LS+ C   ++G LIPIPQYP     
Sbjct: 158 RESVAEFIEERD-GEPASAQDIFLTTGASGAVSYILSLFCNGPENGALIPIPQYPLYTAS 216

Query: 211 XXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVES 270
                    PYYLDE  GWS D  +IE+V+ DS+ KGI+PT LV+INPGNPTG++L+ ++
Sbjct: 217 LALNNSHALPYYLDEESGWSMDTEQIEKVVQDSIKKGIRPTCLVVINPGNPTGALLNTDT 276

Query: 271 MEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLASLHST 330
           +E +I+VAA + +VIIADEVYQEN FN+A+F SMKKVLR LQK  PG+YD VQLASLHST
Sbjct: 277 IENVIKVAAKYSMVIIADEVYQENGFNDAEFVSMKKVLRVLQKTEPGKYDNVQLASLHST 336

Query: 331 SKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQKGDESY 390
           SKGVSGECGQRGGYMEL GF+ E+KQV LKL SISLCPVVTGQAL+DLMV PP+KGD SY
Sbjct: 337 SKGVSGECGQRGGYMELVGFSEEVKQVFLKLASISLCPVVTGQALIDLMVRPPKKGDASY 396

Query: 391 EQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQKSQELD 450
           EQD+ ER  I + L  R+ LL++AF SMEGVSCQ+P+GAMYLFPK++L  K + K++   
Sbjct: 397 EQDRQERCDIHDALHKRSGLLYQAFQSMEGVSCQEPQGAMYLFPKLELSNKAIHKAESAG 456

Query: 451 ITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAEFYDKY 510
           + PDE+YCK LLEATGICTVPGSGFGQ PGT+HLRTTFLAPGTEWID W KFH +F + +
Sbjct: 457 LAPDEYYCKELLEATGICTVPGSGFGQVPGTFHLRTTFLAPGTEWIDSWKKFHEKFTEDH 516

Query: 511 RD 512
           RD
Sbjct: 517 RD 518

>YDR111C Chr4 complement(678241..679764) [1524 bp, 507 aa] {ON}
           ALT2Putative alanine transaminase (glutamic pyruvic
           transaminase)
          Length = 507

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/486 (61%), Positives = 375/486 (77%), Gaps = 8/486 (1%)

Query: 35  PAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG-QKLPFDTVINANIGNPQQLK 93
           PA K+   DLN  V KA+YAVRG+IP RA+ELK  L+   + LPFD +INANIGNPQQL 
Sbjct: 22  PAGKITKKDLNTGVTKAEYAVRGAIPTRADELKEELKKNPEVLPFDDIINANIGNPQQLD 81

Query: 94  QKPLTFYRQVLSILQYPELLESGSN------IFKKDAIERARKLLKEIG-SVGSYSSSQG 146
           QKPLTF RQVL+IL+YPE+L  G N      +F +DA+ERA +LL +IG S+G+YS SQG
Sbjct: 82  QKPLTFTRQVLAILEYPEILRVGHNELASLNLFSRDALERAERLLNDIGGSIGAYSHSQG 141

Query: 147 IPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPX 206
           +P IR+TVA+FIT+RD GE +TP DI+LT GASSA   LLS+LCK+ ++G+LIPIPQYP 
Sbjct: 142 VPGIRQTVADFITRRDGGEPATPEDIYLTTGASSAATSLLSLLCKDSQTGLLIPIPQYPL 201

Query: 207 XXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSIL 266
                        PYYLDE   WST+ +EIE+V+ D+L K I+P+ L++INPGNPTG++L
Sbjct: 202 YTASASLFNAQVLPYYLDEESNWSTNSDEIEKVVQDALKKQIRPSVLIVINPGNPTGAVL 261

Query: 267 SVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLAS 326
           S E++ +I  +AA +GI II+DEVYQEN+FN+ KFHSMKKVLR LQ  +PG++D VQLAS
Sbjct: 262 SEETIARICLIAAKYGITIISDEVYQENIFNDVKFHSMKKVLRKLQHLYPGKFDNVQLAS 321

Query: 327 LHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQKG 386
           LHS SKG   ECGQRGGYME+ GF+ EI+  + KL SIS+C VVTGQA+VDLMV PPQ G
Sbjct: 322 LHSISKGFMDECGQRGGYMEIIGFSQEIRDALFKLMSISICSVVTGQAVVDLMVKPPQPG 381

Query: 387 DESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQKS 446
           DESYEQD  ER  I +++  RA LL+E F  +EG+ CQKP+GAMYLFP++ LP K L +S
Sbjct: 382 DESYEQDHDERLKIFHEMRTRANLLYETFKELEGIECQKPQGAMYLFPRLVLPKKALCES 441

Query: 447 QELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAEF 506
           + L I PDEFYC +LLE+TGICTVPGSGFGQ+PGTYH+RTTFLAPGT+WI  W +FH +F
Sbjct: 442 ERLGIEPDEFYCTSLLESTGICTVPGSGFGQRPGTYHVRTTFLAPGTKWIQDWKEFHQDF 501

Query: 507 YDKYRD 512
           + KYR+
Sbjct: 502 FSKYRN 507

>Suva_2.271 Chr2 complement(472714..474237) [1524 bp, 507 aa] {ON}
           YDR111C (REAL)
          Length = 507

 Score =  625 bits (1612), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/486 (60%), Positives = 375/486 (77%), Gaps = 8/486 (1%)

Query: 35  PAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLE-AGQKLPFDTVINANIGNPQQLK 93
           PA KL   DLN +V KA+YAVRG+IP RAEELK  L+ +   LPF+++INANIGNPQQL 
Sbjct: 22  PAAKLTKKDLNASVTKAEYAVRGAIPTRAEELKEELKRSSNSLPFNSIINANIGNPQQLD 81

Query: 94  QKPLTFYRQVLSILQYPELLE------SGSNIFKKDAIERARKLLKEIG-SVGSYSSSQG 146
           QKPLTF RQVLSIL+YPE+L       +  N+F KDA++RA++LL +IG SVG+YS SQG
Sbjct: 82  QKPLTFTRQVLSILEYPEILRVDHDKLASLNLFAKDALKRAQRLLDDIGGSVGAYSHSQG 141

Query: 147 IPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPX 206
           +P IR+TVA+FIT+RD GE + P DI+LT GASSA   LLS+LCK+ ++G+L+PIPQYP 
Sbjct: 142 VPGIRQTVADFITERDGGEPAGPEDIYLTTGASSAATSLLSLLCKDSQTGLLLPIPQYPL 201

Query: 207 XXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSIL 266
                        PYYLDE   WST+ +EIE V+ D+L KGI+P+ LV+INPGNPTG++L
Sbjct: 202 YTASASLYNAQVLPYYLDEEADWSTESDEIERVVLDALKKGIRPSVLVVINPGNPTGAVL 261

Query: 267 SVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLAS 326
           +  ++ KI  +AA +GI II+DEVYQEN+F + KFHSMKK+LR LQ   PG++D VQLAS
Sbjct: 262 TENTIAKICLIAAKYGITIISDEVYQENIFGDVKFHSMKKILRKLQNLHPGKFDNVQLAS 321

Query: 327 LHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQKG 386
           LHS SKG  GECGQRGGYME+ GF+ +I+  + KL SIS+C V TGQA++DLMV PPQ G
Sbjct: 322 LHSISKGFMGECGQRGGYMEIVGFSQDIRDALFKLMSISICSVATGQAIIDLMVKPPQPG 381

Query: 387 DESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQKS 446
           DESY+QD+ ER  I N++  RA LL+E FN +EG+ CQKP+GAMYLFPK+ LP K L++S
Sbjct: 382 DESYDQDRKERLKIYNEMLTRANLLYETFNELEGIKCQKPQGAMYLFPKLFLPEKALRES 441

Query: 447 QELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAEF 506
           + L+I PD  YC +LLE+TGICTVPGSGFGQ+ GTYH+RTTFL PGT+WI  W +FH +F
Sbjct: 442 ERLNIEPDVLYCTSLLESTGICTVPGSGFGQKSGTYHVRTTFLPPGTQWIQDWRQFHQDF 501

Query: 507 YDKYRD 512
           ++KYRD
Sbjct: 502 FNKYRD 507

>KNAG0M01210 Chr13 (220612..222177) [1566 bp, 521 aa] {ON} Anc_8.263
           YDR111C
          Length = 521

 Score =  620 bits (1600), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/486 (59%), Positives = 376/486 (77%), Gaps = 8/486 (1%)

Query: 35  PAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYL-EAGQKLPFDTVINANIGNPQQLK 93
           PA+KL  DDLNKN++ A+YAVRG+IP++AEEL++ L +    LPF+ +  ANIGNPQQL 
Sbjct: 36  PARKLGADDLNKNIIDAEYAVRGAIPMKAEELEIQLSQQPDLLPFNAITVANIGNPQQLD 95

Query: 94  QKPLTFYRQVLSILQYPELLE-----SGSNIFKKDAIERARKLLKEIG-SVGSYSSSQGI 147
           QKPLTF RQV+SILQYP LL+       S  +K+DA +RA  LL++IG SVG+YS +QG+
Sbjct: 96  QKPLTFSRQVVSILQYPPLLDYEEQLVTSGAYKRDAFKRAAVLLEQIGGSVGAYSLAQGV 155

Query: 148 PAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXX 207
             IR++VA+FIT+RD+GE ++P+DIFLT GAS A  YLLSILC++  +G++IPIPQYP  
Sbjct: 156 YGIRESVADFITRRDEGETASPDDIFLTDGASKAATYLLSILCRDSSTGIMIPIPQYPLY 215

Query: 208 XXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILS 267
                       PYYLDE  GWST   EIE+ + DS+ +G+ P  +V+INPGNPTG++LS
Sbjct: 216 TASITMYNSVMLPYYLDEESGWSTKAEEIEQQVIDSIKRGVTPRVIVVINPGNPTGAVLS 275

Query: 268 VESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFP-GEYDTVQLAS 326
            +++ +I+ +AA +GIV++ADEVYQ N++   KFHSMKKVLR+LQ+  P GEYD VQLAS
Sbjct: 276 FDTIAQILTIAAKYGIVVLADEVYQNNIYKGVKFHSMKKVLRSLQRDHPNGEYDNVQLAS 335

Query: 327 LHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQKG 386
           +HSTSKGVSGECGQRGGYMEL GF+ E++QVILKL SIS+C VVTGQALVDLM++PP++G
Sbjct: 336 MHSTSKGVSGECGQRGGYMELVGFSNEVRQVILKLASISICSVVTGQALVDLMLNPPREG 395

Query: 387 DESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQKS 446
           D+SYE D  ER  I N++  R  LL++ F  +EG+ CQ+P+GAMYLFPK+ L  K ++++
Sbjct: 396 DDSYELDVRERKEIHNNMKTRGYLLYDTFQKLEGIECQEPQGAMYLFPKLLLSKKAIEEA 455

Query: 447 QELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAEF 506
           + L + PDEFYC  LL+ TGICTVPGSGFGQ+ GTYH+RTTFLAPGT+WI  W  FH  F
Sbjct: 456 KSLGLQPDEFYCHRLLDTTGICTVPGSGFGQKEGTYHVRTTFLAPGTQWIKDWETFHKAF 515

Query: 507 YDKYRD 512
           YDKYRD
Sbjct: 516 YDKYRD 521

>NCAS0B03840 Chr2 (683781..685274) [1494 bp, 497 aa] {ON} Anc_8.263
           YDR111C
          Length = 497

 Score =  613 bits (1581), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/485 (58%), Positives = 371/485 (76%), Gaps = 7/485 (1%)

Query: 35  PAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG-QKLPFDTVINANIGNPQQLK 93
           PA KL + D+N+NV+ AK+A+RGSI ++AE+L++ L      LPFD +  ANIGNPQ+L 
Sbjct: 13  PAPKLSLKDINENVVDAKFAIRGSISIKAEDLQVQLNKNPHCLPFDEITVANIGNPQELN 72

Query: 94  QKPLTFYRQVLSILQYPELLE-----SGSNIFKKDAIERARKLLKEIG-SVGSYSSSQGI 147
           QKPLTF RQV+SILQYPELL      +   IF  D+ +RA +LL++IG SVG+YS+SQG+
Sbjct: 73  QKPLTFARQVVSILQYPELLNNRDVLTKEKIFNSDSFDRAERLLRDIGGSVGAYSASQGV 132

Query: 148 PAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXX 207
             IRKT A +ITKRD GE S P DIFLT GA+SA  YLLS+LC+  ++GVLIPIPQYP  
Sbjct: 133 YGIRKTAAEYITKRDGGEPSYPEDIFLTTGATSAASYLLSVLCRGPQTGVLIPIPQYPLY 192

Query: 208 XXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILS 267
                       PYYLDE   WST+  EIE+++ DS+ KGIKP+ +V+INPGNPTG++LS
Sbjct: 193 TATLALNKSTMIPYYLDEESAWSTNTTEIEKLVLDSIKKGIKPSVIVVINPGNPTGAVLS 252

Query: 268 VESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLASL 327
             ++ KI ++AA +GIV++ADEVYQEN+F+  +FHS KKVLR LQK +PG++D +QLAS+
Sbjct: 253 ELAIAKIFQIAAKYGIVVLADEVYQENIFDGVQFHSTKKVLRGLQKQYPGKFDNIQLASM 312

Query: 328 HSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQKGD 387
           HSTSKGV GECGQRGGYMEL GF  E++Q++LKL  +++C VVTGQA+VDLM+ PP+KGD
Sbjct: 313 HSTSKGVFGECGQRGGYMELVGFTDEVRQLLLKLACLAVCSVVTGQAMVDLMLLPPKKGD 372

Query: 388 ESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQKSQ 447
            SYE D+ ER  I + +  RA  L+  F+ ++G+ CQKP+GAMYL+P + L  K + K++
Sbjct: 373 ASYELDKKERQEIFDAMYERARKLYAMFDKLDGIECQKPQGAMYLYPSLILSKKAIAKAE 432

Query: 448 ELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAEFY 507
            L++TPDEFYC  LL+ATGICTVPGSGFGQ+ GTYHLRTTFLAPG EWI++W KFH  FY
Sbjct: 433 SLNLTPDEFYCHELLDATGICTVPGSGFGQKKGTYHLRTTFLAPGIEWINKWEKFHKHFY 492

Query: 508 DKYRD 512
           +KY+D
Sbjct: 493 EKYQD 497

>NDAI0J01360 Chr10 (313791..315296) [1506 bp, 501 aa] {ON} Anc_8.263
          Length = 501

 Score =  609 bits (1570), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/490 (59%), Positives = 372/490 (75%), Gaps = 10/490 (2%)

Query: 31  HNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG-QKLPFDTVINANIGNP 89
           H+  PA KL + DLN NV+KA++AVRG+IP++A+EL+  L      LPF+ +  ANIGNP
Sbjct: 11  HDFEPAPKLSIKDLNPNVIKAEFAVRGTIPMKAQELQTQLNKNPHSLPFNEITVANIGNP 70

Query: 90  QQLKQKPLTFYRQVLSILQYPELLESGSN-------IFKKDAIERARKLLKEIG-SVGSY 141
           Q+L QKPLTF RQV+SILQYPELL   +        I+  D+ +RA KLL EIG SVG+Y
Sbjct: 71  QELHQKPLTFARQVVSILQYPELLNRRNELTSTTPPIYNNDSFDRAEKLLNEIGGSVGAY 130

Query: 142 SSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPI 201
           S+SQG+  IRKT+AN+IT+RD GE ++PNDIF+T GA++A  YLLSIL    ++GVL+PI
Sbjct: 131 SASQGVYGIRKTIANYITQRDLGESASPNDIFMTTGATAASSYLLSILSNGPQTGVLLPI 190

Query: 202 PQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVIN-DSLDKGIKPTALVIINPGN 260
           PQYP              PYYL+E  GWS D NEIE+ I  +++ KGI+P  +VIINPGN
Sbjct: 191 PQYPLYTALLALHNATMLPYYLEEESGWSIDTNEIEKTIKKNAMTKGIQPKVMVIINPGN 250

Query: 261 PTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYD 320
           PTGSILS +S+ KI  +AA +GIVIIADEVYQEN+FN  KFHS KKVLR+LQK FP +Y+
Sbjct: 251 PTGSILSEDSLIKIFNIAAKYGIVIIADEVYQENLFNGNKFHSCKKVLRSLQKQFPTQYN 310

Query: 321 TVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMV 380
            VQLASLHSTSKG+ GECGQRGGYME+ GFN +++ +ILKL  I +CPVVTGQA++DLM+
Sbjct: 311 NVQLASLHSTSKGLFGECGQRGGYMEIIGFNNDVRNLILKLACIDVCPVVTGQAMMDLMI 370

Query: 381 SPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPF 440
            PP++GD+SY+ D +ER  I ND+ NRA  L++ F+ MEG+ CQKP+GAMYLFP++ L  
Sbjct: 371 LPPKQGDQSYQLDCIERQQIHNDMLNRAKKLYDMFSHMEGIQCQKPQGAMYLFPRLLLST 430

Query: 441 KVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWN 500
           KV+ ++++ ++ PDEFYC  LL  TGICTVPGSGFGQ+P TYHLRTTFLAPG +WI++W 
Sbjct: 431 KVIDEAKKFEMEPDEFYCHELLNETGICTVPGSGFGQKPNTYHLRTTFLAPGDQWINKWE 490

Query: 501 KFHAEFYDKY 510
           KFH  F  +Y
Sbjct: 491 KFHKAFLKRY 500

>KAFR0B05520 Chr2 (1130297..1131829) [1533 bp, 510 aa] {ON}
           Anc_8.263 YDR111C
          Length = 510

 Score =  607 bits (1565), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/490 (58%), Positives = 375/490 (76%), Gaps = 10/490 (2%)

Query: 31  HNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYL---EAGQKLPFDTVINANIG 87
           H+  PA K+ + DLN+ ++ A+YAVRGSI +RAEEL+  L         PF+ +I ANIG
Sbjct: 22  HDFEPAPKISVADLNQKIINAEYAVRGSIAMRAEELEFELYHKTQPHSFPFERIIYANIG 81

Query: 88  NPQQLKQKPLTFYRQVLSILQYPELLES-----GSNIFKKDAIERARKLLKEIG-SVGSY 141
           NPQQL QKPLTF RQV+SIL+YP LL+         I+KKDA+ERA  L  +IG SVG+Y
Sbjct: 82  NPQQLDQKPLTFSRQVMSILEYPGLLKFKDVLLSQGIYKKDALERAELLQSQIGASVGAY 141

Query: 142 SSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPI 201
           S +QG+  IR+T A FI+KRD+ E ++ +DIFLT GAS AV YL+  LC+NE +G+LIPI
Sbjct: 142 SLAQGVYGIRETTARFISKRDNCEAASADDIFLTDGASKAVTYLMMALCQNEHTGILIPI 201

Query: 202 PQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNP 261
           PQYP              PYYLDE  GWST + EIE  + ++++ GIKP+A+V+INPGNP
Sbjct: 202 PQYPLYTASICIHNAKMLPYYLDEESGWSTKVEEIENSVINAIENGIKPSAMVVINPGNP 261

Query: 262 TGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDT 321
           TG++LSV+ +++II VAA +GIV+IADEVYQ+N+FN  +FHSMKK+LR LQK +PG+YD 
Sbjct: 262 TGAVLSVDVIQRIITVAAKYGIVLIADEVYQDNIFN-GEFHSMKKILRQLQKKYPGKYDN 320

Query: 322 VQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVS 381
           VQLASLHSTSKGVSGECGQRGGYME+ GF+ E++ ++LKL SI++C VVTGQALVDLMV 
Sbjct: 321 VQLASLHSTSKGVSGECGQRGGYMEIVGFSDEVRHLLLKLASINICSVVTGQALVDLMVD 380

Query: 382 PPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFK 441
           PP  GDESYE+DQ ER+ I + L  RA  L++ F+++EG+ CQKP+GAMYLFP++ LP +
Sbjct: 381 PPHVGDESYEKDQEERNEIHSTLKKRADKLYDTFSNLEGIECQKPQGAMYLFPRLILPDR 440

Query: 442 VLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNK 501
            ++++++L +  DEFYC  LLE TGICTVPGSGFGQ+ GTYH+RTTFL+PGTEWID W K
Sbjct: 441 AIEEAKKLQMEADEFYCHKLLENTGICTVPGSGFGQREGTYHVRTTFLSPGTEWIDDWKK 500

Query: 502 FHAEFYDKYR 511
           FH +F  +Y+
Sbjct: 501 FHEKFMKEYQ 510

>Kpol_543.39 s543 complement(86358..87836) [1479 bp, 492 aa] {ON}
           complement(86358..87836) [1479 nt, 493 aa]
          Length = 492

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 296/487 (60%), Positives = 363/487 (74%), Gaps = 11/487 (2%)

Query: 35  PAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKL-YLEAGQKLPFDTVINANIGNPQQLK 93
           PA+KL ++DLN++ + A YAVRGSIP+RAE+L    +     LPFD +I ANIGNPQQ+ 
Sbjct: 5   PAEKLSVNDLNQHAVHADYAVRGSIPMRAEQLHAQIINDPGSLPFDKIITANIGNPQQVG 64

Query: 94  QKPLTFYRQVLSILQYP------ELLES--GSNIFKKDAIERARKLLKEIG-SVGSYSSS 144
           QKPLTF RQVLSIL+YP      ELLE      ++++D IERARK+L  IG SVG+YS+S
Sbjct: 65  QKPLTFIRQVLSILEYPNILNDPELLEKLVQLGVYQRDVIERARKMLDSIGGSVGAYSAS 124

Query: 145 QGIPAIRKTVANFITKRDD-GEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQ 203
           QG+   R+TVA+FI KRD   ++++PNDIFLT GASSAV YLLSILC   + GVLIPIPQ
Sbjct: 125 QGVLGFRQTVADFINKRDGCKQLASPNDIFLTGGASSAVHYLLSILCSGPEFGVLIPIPQ 184

Query: 204 YPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTG 263
           YP              PYYL E   WST+  EIE  I +S+  G+KP A+VIINPGNPTG
Sbjct: 185 YPLYTATLTLSNSTAIPYYLKEHTSWSTNTKEIEINIKESMANGVKPVAIVIINPGNPTG 244

Query: 264 SILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQ 323
           +ILS   +  II ++A +GI IIADEVYQEN+F   +FHSM+KVL NLQ  FPG YD VQ
Sbjct: 245 AILSESDLADIIRISAKYGIAIIADEVYQENIFPGFEFHSMRKVLLNLQSEFPGTYDNVQ 304

Query: 324 LASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPP 383
           LASLHSTSKG  GECGQRGGYMEL GF  E+  ++LKL SIS+C VVTGQAL+DL+  PP
Sbjct: 305 LASLHSTSKGFIGECGQRGGYMELIGFKDEVIAIVLKLASISICSVVTGQALMDLVTCPP 364

Query: 384 QKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVL 443
           Q GD SY+ DQ ER+ I  DL  RA  L+  F S+EGV CQ+P+GAMYLFPK+ LP K +
Sbjct: 365 QPGDASYKLDQEERNKIKQDLMFRADRLYGLFTSLEGVECQRPQGAMYLFPKLILPDKAI 424

Query: 444 QKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFH 503
           +K+ +L+I PDE+YC+ LL+ATGICTVPGSGFGQ PGTYHLRTTFL PGTEWI+RW +FH
Sbjct: 425 EKALQLEIPPDEYYCRELLDATGICTVPGSGFGQDPGTYHLRTTFLVPGTEWIERWREFH 484

Query: 504 AEFYDKY 510
            +FY+++
Sbjct: 485 QQFYERF 491

>TPHA0A01800 Chr1 (364262..365758) [1497 bp, 498 aa] {ON} Anc_8.263
           YDR111C
          Length = 498

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/494 (58%), Positives = 362/494 (73%), Gaps = 10/494 (2%)

Query: 28  EHKHNVYPAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAGQK-LPFDTVINANI 86
           EH  +  P  K+ + DLN  ++K +YAVRG IP RAEELKL LE   K LPF+ +INANI
Sbjct: 4   EHFTDFTPVAKVTLKDLNSKIIKTQYAVRGPIPARAEELKLQLEKDPKSLPFNKIINANI 63

Query: 87  GNPQQLKQKPLTFYRQVLSILQYPELLESGS--------NIFKKDAIERARKLLKEIG-S 137
           GNPQQL QKPL+F R+VLSILQYP++LE  S         +++KD + RARKLL EIG S
Sbjct: 64  GNPQQLGQKPLSFIRKVLSILQYPDILEDESKLQTLIELRVYQKDVVRRARKLLGEIGGS 123

Query: 138 VGSYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGV 197
           VG+YS SQG+P I++TVA++ITKRD GE++ P DIFLT GASSAV ++L + C    +GV
Sbjct: 124 VGAYSLSQGVPGIQQTVADYITKRDSGEVAYPEDIFLTTGASSAVSFILPMFCNGPTTGV 183

Query: 198 LIPIPQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIIN 257
           LIPIPQYP               YYL+E   WS +  E+E  I +S+  GIKPT +VIIN
Sbjct: 184 LIPIPQYPLYTATITLVGATAISYYLNEEDNWSVNTVEMENTIQESIKSGIKPTTIVIIN 243

Query: 258 PGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPG 317
           PGNPTGSIL+ + +  II ++A +G++IIADEVYQENVF+  +FHS+KKVLR LQ+ + G
Sbjct: 244 PGNPTGSILTEKDIANIIRISAKYGLLIIADEVYQENVFSGNEFHSVKKVLRKLQRKYLG 303

Query: 318 EYDTVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVD 377
            Y+TVQLASLHSTSKG+ GECGQRGGYMEL G   +++  ++KL SIS+C VVTGQAL+D
Sbjct: 304 FYETVQLASLHSTSKGLIGECGQRGGYMELIGLTDDVRLEVVKLMSISICSVVTGQALID 363

Query: 378 LMVSPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKID 437
           ++VSPP+ GDESYE DQLER+ I NDL +R+  L + F S+EGV C +P+GAMYLFPK  
Sbjct: 364 MVVSPPRPGDESYEMDQLERNNIKNDLISRSQKLHQLFISLEGVECLRPQGAMYLFPKFI 423

Query: 438 LPFKVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWID 497
            P K +  +Q+L    D  YCK LLE TGICTVPGSGFGQ+P TYHLRTTFL PG  WID
Sbjct: 424 FPQKFIDIAQKLHTEADTLYCKELLEHTGICTVPGSGFGQKPNTYHLRTTFLVPGDSWID 483

Query: 498 RWNKFHAEFYDKYR 511
            W KFH EF ++YR
Sbjct: 484 LWRKFHTEFCERYR 497

>AGR085W Chr7 (887023..888588) [1566 bp, 521 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR089C (ALT1) and
           YDR111C (ALT2)
          Length = 521

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/484 (59%), Positives = 363/484 (75%), Gaps = 7/484 (1%)

Query: 35  PAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAGQ-KLPFDTVINANIGNPQQLK 93
           PA+ + + D+N+NV+KAKYAVRG IP RAEEL+  LE     LPF  +I ANIGNPQQL 
Sbjct: 39  PAEPMTLADVNENVVKAKYAVRGKIPTRAEELERRLEEHPGSLPFSKIIQANIGNPQQLG 98

Query: 94  QKPLTFYRQVLSILQYPELLESGS----NIFKKDAIERARKLLKEIG-SVGSYSSSQGIP 148
           QKPLTFYRQV+S++Q P+LLE  +      FK D + RAR++L++ G SVG+YS+SQG+ 
Sbjct: 99  QKPLTFYRQVISLMQNPQLLEMPAEWLQQAFKADVVVRARRMLQDAGGSVGAYSASQGVK 158

Query: 149 AIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXX 208
             R+TVA FI +RD G  + P++++LTAGASSAV  LLS  CK  ++GVLIPIPQYP   
Sbjct: 159 GYRRTVAQFIERRD-GIPANPDNVYLTAGASSAVSCLLSTFCKGPETGVLIPIPQYPLYT 217

Query: 209 XXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSV 268
                      PYYL+E+ GWST+ +E+E VI DS  + I P  LV+INPGNPTGS+LSV
Sbjct: 218 ATITQNNAVALPYYLNEADGWSTNPDEMERVILDSKKRNIAPKCLVVINPGNPTGSVLSV 277

Query: 269 ESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLASLH 328
           + ME I+ +AA +GIV+IADEVYQ+NVF +AKFHSM+KVL+NLQ   P  Y  VQLASLH
Sbjct: 278 KDMEAILTLAAKYGIVVIADEVYQDNVFGDAKFHSMRKVLKNLQLREPTLYKNVQLASLH 337

Query: 329 STSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQKGDE 388
           S SKG+SGECGQRGGYMEL GF  E+++V +KL SISLCPVVTGQALVDLMV PP +GD 
Sbjct: 338 SISKGLSGECGQRGGYMELIGFREELRKVFVKLASISLCPVVTGQALVDLMVGPPSQGDP 397

Query: 389 SYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQKSQE 448
           SYEQ   E  +I ++L  R+ LLW+ F S+EG+ C  P+GA+YLFPK+ LP K ++ +Q+
Sbjct: 398 SYEQYTQETRSIYHELEERSQLLWKTFCSLEGIECNMPQGALYLFPKLHLPQKAIEAAQK 457

Query: 449 LDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAEFYD 508
           L I  DE YC  LL+ TGICTVPG+GFGQ PGTYH+RTTFL PGT+WI+ W  FH +FYD
Sbjct: 458 LGIPADELYCSELLDETGICTVPGTGFGQIPGTYHVRTTFLPPGTKWIESWKDFHKKFYD 517

Query: 509 KYRD 512
           KYRD
Sbjct: 518 KYRD 521

>Ecym_4307 Chr4 (652209..653813) [1605 bp, 534 aa] {ON} similar to
           Ashbya gossypii AGR085W
          Length = 534

 Score =  588 bits (1515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/484 (58%), Positives = 361/484 (74%), Gaps = 7/484 (1%)

Query: 35  PAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLEAG-QKLPFDTVINANIGNPQQLK 93
           P   L+++DLN NVL+AKYAVRG IP RA EL+  L      LPF  +I ANIGNPQQL 
Sbjct: 52  PGDPLKLEDLNSNVLEAKYAVRGKIPARAMELERQLSRDPDSLPFKKIIYANIGNPQQLG 111

Query: 94  QKPLTFYRQVLSILQYPELL----ESGSNIFKKDAIERARKLLKEI-GSVGSYSSSQGIP 148
           QKPL+F R+VLS+L+ P LL    E  + I+K DA+ RA+++++++  S+G+YS SQG+ 
Sbjct: 112 QKPLSFSREVLSLLESPNLLQMPMEVLNLIYKPDAVRRAKRMMRDLQTSIGAYSHSQGVL 171

Query: 149 AIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXX 208
             RKTVA +++ RD GE ++  DIFLT GAS+    ++ +LCK ++SGVLIPIPQYP   
Sbjct: 172 GFRKTVAEYLSSRD-GEPASAEDIFLTTGASNGASLMIELLCKGQESGVLIPIPQYPLYT 230

Query: 209 XXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSV 268
                      PYYLDE  GWS +I+++E +I +S++KG+KP  LV+INPGNPTG+IL V
Sbjct: 231 ATITLNNTVALPYYLDEESGWSLNIDDLERIIIESIEKGVKPACLVVINPGNPTGAILPV 290

Query: 269 ESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLASLH 328
           ESME+I  +AA + IV+IADEVYQENVF   KF+SMKKVLR+LQ+ +   +  VQL SLH
Sbjct: 291 ESMERIFVIAAKYSIVVIADEVYQENVFEGLKFYSMKKVLRSLQRRYKELFSNVQLVSLH 350

Query: 329 STSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQKGDE 388
           STSKG+SGECGQRGGYMEL GF+ +I++VILK+ SI LC  V GQALVDLM+S P+ GDE
Sbjct: 351 STSKGLSGECGQRGGYMELVGFSDDIREVILKMASIQLCSPVGGQALVDLMLSRPKPGDE 410

Query: 389 SYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPFKVLQKSQE 448
           SYE+D  ERS+I N L  R+  LWE FN++EGV C+KP+G+MYLFP++ LP K ++ ++ 
Sbjct: 411 SYERDLSERSSIRNALQERSKSLWETFNNLEGVECRKPQGSMYLFPRLVLPQKAIKAAES 470

Query: 449 LDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWNKFHAEFYD 508
           LD+ PDEFYC  LL +TGICTVPGSGFGQ P T HLRTTFL PGTEWI+ W  FH  FYD
Sbjct: 471 LDMQPDEFYCTELLNSTGICTVPGSGFGQAPDTCHLRTTFLCPGTEWIESWELFHKSFYD 530

Query: 509 KYRD 512
           KYRD
Sbjct: 531 KYRD 534

>TBLA0F03060 Chr6 (743646..745148) [1503 bp, 500 aa] {ON} Anc_8.263
           YDR111C
          Length = 500

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 288/491 (58%), Positives = 370/491 (75%), Gaps = 14/491 (2%)

Query: 35  PAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKL-YLEAGQKLPFDTVINANIGNPQQLK 93
           PA K  ++D+N+++LKA+YA+RG+IP RAEEL +  LE  + LPF  ++ ANIGNPQQL 
Sbjct: 10  PAPKFSLNDINESILKAEYAIRGTIPNRAEELDIQLLENSKSLPFAKIVYANIGNPQQLD 69

Query: 94  QKPLTFYRQVLSILQYPELLES-----GSNIFKKDAIERARKLLKEIG-SVGSYSSSQGI 147
           Q+PLTF RQV+S++Q+P+LL+S        I+ KD+IERA KLL  IG SVG+YSSSQG+
Sbjct: 70  QQPLTFQRQVMSLVQFPDLLKSKDILLAQKIYSKDSIERATKLLNSIGGSVGAYSSSQGV 129

Query: 148 PAIRKTVANFITKRD-------DGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIP 200
             IRK VA FI KRD       D    T +++FLTAGAS+AVD++L +  K+E  GVL+P
Sbjct: 130 LDIRKNVARFILKRDLHHDPTQDLIDETASNVFLTAGASTAVDHILPLFAKDESCGVLLP 189

Query: 201 IPQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGN 260
           IPQYP              PYYL+ES  WSTD  +IE+++ D++ + IKPT LV+INPGN
Sbjct: 190 IPQYPLYTAAVTLQKSKLLPYYLNESNNWSTDPKQIEQIVIDAIKQNIKPTTLVVINPGN 249

Query: 261 PTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYD 320
           PTG+IL+ +S+  II++AA +GIVIIADEVYQENV+   +FHS KKVL  L+K +P +YD
Sbjct: 250 PTGAILTKDSIIDIIDIAAEYGIVIIADEVYQENVYEAFEFHSFKKVLSELRKNYPSKYD 309

Query: 321 TVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMV 380
            VQLASLHS SKGV+GECGQRGGYME+TGF+ ++K+V+LK+ SIS+C VVTGQ LVDLMV
Sbjct: 310 NVQLASLHSISKGVNGECGQRGGYMEITGFSNDVKKVLLKVASISICSVVTGQILVDLMV 369

Query: 381 SPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDLPF 440
           +PPQ GDESYE DQLERS I ++L  ++  L++ F  + G+SCQKP+GAMYLFP++ L  
Sbjct: 370 NPPQPGDESYELDQLERSVIHSNLILKSNTLYDVFTRLPGISCQKPQGAMYLFPRLHLSE 429

Query: 441 KVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDRWN 500
             +  + EL++ PDEFYC  LLE TGICTVPGSGFGQ PGTYHLRTTFL PG EWI+ W 
Sbjct: 430 NAINAATELNLKPDEFYCLKLLENTGICTVPGSGFGQYPGTYHLRTTFLPPGIEWINSWE 489

Query: 501 KFHAEFYDKYR 511
           KFH EF +KY+
Sbjct: 490 KFHLEFMEKYK 500

>TBLA0G01630 Chr7 (428016..429518) [1503 bp, 500 aa] {ON} 
          Length = 500

 Score =  552 bits (1422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/493 (54%), Positives = 360/493 (73%), Gaps = 16/493 (3%)

Query: 35  PAQKLRMDDLNKNVLKAKYAVRGSIPLRAEELKLYLE-AGQKLPFDTVINANIGNPQQLK 93
           PA K  ++D+++++L  +YA+RG+IP RA+EL+  L  +  +LPF  +I ANIGNPQQL+
Sbjct: 8   PAPKFSLNDISQSILDTEYAIRGTIPTRADELQEQLNISPNQLPFKKIIYANIGNPQQLE 67

Query: 94  QKPLTFYRQVLSILQYPELLESGS-----NIFKKDAIERARKLLKEIG-SVGSYSSSQGI 147
           Q+PLTF RQVLS+++YP L+ S +      I+  DAI+RA  +L  IG SVG+YSSSQGI
Sbjct: 68  QEPLTFQRQVLSLVEYPNLVNSKNILVENKIYAPDAIKRAETILNSIGGSVGAYSSSQGI 127

Query: 148 PAIRKTVANFITKRDDGEIS---------TPNDIFLTAGASSAVDYLLSILCKNEKSGVL 198
            +IRK VA  I +RD+ E+          T ++IFLT GA++AV Y+L +  K+E  GVL
Sbjct: 128 LSIRKNVAKCILQRDNDELCCNDEELINETASNIFLTDGATTAVSYILPLFAKDENCGVL 187

Query: 199 IPIPQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINP 258
           +PIPQYP              PYYL+E + WSTD  EIE +I D++ + IKPT LVIINP
Sbjct: 188 LPIPQYPLYTAAVTLQNSKLLPYYLNEDENWSTDPEEIETIIKDAISRNIKPTTLVIINP 247

Query: 259 GNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGE 318
           GNPTG+ILSVES+ +II +AA +GIVIIADEVYQ N++ + KFHS KK+L +L+  +P +
Sbjct: 248 GNPTGAILSVESITQIINIAAKYGIVIIADEVYQNNIYQDFKFHSFKKILNSLKLQYPKK 307

Query: 319 YDTVQLASLHSTSKGVSGECGQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDL 378
           YD VQLASLHS SKGV+GECGQRGGY EL GF+ EIK++ILKL SI +C VVTGQ LVDL
Sbjct: 308 YDNVQLASLHSISKGVNGECGQRGGYFELLGFSDEIKKIILKLASIDICSVVTGQILVDL 367

Query: 379 MVSPPQKGDESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYLFPKIDL 438
           M  PP+KGD SY+ DQ ER+ I ++L  ++  L++ F+ + G+SCQKP+GAMYLFP++ L
Sbjct: 368 MSKPPEKGDYSYKLDQRERNNIQSNLILKSNTLYDLFSRLPGISCQKPQGAMYLFPRLHL 427

Query: 439 PFKVLQKSQELDITPDEFYCKALLEATGICTVPGSGFGQQPGTYHLRTTFLAPGTEWIDR 498
              ++ +++  ++ PDEFYC  LLE TGICTVPGSGFGQ+ GTYH+RTTFL  G EWI  
Sbjct: 428 TSNMINEAKLNNLEPDEFYCLKLLENTGICTVPGSGFGQKEGTYHVRTTFLPSGIEWIKL 487

Query: 499 WNKFHAEFYDKYR 511
           W KFH EF ++Y+
Sbjct: 488 WEKFHLEFMNQYK 500

>TPHA0O01450 Chr15 complement(291591..292922) [1332 bp, 443 aa] {ON}
           Anc_1.321 YJL060W
          Length = 443

 Score = 55.8 bits (133), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 51/184 (27%), Positives = 88/184 (47%), Gaps = 17/184 (9%)

Query: 122 KDAIERARKLLKEIGSVGSYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSA 181
           K AIE  +K ++E   V  YS ++G P + K++ +  +      +  P ++ +T GA+  
Sbjct: 69  KFAIEALQKAVEE-PLVNQYSPTRGRPTLIKSLTDLYSPLYKLTLK-PENVLVTTGANEG 126

Query: 182 V-DYLLSILCKNEKSGVLIPI-PQYPXXXXX---XXXXXXXXXPYYLDE--SKG--WSTD 232
           +   L+ IL +N++  V  P   QY                  P  LD+  +KG  W+ D
Sbjct: 127 ILACLMGILNQNDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKDLDKRVTKGTEWTLD 186

Query: 233 INEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQ 292
             + E VI +      K  A++I  P NP G + + E +++I ++   H ++II+DEVY 
Sbjct: 187 FEQFENVITN------KTKAIIINTPHNPIGKVFTREELKRIGDICVKHNVIIISDEVYD 240

Query: 293 ENVF 296
              F
Sbjct: 241 NLYF 244

>Kwal_34.16018 s34 (159210..160349) [1140 bp, 379 aa] {ON} YJL060W
           (BNA3) - YJL060W [contig 272] FULL
          Length = 379

 Score = 55.5 bits (132), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 47/169 (27%), Positives = 78/169 (46%), Gaps = 19/169 (11%)

Query: 140 SYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLI 199
           +Y + QG  A+RK +A   +  +D  +S  N + LT GA +A ++L       +    + 
Sbjct: 54  TYGAIQGSHALRKLIAEMYSN-EDVTLSEEN-VILTNGAIAA-NFLTHYTLAGKGDHFIC 110

Query: 200 PIPQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKP-TALVIIN- 257
             P Y                 +L +   +  +I E+E +I        KP T  +++N 
Sbjct: 111 ISPTYQQLSSIPQMFGAEVELLHLRKETNYQPNIVELERMI--------KPNTKCIVLNT 162

Query: 258 PGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMKK 306
           P NP  S++  E++ +I E+A  HGIV+  DEVY      +  FHS +K
Sbjct: 163 PNNPLSSVIPTETLREIAELADKHGIVVFCDEVY------SPLFHSCEK 205

>ZYRO0G20636g Chr7 complement(1700506..1701867) [1362 bp, 453 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 453

 Score = 55.1 bits (131), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 84/370 (22%), Positives = 139/370 (37%), Gaps = 53/370 (14%)

Query: 124 AIERARKLLKEIGSVGSYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVD 183
           AI  A+K L EI  V  YS ++G P++  ++    +     E+   N    T      + 
Sbjct: 79  AIHEAQKAL-EIPLVNQYSPTKGRPSVINSLKKLYSPLYGQELKDENVTITTGANEGILS 137

Query: 184 YLLSILCKNEKSGVLIP-----IPQYPXXXXXXXXXXXXXXPYYLD----ESKGWSTDIN 234
            L+ IL   ++  V  P     IP                 P  +D    E K W+ D  
Sbjct: 138 SLMGILNPGDEVIVFEPFFDQYIPNI-ELLGGKVVYVPINPPKDMDQRIVEGKDWTIDYE 196

Query: 235 EIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQEN 294
           E+ +          K  AL++  P NP G + + E + KI  +   + +VII+DEVY+  
Sbjct: 197 ELAKAFTS------KTKALILNTPHNPIGKVFTKEELTKIGNLCVENNVVIISDEVYEFL 250

Query: 295 VFNNAKFHSMKKVLRNLQKAFPGEYDTVQLASLHSTSKGVSGECGQRGGYMELTGFNPEI 354
            F ++           +    P   +  QL     ++       G R G++     NPE+
Sbjct: 251 YFTDS--------YTRIATLSP---EIGQLTLTVGSAGKTFAATGWRIGWV--ISLNPEL 297

Query: 355 KQVILK----LCSISLCPVVTGQALVDLMVSPPQKGD--ESYEQDQLERSTILNDLSNRA 408
              + K    +C  S  P+   Q  V   +    KGD  E+   D + +  I   +    
Sbjct: 298 LSYVSKGHTRICFSSPSPI---QEAVANSIEDALKGDYFEAMRTDYIRKFEIFTSV---- 350

Query: 409 ILLWEAFNSMEGVSCQKPEGAMYL---FPKIDLPFKVLQKSQELDITPDEFYCKALLEAT 465
                 F  M G+    PEG  ++   F K+++P       + LD   D      L+   
Sbjct: 351 ------FKEM-GLPYTIPEGTYFILVDFSKVNVPEDYPYPEELLDKGKDFRISYWLINEL 403

Query: 466 GICTVPGSGF 475
           G+  +P + F
Sbjct: 404 GVVAIPPTEF 413

>Suva_6.136 Chr6 complement(227366..228700) [1335 bp, 444 aa] {ON}
           YJL060W (REAL)
          Length = 444

 Score = 54.3 bits (129), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 50/201 (24%), Positives = 88/201 (43%), Gaps = 19/201 (9%)

Query: 111 ELLESGSNIFK----KDAIERARKLLKEIGSVGSYSSSQGIPAIRKTVANFITKRDDGEI 166
           EL+  G   F     + AI+ A+K L EI  V  YS ++G P++  ++ +  T   + E+
Sbjct: 55  ELINLGQGFFSYSPPQFAIKEAQKAL-EIPLVNQYSPTRGRPSLINSLIDLYTPIYNKEL 113

Query: 167 STPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPI-PQYPXXXXX---XXXXXXXXXPYY 222
              N +  T      +  L+ +L   ++  V  P   QY                  P  
Sbjct: 114 KAENVVVTTGANEGILSCLMGLLNSGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKE 173

Query: 223 LDE--SKG--WSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVA 278
           LD+  ++G  W+ D  + E+ I        K  A++I  P NP G + + + +  +  + 
Sbjct: 174 LDQRNTRGEEWTIDFEQFEKAITS------KTKAVIINTPNNPIGKVFTHDELTTLGNIC 227

Query: 279 ATHGIVIIADEVYQENVFNNA 299
             H +VII+DEVY+   F ++
Sbjct: 228 VKHNVVIISDEVYEHLYFTDS 248

>Skud_10.156 Chr10 complement(294149..295531) [1383 bp, 460 aa] {ON}
           YJL060W (REAL)
          Length = 460

 Score = 53.1 bits (126), Expect = 9e-07,   Method: Compositional matrix adjust.
 Identities = 51/201 (25%), Positives = 85/201 (42%), Gaps = 19/201 (9%)

Query: 111 ELLESGSNIFK----KDAIERARKLLKEIGSVGSYSSSQGIPAIRKTVANFITKRDDGEI 166
           EL+  G   F     + AI+ A+K L EI  V  YS ++G P++  ++    +   D ++
Sbjct: 71  ELINLGQGFFSYSPPQFAIKEAQKAL-EIPLVNQYSPTRGRPSLINSLIKLYSPIYDTDL 129

Query: 167 STPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPI-PQYPXXXXX---XXXXXXXXXPYY 222
              N    T      +  L+ +L   ++  V  P   QY                  P  
Sbjct: 130 RAENVTVTTGANEGILSCLMGLLNSGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKE 189

Query: 223 LDE--SKG--WSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVA 278
           LD+  +KG  W+ D  + E  I        K  A++I  P NP G + + E +  +  + 
Sbjct: 190 LDQRNTKGEEWTIDFEQFENAITS------KTKAVIINTPHNPIGKVFTREELTTLGNIC 243

Query: 279 ATHGIVIIADEVYQENVFNNA 299
             H +VII+DEVY+   F ++
Sbjct: 244 VKHNVVIISDEVYEHLFFTDS 264

>KLTH0G19646g Chr7 complement(1699421..1700560) [1140 bp, 379 aa]
           {ON} conserved hypothetical protein
          Length = 379

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 39/152 (25%), Positives = 70/152 (46%), Gaps = 9/152 (5%)

Query: 140 SYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLI 199
           +Y S  G P +R  VA  I   D+ ++ T +++ +T GA  A ++L+          ++ 
Sbjct: 54  TYGSIWGTPVLRDLVAK-IHSSDEIQL-TADNVLITNGAIGA-NFLVHYTAAGPGDHIIC 110

Query: 200 PIPQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPG 259
             P Y                 +L+   G++ +I +++  +            +V+ NP 
Sbjct: 111 VDPTYQQLSSVPSMFGADVELLHLEAEDGYTPNIQKLKSKVR------ANTKYIVLNNPN 164

Query: 260 NPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
           NP GS++S E M +II+ A  + I I+ DEVY
Sbjct: 165 NPLGSVISTEKMTEIIDYAERNEIFIVCDEVY 196

>NDAI0G05760 Chr7 (1427844..1429190) [1347 bp, 448 aa] {ON}
           Anc_1.321
          Length = 448

 Score = 52.8 bits (125), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 87/392 (22%), Positives = 151/392 (38%), Gaps = 67/392 (17%)

Query: 111 ELLESGSNIFK----KDAIERARKLLKEIGSVGSYSSSQGIPAIRKTVANFITKRDDGEI 166
           EL+  G   F     + AI+ A+K L EI  V  YS ++G  ++  ++    +     E+
Sbjct: 59  ELINLGQGFFSYSPPQFAIKEAQKAL-EIPLVNQYSPTRGRASLLNSLIKLYSPFYGKEL 117

Query: 167 STPNDIFLTAGASSAV-DYLLSILCKNEKSGVLIPI-PQYPXXXXXXXXXXXXXX---PY 221
              N I +T GA+  +   L+ +L   ++  V  P   QY                  P 
Sbjct: 118 KQEN-ITITTGANEGILSCLMGLLNAGDEVIVFEPFFDQYISNIELMGGKVVYVPINPPK 176

Query: 222 YLD----ESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEV 277
            LD    E   W+ D  +    I        K  A+++ +P NP G + + E + K+ E+
Sbjct: 177 DLDQRITEGTEWTIDFEQFRNAITP------KTKAVIVNSPHNPIGKVFTKEELTKLGEI 230

Query: 278 AATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLASLHSTSKGVSGE 337
              + ++II+DEVY+   FN++                       ++A+L      ++  
Sbjct: 231 CVENNVIIISDEVYEFLYFNDS---------------------FTRIATLSPEIGQLTLT 269

Query: 338 CGQRGGYMELTGF--------NPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQKGDES 389
            G  G     TG+        NPE+ Q + K     +C             SP Q+   +
Sbjct: 270 VGSAGKTFAATGWRIGWVISQNPELLQYVSK-AHTRICFASP---------SPLQEACAN 319

Query: 390 YEQDQLERSTILNDLSNRAILLWEAFNSME---GVSCQKPEGAMYL---FPKIDLPFKVL 443
              D LE S     +    +  ++ FN++    G+   KPEG  ++   F K+ +P    
Sbjct: 320 SINDALE-SGYFEKMRKEYVQKFKIFNAVFEELGLPYTKPEGTYFVLADFSKVKIPEDYP 378

Query: 444 QKSQELDITPDEFYCKALLEATGICTVPGSGF 475
              + LD   D      L+   G+  +P + F
Sbjct: 379 WPEEILDKGKDFRISHWLINELGVVAIPPTEF 410

>YJL060W Chr10 (323386..324720) [1335 bp, 444 aa] {ON}
           BNA3Kynurenine aminotransferase, catalyzes formation of
           kynurenic acid from kynurenine; potential Cdc28p
           substrate
          Length = 444

 Score = 51.2 bits (121), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 49/201 (24%), Positives = 86/201 (42%), Gaps = 19/201 (9%)

Query: 111 ELLESGSNIFK----KDAIERARKLLKEIGSVGSYSSSQGIPAIRKTVANFITKRDDGEI 166
           EL+  G   F     + AI+ A+K L +I  V  YS ++G P++  ++    +   + E+
Sbjct: 55  ELINLGQGFFSYSPPQFAIKEAQKAL-DIPMVNQYSPTRGRPSLINSLIKLYSPIYNTEL 113

Query: 167 STPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPI-PQYPXXXXX---XXXXXXXXXPYY 222
              N    T      +  L+ +L   ++  V  P   QY                  P  
Sbjct: 114 KAENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPKE 173

Query: 223 LDE--SKG--WSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVA 278
           LD+  ++G  W+ D  + E+ I        K  A++I  P NP G + + E +  +  + 
Sbjct: 174 LDQRNTRGEEWTIDFEQFEKAITS------KTKAVIINTPHNPIGKVFTREELTTLGNIC 227

Query: 279 ATHGIVIIADEVYQENVFNNA 299
             H +VII+DEVY+   F ++
Sbjct: 228 VKHNVVIISDEVYEHLYFTDS 248

>Smik_10.180 Chr10 (315030..316364) [1335 bp, 444 aa] {ON} YJL060W
           (REAL)
          Length = 444

 Score = 50.1 bits (118), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 48/201 (23%), Positives = 86/201 (42%), Gaps = 19/201 (9%)

Query: 111 ELLESGSNIFK----KDAIERARKLLKEIGSVGSYSSSQGIPAIRKTVANFITKRDDGEI 166
           EL+  G   F     + AI+  +K L EI  V  YS ++G P++  ++    +   + ++
Sbjct: 55  ELINLGQGFFSYSPPQFAIKECQKAL-EIPLVNQYSPTRGRPSLINSLIKLYSPIYNKDL 113

Query: 167 STPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPI-PQYPXXXXX---XXXXXXXXXPYY 222
           +T N    T      +  L+ +L   ++  V  P   QY                  P  
Sbjct: 114 TTENVTVTTGANEGILSCLMGLLNAGDEVIVFEPFFDQYISNIELCGGKVVYVPINPPKE 173

Query: 223 LD--ESKG--WSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVA 278
           LD   ++G  W+ D  + E+ I        K  A++I  P NP G + + E +  +  + 
Sbjct: 174 LDLRNTRGEEWTIDFEQFEKAITP------KTKAVIINTPHNPIGKVFTREELTTLGNIC 227

Query: 279 ATHGIVIIADEVYQENVFNNA 299
             H ++II+DEVY+   F ++
Sbjct: 228 VKHNVIIISDEVYEHLYFTDS 248

>KNAG0B05320 Chr2 (1028845..1030146) [1302 bp, 433 aa] {ON}
           Anc_1.321 YJL060W
          Length = 433

 Score = 49.7 bits (117), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 53/201 (26%), Positives = 87/201 (43%), Gaps = 21/201 (10%)

Query: 111 ELLESGSNIFKKD----AIERARKLLKEIGSVGSYSSSQGIPAIRKTVANFITKRDDGEI 166
           E++  G   F       AI   ++ L EI     YS ++G P + K +A+  T     ++
Sbjct: 44  EMINMGQGFFSYSPPHFAISDVQQAL-EIPLANQYSPTRGRPNLIKALADLYTPLYGQQL 102

Query: 167 STPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPI-PQYPXXXXXX---XXXXXXXXPYY 222
           S  N    T    +    L+ +L K ++  V  P   QY                  P  
Sbjct: 103 SADNITVHTGANEAIFSCLMGLLNKGDEVIVFEPFFDQYISNIELAGGVVRYVPINPPRE 162

Query: 223 LDE--SKG--WSTDINEIEEVINDSLDKGIKPTALVIIN-PGNPTGSILSVESMEKIIEV 277
           LD+  ++G  W  D + +E+ IN         T  VIIN P NP G + + E + ++ ++
Sbjct: 163 LDDRVTRGTEWEIDWDILEKTINSR-------TKCVIINTPHNPIGKVFTREELLRLGKI 215

Query: 278 AATHGIVIIADEVYQENVFNN 298
              + IVII+DEVY+   F++
Sbjct: 216 CVDNNIVIISDEVYEHLYFSD 236

>KLLA0F10021g Chr6 (926569..928062) [1494 bp, 497 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 497

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 55/216 (25%), Positives = 91/216 (42%), Gaps = 18/216 (8%)

Query: 141 YSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIP 200
           Y  SQG P I K      +   D +     D+  T G + A + +L I C N    +L  
Sbjct: 105 YGYSQGQPEITKFFKEHHSLIHDMKYEN-WDVLATIGNTGAWESVLRIFC-NRGDTILAE 162

Query: 201 IPQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPG- 259
              +               P  LDE        +++E ++++  +   KP  L  +  G 
Sbjct: 163 QFAFSSSISAAEAQGVNVFPIPLDEH---GIIPSKLETILDNWTEGAAKPKLLYTVPTGQ 219

Query: 260 NPTGSILSVESMEKIIEVAATHGIVIIAD--------EVYQENVFNNA--KFHSMKKVLR 309
           NPTGS LS +  E+I  +A  H  +II D        E Y+++  N     +   K+ ++
Sbjct: 220 NPTGSSLSFDRKEEIYRIAQKHDFIIIEDEPYYFLQMEKYEKDPANRVVKSYADHKEFIQ 279

Query: 310 NLQKAFPGEYDTVQLASLHSTSKGVSGECGQRGGYM 345
           NL+K+F       ++  L S SK ++   G R G++
Sbjct: 280 NLEKSFVSIDTEGRVLRLDSLSKVLA--PGTRFGWI 313

>CAGL0J05126g Chr10 complement(487452..488753) [1302 bp, 433 aa]
           {ON} highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060w
          Length = 433

 Score = 48.9 bits (115), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 83/392 (21%), Positives = 156/392 (39%), Gaps = 67/392 (17%)

Query: 111 ELLESGSNIFK----KDAIERARKLLKEIGSVGSYSSSQGIPAIRKTVANFITKRDDGEI 166
           EL+  G   F     + AI  A+  L ++  V  YS ++G P++ K++   + K   G+ 
Sbjct: 44  ELINLGQGFFSYSPPQFAINAAKSAL-DVPLVNQYSPTRGRPSLIKSLVE-LYKPVFGDF 101

Query: 167 STPNDIFLTAGASSAV-DYLLSILCKNEKSGVLIPI-PQYPXXXXXXXXXXXXXXPYYLD 224
               ++ +T GA+  +   L+ IL   ++  V  P   QY                +   
Sbjct: 102 IDNQNVLVTTGANEGILSCLMGILNAGDEVIVFEPFFDQYIPNIELCGGVVRYVPIHPPK 161

Query: 225 ESKG-------WSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEV 277
           E K        W  D + +E+  N+      K  A++I  P NP G + + + + K+ ++
Sbjct: 162 EMKTRNTTGDEWQIDWDALEKTFNN------KTKAVIINTPHNPIGKVFTEQELTKLAQL 215

Query: 278 AATHGIVIIADEVYQENVFNNA--KFHSMKKVLRNLQKAFPGEYDTVQLASLHSTSKGVS 335
              H  V+I+DEVY+   F  +  +  ++ + + NL              +L   S G S
Sbjct: 216 CVEHNTVVISDEVYEHLYFTESFPRIANINEDIANL--------------TLTVGSAGKS 261

Query: 336 -GECGQRGGYM-----ELTGFNPEIKQVILKLCSISLCPV---VTGQALVDLMVSPPQKG 386
               G R G++     +L  +   + +   ++C  S  P+     G     L +    K 
Sbjct: 262 FAATGWRIGWIISKNDQLLNY---VSKAHTRICFASPSPLQEACAGSIEHALKIDYFPKM 318

Query: 387 DESYEQDQLERSTILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYL---FPKIDLPFKVL 443
            E Y +              +  +L  AF+ + G++  +PEG  ++   F K+ +P   +
Sbjct: 319 REEYRK--------------KFEILTTAFDKL-GLNYTQPEGTYFILVDFSKVKIPEDYV 363

Query: 444 QKSQELDITPDEFYCKALLEATGICTVPGSGF 475
              + L+   D      L+   GI  +P + F
Sbjct: 364 YPEELLEKAKDFRISYWLINEIGIVAIPPTEF 395

>Kpol_1035.23 s1035 complement(56123..57457) [1335 bp, 444 aa] {ON}
           complement(56123..57457) [1335 nt, 445 aa]
          Length = 444

 Score = 48.1 bits (113), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 51/199 (25%), Positives = 87/199 (43%), Gaps = 21/199 (10%)

Query: 111 ELLESGSNIFKKD----AIERARKLLKEIGSVGSYSSSQGIPAIRKTVANFITKRDDGEI 166
           EL+  G   F       AI+  +K + EI  V  YS ++G P +  ++ +  +     ++
Sbjct: 55  ELINLGQGFFSYSPPAFAIKEIQKAV-EIPLVNQYSPTRGRPRLINSLIDLYSPFYKKQL 113

Query: 167 STPNDIFLTAGASSAV-DYLLSILCKNEKSGVLIPI-PQYPXXXXX---XXXXXXXXXPY 221
            TP ++ +T GA+  +   L+ I+   ++  V  P   QY                  P 
Sbjct: 114 -TPENVLVTTGANEGILSCLMGIINPGDEVIVFEPFFDQYIPNIELCGGKVVYVPINPPK 172

Query: 222 YLDE--SKG--WSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEV 277
            LD   +KG  W+ D +E    I        K  A++I  P NP G + + E + K+  +
Sbjct: 173 ELDNRVTKGTEWTVDFDEFTRAITP------KTKAVIINTPHNPIGKVFTREELTKLGNI 226

Query: 278 AATHGIVIIADEVYQENVF 296
              + ++IIADEVY+   F
Sbjct: 227 CVENNVIIIADEVYEHLYF 245

>Kwal_14.2574 s14 complement(818144..819475) [1332 bp, 443 aa] {ON}
           YJL060W (BNA3) - 1:1 [contig 224] FULL
          Length = 443

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 23/68 (33%), Positives = 37/68 (54%), Gaps = 6/68 (8%)

Query: 229 WSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVIIAD 288
           W+ + +E+E  I        K  AL++  P NP G + + E + +I E+   H +VII+D
Sbjct: 183 WTVNYDELEAAITP------KTKALILNTPHNPVGKVFTREELLRIGEICVKHNVVIISD 236

Query: 289 EVYQENVF 296
           EVY+   F
Sbjct: 237 EVYEHLYF 244

>TDEL0D01900 Chr4 (369434..370765) [1332 bp, 443 aa] {ON} Anc_1.321
           YJL060W
          Length = 443

 Score = 47.8 bits (112), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 50/202 (24%), Positives = 84/202 (41%), Gaps = 21/202 (10%)

Query: 111 ELLESGSNIFK----KDAIERARKLLKEIGSVGSYSSSQGIPAIRKTVANFITKRDDGEI 166
           EL+  G   F     K AI  A+K + +I  V  YS ++G  ++ +++    +   + E+
Sbjct: 54  ELINLGQGFFSYSPPKFAITEAKKAV-DIPLVNQYSPTRGRVSLLESLIKLYSPLYNAEL 112

Query: 167 STPNDIFLTAGASSAVDYLLSILCKNEKSGVLIP-----IPQYPXXXXXXXXXXXXXXPY 221
              N    T      +  L+ IL   ++  V  P     IP                 P 
Sbjct: 113 KAENVTVTTGANEGILSCLMGILNPGDEVIVFEPFFDQYIPNI-ELLGGKVVYVPINPPK 171

Query: 222 YLDES--KG--WSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEV 277
            +D+   KG  W+ D  +    I D      K  A++I  P NP G + + E + +I E+
Sbjct: 172 DMDQRVVKGTEWTVDYEQFANAITD------KTKAVIINTPHNPIGKVFTREELTRIGEI 225

Query: 278 AATHGIVIIADEVYQENVFNNA 299
                +VII+DEVY+   F ++
Sbjct: 226 CVKKNVVIISDEVYEHLYFTDS 247

>NDAI0B04550 Chr2 (1132653..1134350) [1698 bp, 565 aa] {ON}
           Anc_2.102
          Length = 565

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 45/162 (27%), Positives = 73/162 (45%), Gaps = 14/162 (8%)

Query: 141 YSSSQGIPAIRKTVANFITKRDDGE--ISTPNDIFLTAGASSAVDYLLSILCKNEKSGVL 198
           YS +QG+  +   +  FITK ++      T  DI L  G+S ++  +   LC +E + VL
Sbjct: 137 YSETQGMKPLLDFIKTFITKLNNTPPYNETLYDIMLANGSSDSMFKVFETLC-DESTTVL 195

Query: 199 IPIPQYPXXXXXXXXXXXXXXPYYLD---ESKGWSTDINEIEEVINDSLDKG-----IKP 250
           +    +               P  L+   E +G   DI  +E ++++   K       KP
Sbjct: 196 MEEFTFVPVISNVMATGAKCIPLKLNLNYEDQG--IDIEYLENLLDNWGGKSNTKHLSKP 253

Query: 251 TALVIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
             L  I+ G NP G  LS+E   KI  +A  H ++I+ D+ Y
Sbjct: 254 KILYTISTGQNPIGVTLSMEKRRKIYTIAQRHDLIILEDDPY 295

>SAKL0D11528g Chr4 complement(960867..962018) [1152 bp, 383 aa] {ON}
           weakly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase, involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway; potential Cdc28p substrate
          Length = 383

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/153 (23%), Positives = 65/153 (42%), Gaps = 9/153 (5%)

Query: 140 SYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLI 199
           +Y + +G   +R  VA+  +   D E+    D  L    +   ++L+S         V+ 
Sbjct: 54  TYGAIKGSDELRSLVASLYS---DKEVKLDKDNVLITNGAIGANFLVSYTLAGPGDHVIC 110

Query: 200 PIPQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPG 259
             P Y                  L+    +  DI +++ +I     KG     +V+ NP 
Sbjct: 111 VDPTYQQLSSVPKMFGAEVELLELNRENDFIPDIGKLKSMI-----KG-NTKCIVLNNPN 164

Query: 260 NPTGSILSVESMEKIIEVAATHGIVIIADEVYQ 292
           NP GS++   ++E+I  +A  + I +I DEVY+
Sbjct: 165 NPLGSVIPTATLEEIAALARKNEIRVICDEVYR 197

>AEL170C Chr5 complement(318032..319408) [1377 bp, 458 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJL060W
           (BNA3)
          Length = 458

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 23/76 (30%), Positives = 39/76 (51%), Gaps = 6/76 (7%)

Query: 223 LDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHG 282
           + E   W  D + + + IN+      K  A++I +P NP G + + E + K+  +    G
Sbjct: 192 VTEGTEWVIDYDMLRQTINE------KTKAVIINSPHNPIGKVFTREELLKLGNICVEKG 245

Query: 283 IVIIADEVYQENVFNN 298
           I II+DEVY+   F +
Sbjct: 246 IYIISDEVYEHLYFTD 261

>SAKL0F02156g Chr6 (185574..187070) [1497 bp, 498 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 498

 Score = 45.1 bits (105), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 65/152 (42%), Gaps = 6/152 (3%)

Query: 141 YSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIP 200
           Y  SQG P + + V    +   D + +   D+  TAG ++A +  L + C N    +L  
Sbjct: 106 YGFSQGQPELMEFVRKHTSLVHDIKYAD-WDVLATAGNTNAWESTLRVFC-NRGDTILAE 163

Query: 201 IPQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPG- 259
              +               P  LDE   +     ++E ++++   +  KP  L  I  G 
Sbjct: 164 AYSFSSSLYAAEAQGVNVFPVPLDE---FGIIPEKLESIMDNWNPETPKPKLLYTIPTGQ 220

Query: 260 NPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
           NPTGS LS +   KI  +A  H  +II DE Y
Sbjct: 221 NPTGSSLSDDRKAKIYRIAQKHNFIIIEDEPY 252

>Ecym_6292 Chr6 (547563..548855) [1293 bp, 430 aa] {ON} similar to
           Ashbya gossypii AEL170C
          Length = 430

 Score = 44.7 bits (104), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 52/227 (22%), Positives = 92/227 (40%), Gaps = 47/227 (20%)

Query: 225 ESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIV 284
           E+  W  D   +     D      K   ++I NP NP G + + + + ++  +   +G  
Sbjct: 163 EANDWILDRETLRAAFTD------KTKLMIINNPNNPLGKVFNRDELLEMATLCVNNGAY 216

Query: 285 IIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLASLHSTSKGVSGECGQRGGY 344
           IIADEVY+   F       +     NL +A   +  T+       ++  +    G R G+
Sbjct: 217 IIADEVYEFLQFTPNPLSRIS----NLSEAIAQKTITI------GSAGKIFRVTGWRVGW 266

Query: 345 MELTGFNPEIKQ------VILKLCSISLCPVVTGQALVDLMVSPPQKGDESYEQDQLERS 398
           M     N E+ +      V +  CS S+  V +G  +                Q  LE  
Sbjct: 267 M--ISKNRELVEKVTAVHVRMGFCSPSISQVASGLGI----------------QRALECG 308

Query: 399 TIL---NDLSNRAILLWEAFNSMEGVSCQKPEGAMYL---FPKIDLP 439
             L   N+   +  ++++A + + GVS  KP+GA ++   F K+ +P
Sbjct: 309 YFLSMPNEFDRKFSIIYKALDYL-GVSYTKPQGAHFIITDFSKVKIP 354

>ADL249W Chr4 (261227..262390) [1164 bp, 387 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YIL116W (HIS5)
          Length = 387

 Score = 43.9 bits (102), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 51/178 (28%), Positives = 76/178 (42%), Gaps = 21/178 (11%)

Query: 168 TPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPYYLDES- 226
           T  +I L  G+  ++D ++   C   +  V++  P Y                  L  S 
Sbjct: 86  TAKNICLGVGSDESIDAIIRATCSPREQKVMLLPPTYGMYKVCADINDVGYVEVPLISSD 145

Query: 227 KGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVII 286
             +  D + I E +N  LDK IK   + I +PGNPTG+ + V  +EK++    T GIV++
Sbjct: 146 NSFQIDEDRILEQLN--LDKSIK--VVFITSPGNPTGACIEVGRVEKLLR-NWTAGIVVV 200

Query: 287 ADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLASLHSTSKGVSGECGQRGGY 344
            DE Y +       F + K  L  L    P       L  L + SK  SG  G R G+
Sbjct: 201 -DEAYID-------FSADKPSLSPLVNKHP------NLVVLQTLSKA-SGLAGIRLGF 243

>KAFR0A01710 Chr1 complement(348198..349505) [1308 bp, 435 aa] {ON}
           Anc_1.321 YJL060W
          Length = 435

 Score = 44.3 bits (103), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 47/201 (23%), Positives = 87/201 (43%), Gaps = 19/201 (9%)

Query: 111 ELLESGSNIFK----KDAIERARKLLKEIGSVGSYSSSQGIPAIRKTVANFITKRDDGEI 166
           E++  G   F     + AI+ A++ L EI  V  YS ++G  ++  ++  F T   + ++
Sbjct: 46  EMINLGQGFFSYAPPQFAIKEAQRAL-EIPLVNQYSPTRGRLSLIDSLVKFYTPFYNTKL 104

Query: 167 STPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPI-PQY-PXXXXX--XXXXXXXXXPYY 222
              N    T    +    L+ +L   ++  V  P   QY P                P  
Sbjct: 105 EAANFSVFTGANEAIFSILIGLLNPGDEVIVFEPFFDQYIPNIELSGGKVVYVPITPPKN 164

Query: 223 LDE--SKG--WSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVA 278
           LD   +KG  W  D + ++  +N       K  A++I  P NP G + +   + ++ ++ 
Sbjct: 165 LDTRVTKGEEWQIDWDSLQAAMNS------KTKAIIINTPHNPIGKVFTEPELRRLGDIC 218

Query: 279 ATHGIVIIADEVYQENVFNNA 299
             + +VII+DEVY+   F ++
Sbjct: 219 VKNNVVIISDEVYEHLYFKDS 239

>KLTH0H10648g Chr8 complement(919601..920932) [1332 bp, 443 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 443

 Score = 43.9 bits (102), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 22/72 (30%), Positives = 37/72 (51%), Gaps = 6/72 (8%)

Query: 225 ESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIV 284
           E   W+ D +E+   I        K  AL++  P NP G + + E + +I ++   + +V
Sbjct: 179 EGTEWTVDYDELRAAITP------KTKALILNTPHNPVGKVFTREELLQIGQICVENNVV 232

Query: 285 IIADEVYQENVF 296
           II+DEVY+   F
Sbjct: 233 IISDEVYEHLYF 244

>Ecym_6319 Chr6 complement(607599..608663) [1065 bp, 354 aa] {ON}
           similar to Ashbya gossypii AEL170C
          Length = 354

 Score = 43.5 bits (101), Expect = 9e-04,   Method: Compositional matrix adjust.
 Identities = 51/225 (22%), Positives = 88/225 (39%), Gaps = 52/225 (23%)

Query: 229 WSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVIIAD 288
           W+ D ++    I++      K  A++I +P NPTG + + E +  +  +     + II+D
Sbjct: 168 WTLDFDQFRSAISE------KTKAVIINSPHNPTGKVFTREELLTLGNICVEKNVYIISD 221

Query: 289 EVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLASLHSTSKGVSGECGQRGGYMELT 348
           EVY+   F                       + V+LASL      ++   G  G    +T
Sbjct: 222 EVYENLYFTP---------------------ECVKLASLSPEISNITLTIGSAGKIFAVT 260

Query: 349 GFNPEIKQVI------LKLCSISLCPVVTGQALVDLMVSPPQKG-----DESYEQDQLER 397
           G+   I  +I      LKL S +   +           SPPQ       D +   D  +R
Sbjct: 261 GW--RIGWIISENVELLKLASSAHIKICFSSP------SPPQLACAHAIDIALNSDYFDR 312

Query: 398 STILNDLSNRAILLWEAFNSMEGVSCQKPEGAMYL---FPKIDLP 439
             +  D   +  +L   F  + G+    PEG+ ++   F K+ +P
Sbjct: 313 --MRKDYIEKVEILTSVFEEL-GMPYTVPEGSYFIVVDFSKLKIP 354

>SAKL0D06886g Chr4 complement(571478..572821) [1344 bp, 447 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase involved in
           biosynthesis of nicotinic acid from tryptophan via
           kynurenine pathway potential Cdc28p substrate
          Length = 447

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/201 (21%), Positives = 84/201 (41%), Gaps = 21/201 (10%)

Query: 111 ELLESGSNIFK----KDAIERARKLLKEIGSVGSYSSSQGIPAIRKTVANFITKRDDGEI 166
           EL+  G   F     + A+  A+K L E+     YS ++G P++   +    +      +
Sbjct: 58  ELINLGQGFFSYSPPQFAVREAQKAL-EVALNNQYSPTKGRPSLINELIKLYSPFYKTRL 116

Query: 167 STPNDIFLTAGASSAV-DYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPYY--- 222
             P+++ +T GA+ A+   L+ +L + ++  V  P                   P +   
Sbjct: 117 G-PSNVQVTTGANEAILSCLVGLLNQGDEVIVFEPFFDQYISNIEIPGGKVTYVPLHPPK 175

Query: 223 -----LDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEV 277
                +     W+ D +E+   I        K  AL++  P NP G + + E + +I  +
Sbjct: 176 ELENRVTHGTEWTVDYDELRAAITP------KTKALILNTPHNPIGKVFTREELLEIGNI 229

Query: 278 AATHGIVIIADEVYQENVFNN 298
              + +VII+DEVY+   F +
Sbjct: 230 CVENNVVIISDEVYEHLYFTS 250

>NCAS0A09200 Chr1 complement(1819134..1820471) [1338 bp, 445 aa]
           {ON} Anc_1.321 YJL060W
          Length = 445

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 82/383 (21%), Positives = 143/383 (37%), Gaps = 49/383 (12%)

Query: 111 ELLESGSNIFK----KDAIERARKLLKEIGSVGSYSSSQGIPAIRKTVANFITKRDDGEI 166
           EL+  G   F     + AI+ A+K L +I  V  YS ++G  ++   +    T     E+
Sbjct: 56  ELINLGQGFFSYSPPQFAIKEAQKAL-DIPLVNQYSPTRGRVSLLNALIKQYTPIYGSEL 114

Query: 167 STPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPI-PQYPXXXXXX---XXXXXXXXPYY 222
              N    T      +  L+ +L   ++  V  P   QY                  P  
Sbjct: 115 KQENVTITTGANEGILSCLMGLLNAGDEVIVFEPFFDQYISNIELMGGKIVYVPINPPKE 174

Query: 223 LD----ESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVA 278
           LD    E   W+ D+ + +  I        K  A++I  P NP G + + E + +I  + 
Sbjct: 175 LDQRVTEGTEWTVDMEQFKNAITS------KTKAVIINTPHNPIGKVFTREELLQIGNIC 228

Query: 279 ATHGIVIIADEVYQENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLASLHSTSKGVSGEC 338
               ++II+DEVY E+++   +F  +  +   +           QL     ++       
Sbjct: 229 VEKNVIIISDEVY-EHLYFTDEFTRIATLSPEIG----------QLTLTVGSAGKTFAAT 277

Query: 339 GQRGGYMELTGFNPEIKQVILKLCSISLCPVVTGQALVDLMVSPPQKGDESYEQDQLERS 398
           G R G++     N E+ Q + K     +C             SP Q+   +   D LE S
Sbjct: 278 GWRIGWV--ISLNSELLQYVSK-AHTRICFASP---------SPLQEACANSINDALE-S 324

Query: 399 TILNDLSNRAILLWEAFNSM---EGVSCQKPEGAMYL---FPKIDLPFKVLQKSQELDIT 452
                +    I  ++ F S+    G+   KPEG  ++   F K+ +P       + L+  
Sbjct: 325 NYFEKMRQEYIQKFKIFTSVFEELGLPYTKPEGTYFVLADFSKVKIPEDYPYPKEILNKG 384

Query: 453 PDEFYCKALLEATGICTVPGSGF 475
            D      L+   G+  +P + F
Sbjct: 385 KDFRISHWLINELGVVAIPPTEF 407

>KNAG0B00660 Chr2 (115417..116907) [1491 bp, 496 aa] {ON} Anc_3.511
           YGL202W
          Length = 496

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 42/155 (27%), Positives = 66/155 (42%), Gaps = 12/155 (7%)

Query: 141 YSSSQGIPAIR---KTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGV 197
           Y  SQG P +    +   N I K    +     D+  T G ++A +  L + C ++   +
Sbjct: 103 YGFSQGQPELMDYLRDHTNIIHKMQYSDW----DVVATTGNTNAWESTLRVFC-DKGDVI 157

Query: 198 LIPIPQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIIN 257
           L     +               P  +DE         ++E+++++  +   KP  L  I 
Sbjct: 158 LAEAHSFSSCLAAAQAQGIITFPIPIDEH---GIIPEKLEQILDNWTEGAPKPKLLYTIP 214

Query: 258 PG-NPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
            G NPTGS LS +  EKI +VA  H  +II DE Y
Sbjct: 215 TGQNPTGSSLSDDRKEKIYKVAQKHDFIIIEDEPY 249

>Kpol_278.2 s278 (2488..3984) [1497 bp, 498 aa] {ON} (2488..3984)
           [1497 nt, 499 aa]
          Length = 498

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/156 (27%), Positives = 65/156 (41%), Gaps = 14/156 (8%)

Query: 141 YSSSQGIPAIRKTVANFITKRDDGEISTPN----DIFLTAGASSAVDYLLSILCKNEKSG 196
           Y  +QG P +     NF+ K   G I   N    DI LT G ++  +  L + C N+   
Sbjct: 103 YGFTQGHPDL----LNFL-KEHTGLIHKMNYSDWDIILTTGNTNGWESTLRVFC-NKGDV 156

Query: 197 VLIPIPQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVII 256
           +L     +               P  +DE         ++EE++++      KP  L  I
Sbjct: 157 ILAEAHSFSSSLASAEAQGITTFPIPIDEH---GIIPEKLEEILDNWTPGAPKPKLLYTI 213

Query: 257 NPG-NPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
             G NPTG+ L+ E   +I  +A  H  +II DE Y
Sbjct: 214 PTGQNPTGTSLADERKVEIYRIACKHDFLIIEDEPY 249

>Kpol_1035.30 s1035 (69909..71414) [1506 bp, 501 aa] {ON}
           (69909..71414) [1506 nt, 502 aa]
          Length = 501

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 42/159 (26%), Positives = 70/159 (44%), Gaps = 10/159 (6%)

Query: 141 YSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIP 200
           YS + G+P +     N I K ++       D+ L  G+S ++  L   +C +E + V++ 
Sbjct: 95  YSETVGLPPLINFSRNIIKKANNPAYDNW-DVILGNGSSDSMFKLFETIC-DENTTVMME 152

Query: 201 IPQYPXXXXXXXXXXXXXXPYYLD-----ESKGWSTD-INEIEEVINDSLDKGI-KPTAL 253
              +               P  ++     E +G   D +  + E  + S  K + KPT L
Sbjct: 153 EFTFSPVIYNIKATGAAHIPIKMELSENPEKQGIDVDYMQTLLENWDSSEHKHLPKPTVL 212

Query: 254 VIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
             I  G NPTG  LS+E   KI ++   H I+I+ D+ Y
Sbjct: 213 YTIATGQNPTGMTLSMEKRRKIYKICQKHDIIIVEDDPY 251

>NCAS0G04050 Chr7 complement(753216..754370) [1155 bp, 384 aa] {ON}
           Anc_1.472
          Length = 384

 Score = 41.6 bits (96), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/166 (24%), Positives = 71/166 (42%), Gaps = 20/166 (12%)

Query: 140 SYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLI 199
           +Y S +G   +R  +A+       G     +++ +T GA +A ++L+          V+ 
Sbjct: 54  TYGSIKGSDKLRSLIASMY-----GPEFNKDNVLVTNGAIAA-NFLIYYTLVGPGDHVIC 107

Query: 200 PIPQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIIN-P 258
             P Y                  L +  G+  +I  ++++I  +       T L+IIN P
Sbjct: 108 VDPTYAQLYSVPKMFGAEVSLLKLQKEDGFIPNIETLKKMIKSN-------TKLIIINNP 160

Query: 259 GNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSM 304
            NP GS +S E++  I ++   + I +  DEVY+        FHSM
Sbjct: 161 NNPLGSAISTETLNDICQLCEENNIYLHCDEVYK------PIFHSM 200

>NCAS0E00670 Chr5 (117006..118499) [1494 bp, 497 aa] {ON} Anc_3.511
          Length = 497

 Score = 41.6 bits (96), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 47/166 (28%), Positives = 68/166 (40%), Gaps = 18/166 (10%)

Query: 171 DIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESKGWS 230
           D+  TAG ++A +  L + C N    +L     +               P  +D+ KG  
Sbjct: 133 DVVATAGNTNAWESTLRVFC-NRGDVILAEAHSFSSCLAAAQAQGITTFPVPIDD-KGII 190

Query: 231 TDINEIEEVINDSLDKGIKPTALVIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADE 289
               ++E ++++      KP  L  I  G NPTG+ L+ E   +I  +A  H  +II D 
Sbjct: 191 P--AKLEAILDNWTPGAPKPKLLYTIPTGQNPTGTSLADERKPEIFRIAQKHDFLIIEDA 248

Query: 290 VYQENVFNNAKFHSMKKVLRNLQK-----AFPGEYDTVQLASLHST 330
            Y         F  M K  R+LQK     A P E     LASL  T
Sbjct: 249 PYY--------FLQMDKYERDLQKRAVTRAQPRESHKDFLASLDKT 286

>KLLA0F03509g Chr6 (327598..328761) [1164 bp, 387 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 387

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 35/124 (28%), Positives = 56/124 (45%), Gaps = 8/124 (6%)

Query: 170 NDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXX--XXXXXXXXXXXPYYLDESK 227
           +++ L  G+  ++D L+   C   K  +LI    Y                 P  L E  
Sbjct: 88  DNLCLGVGSDESIDALIRACCVPAKEKILIAPATYGMYTICSQVNDVEYVTVPLLLSEED 147

Query: 228 GWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVIIA 287
            +  D  +I E + +  D  IK   + I +PGNPTG+ + V  +EKI+    T G+V++ 
Sbjct: 148 KFQIDEEKILETLQN--DPSIK--LVFITSPGNPTGTFIDVNRIEKILSQWQT-GLVVV- 201

Query: 288 DEVY 291
           DE Y
Sbjct: 202 DEAY 205

>AFR548C Chr6 complement(1422283..1423776) [1494 bp, 497 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGL202W
           (ARO8)
          Length = 497

 Score = 41.2 bits (95), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 38/152 (25%), Positives = 60/152 (39%), Gaps = 3/152 (1%)

Query: 141 YSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIP 200
           Y  SQG P +   V    T+R         D+  T G +SA +  L + C N    +L  
Sbjct: 103 YGFSQGQPELMDFVREH-TRRLHRMQYADWDVLATVGNTSAWESTLRVFC-NRGDTILAE 160

Query: 201 IPQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPG- 259
              +               P  LDE+      + E+ +      D   +P  L  +  G 
Sbjct: 161 EYTFSSSLVAAEAQGVRAYPVPLDENGMVPERLGELLDNWERWHDGVPRPKLLYTVPTGQ 220

Query: 260 NPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
           NPTG+ LS +  + +  +A  H ++I+ DE Y
Sbjct: 221 NPTGTCLSNDRRQAVYRLAQQHDLLIVEDEPY 252

>Kpol_1039.22 s1039 (68736..69896) [1161 bp, 386 aa] {ON}
           (68736..69896) [1161 nt, 387 aa]
          Length = 386

 Score = 40.8 bits (94), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 40/158 (25%), Positives = 70/158 (44%), Gaps = 16/158 (10%)

Query: 168 TPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPY-YLDES 226
           T +++ L  G+   +D L+   C+ E   +L   P Y                   + E 
Sbjct: 83  TEDNLCLGVGSDECIDSLIRACCRPEVDKILTLPPTYSMYSVCANINDVEIVECPLITED 142

Query: 227 KGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVII 286
             +  ++ E+   + +  D  IK   L I +PGNPTG +++ + +E I+E   T+G+V++
Sbjct: 143 NSFQMNVPEVLSTLKN--DPKIK--LLFITSPGNPTGKLVNKKDIEFILE-NWTNGLVVV 197

Query: 287 ADEVYQENVFNNAKFHSMKK---------VLRNLQKAF 315
            DE Y +        +SM K         VL+ L K+F
Sbjct: 198 -DEAYIDFADAEGTTYSMAKLVTKYPNLTVLQTLSKSF 234

>TPHA0D03370 Chr4 complement(704980..706473) [1494 bp, 497 aa] {ON}
           Anc_3.511 YGL202W
          Length = 497

 Score = 40.8 bits (94), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 36/122 (29%), Positives = 53/122 (43%), Gaps = 5/122 (4%)

Query: 171 DIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESKGWS 230
           D  LT G ++  +  L I C N+   +L     +               P  +D S G  
Sbjct: 132 DSILTTGNTNGWESTLRIFC-NKGDVILAEAHSFSSSLASAEAQGVITFPVPID-SDGII 189

Query: 231 TDINEIEEVINDSLDKGIKPTALVIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADE 289
            +  ++E ++++      KP  L  I  G NPTGS LS E  E I ++A  H  +II DE
Sbjct: 190 PE--KLESILDNWTPGSPKPKLLYTIPTGQNPTGSSLSDERKEAIYKIACKHDFIIIEDE 247

Query: 290 VY 291
            Y
Sbjct: 248 PY 249

>KAFR0D01420 Chr4 (284515..285993) [1479 bp, 492 aa] {ON} Anc_3.511
           YGL202W
          Length = 492

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 41/157 (26%), Positives = 66/157 (42%), Gaps = 16/157 (10%)

Query: 141 YSSSQGIPAIRKTVANFI-----TKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKS 195
           Y  SQG P + K +          + DD E+       +TAG +SA +  L I C N   
Sbjct: 103 YGHSQGQPELLKFIREHTEIIHTMQYDDWEL------LVTAGNTSAWESTLRIFC-NRGD 155

Query: 196 GVLIPIPQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVI 255
            +L     +               P  +D+ KG   +  ++  ++++   +  KP  L  
Sbjct: 156 TILAEAHSFSSSLSAAQAQGIITFPVPIDD-KGIIPE--KLAAIMDNWNPETPKPKLLYT 212

Query: 256 INPG-NPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
           I  G NPTGS L  E   ++ ++A  H  +I+ DE Y
Sbjct: 213 IPTGQNPTGSSLDAERKSQVYKIAQKHDFLIVEDEPY 249

>KNAG0E01850 Chr5 (381827..382981) [1155 bp, 384 aa] {ON} Anc_2.252
           YIL116W
          Length = 384

 Score = 40.0 bits (92), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 30/125 (24%), Positives = 59/125 (47%), Gaps = 7/125 (5%)

Query: 168 TPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPY-YLDES 226
           T  +I L  G+  ++D ++   C   +  +L+  P Y                   + E 
Sbjct: 86  TSGNICLGVGSDESIDAIIRATCVPAREKILVLPPTYSMYSVCAKINDVEVVTCPLITED 145

Query: 227 KGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVII 286
             +  D +++ +++N+  D+ IK   L I +PGNPTG+ +    +EK+++     G+V++
Sbjct: 146 NSFQMDSDKVLDILNN--DQEIK--LLFITSPGNPTGAQIETARIEKVLQ-NWDRGLVVV 200

Query: 287 ADEVY 291
            DE Y
Sbjct: 201 -DEAY 204

>NDAI0I02830 Chr9 complement(669885..671387) [1503 bp, 500 aa] {ON}
           Anc_3.511
          Length = 500

 Score = 40.4 bits (93), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 52/122 (42%), Gaps = 5/122 (4%)

Query: 171 DIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESKGWS 230
           DI  TAG ++A +  L + C N    +L     +               P  +D++    
Sbjct: 133 DIIATAGNTNAWESTLRVFC-NRGDVILAEAHSFSSCLAAAQAQGITTFPIPIDDN---G 188

Query: 231 TDINEIEEVINDSLDKGIKPTALVIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADE 289
               ++E+++++      KP  L  I  G NPTG+ L    ME+I  +A  H  +I+ D 
Sbjct: 189 IIPEKLEKILDNWTPGAPKPKLLYTIPTGQNPTGTSLPAHRMEEIYRIAQKHDFLIVEDA 248

Query: 290 VY 291
            Y
Sbjct: 249 PY 250

>YHR137W Chr8 (375709..377250) [1542 bp, 513 aa] {ON}  ARO9Aromatic
           aminotransferase II, catalyzes the first step of
           tryptophan, phenylalanine, and tyrosine catabolism
          Length = 513

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 59/271 (21%), Positives = 114/271 (42%), Gaps = 38/271 (14%)

Query: 135 IGSVGSYSSSQGIPAIRKTVANFITKRD----DGEISTPNDIFLTAGASSAVDYLLSILC 190
           I     Y+ ++G+P +   V +F+++ +      E  +  D+ L+ G++ ++  +   +C
Sbjct: 96  IARSFQYAETKGLPPLLHFVKDFVSRINRPAFSDETESNWDVILSGGSNDSMFKVFETIC 155

Query: 191 KNEKSGVLIPIPQYPXXXXXXXXXXXXXXPYYLD-----ESKGWSTDINEIEEVINDSLD 245
            +E + V+I    +               P  ++     ES+G   D+  + +++ D+  
Sbjct: 156 -DESTTVMIEEFTFTPAMSNVEATGAKVIPIKMNLTFDRESQG--IDVEYLTQLL-DNWS 211

Query: 246 KGI-----KPTALVIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADEVYQ------- 292
            G      KP  L  I  G NPTG  +     EKI ++A  H  +I+ D+ Y        
Sbjct: 212 TGPYKDLNKPRVLYTIATGQNPTGMSVPQWKREKIYQLAQRHDFLIVEDDPYGYLYFPSY 271

Query: 293 ------ENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLASLHSTSKGVSGECGQRGGYME 346
                 EN ++++   + + +   L K+F       ++  L + SK  +   G R  ++ 
Sbjct: 272 NPQEPLENPYHSSDLTTERYLNDFLMKSFLTLDTDARVIRLETFSKIFA--PGLRLSFIV 329

Query: 347 LTGFNPEIKQVILKLCSISL-CPVVTGQALV 376
              F   + Q IL L  I+   P  T QA+V
Sbjct: 330 ANKF---LLQKILDLADITTRAPSGTSQAIV 357

>TDEL0A01600 Chr1 (289263..290690) [1428 bp, 475 aa] {ON} Anc_8.204
           YER152C
          Length = 475

 Score = 39.7 bits (91), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 47/187 (25%), Positives = 72/187 (38%), Gaps = 38/187 (20%)

Query: 140 SYSSSQGIPAIRKTVANFITK------RDDGEISTPNDIFLTAGASSAVDYLLSILCKNE 193
           +Y S +G   +R+ +  F         RDD   S P  + L++GAS  V   LSIL +  
Sbjct: 50  TYGSDEGALWVREAITRFNNDETFRFARDDKARSRPEFLNLSSGASYGV---LSILLQAT 106

Query: 194 KSGV------LIPIPQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKG 247
            +         I  P Y                  +DE    S D+  +E  + +  DK 
Sbjct: 107 LAHTGYTRQAFIVSPTYFLINDCFIDAGFGSKITAIDEDGQGSIDLALLERKLQEFEDKF 166

Query: 248 I----KPTALVIINPG-------------------NPTGSILSVESMEKIIEVAATHGIV 284
                +     I +P                    NPTG+  S E+  K+IE+A  + ++
Sbjct: 167 TEEEDQEKLQAITDPAKAVPKKIYKYVIYCIPTYSNPTGTTYSTETKLKLIEIARKYDML 226

Query: 285 IIADEVY 291
           IIAD+VY
Sbjct: 227 IIADDVY 233

>KLLA0F01617g Chr6 complement(154025..155359) [1335 bp, 444 aa] {ON}
           highly similar to uniprot|P47039 Saccharomyces
           cerevisiae YJL060W BNA3 Arylformamidase
          Length = 444

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 43/186 (23%), Positives = 78/186 (41%), Gaps = 17/186 (9%)

Query: 122 KDAIERARKLLKEIGSVGSYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSA 181
           K AIE+A   L  +     YS ++G P++ K++ +F +   +  ++  N    T      
Sbjct: 70  KFAIEQAVSALN-VPLNNQYSPTRGRPSLLKSLTDFYSPIYNETLNESNVTITTGANEGI 128

Query: 182 VDYLLSILCKNEKSGVLIPI-PQYPXXXXX---XXXXXXXXXPYYLDE----SKGWSTDI 233
           +  L+ +L   ++  V  P   QY                  P  L E       W  D 
Sbjct: 129 LASLVGLLNPGDEVIVFEPFFDQYISNIEIPGGKVRYVPLVAPKELSERVTIGAEWKIDF 188

Query: 234 NEIEEVINDSLDKGIKPTALVIIN-PGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQ 292
           + + + IN+        T  +I+N P NP G + + E + ++ ++   + I II+DEVY+
Sbjct: 189 DILNKTINER-------TKCIILNTPHNPIGKVFTREELTQLGDICVKNNIYIISDEVYE 241

Query: 293 ENVFNN 298
              F +
Sbjct: 242 HLYFGD 247

>KNAG0G00550 Chr7 (96823..97986) [1164 bp, 387 aa] {ON} Anc_1.472
          Length = 387

 Score = 39.3 bits (90), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 35/65 (53%), Gaps = 8/65 (12%)

Query: 242 DSLDKGIKP-TALVIIN-PGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNA 299
           D+L K IK  T L+IIN P NP G ++S E +  I E+     + +  DEVY+       
Sbjct: 143 DTLKKAIKSNTKLIIINNPNNPLGCVISDELLTSICELCKEKNVYLHCDEVYR------P 196

Query: 300 KFHSM 304
            FHS+
Sbjct: 197 IFHSL 201

>SAKL0E12188g Chr5 (1010503..1012095) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 39.3 bits (90), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 49/187 (26%), Positives = 79/187 (42%), Gaps = 17/187 (9%)

Query: 115 SGSNIFKKDAIERARKLLKEIGSVGSYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFL 174
           S  NI++ D  +  R     I     YS ++G+P++ +  +  I KR +       D+ L
Sbjct: 109 SMVNIWRYDPCKPDRL---SIARAFQYSETRGLPSVVE-FSKKIVKRFNPPAYDNWDVLL 164

Query: 175 TAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPYYLD-----ESKG- 228
             G+S ++  +   LC +E   VL+    +               P  ++     E++G 
Sbjct: 165 ANGSSDSLFKIFETLC-DEGVTVLMEEFTFSPTIFNVTASGGKVVPIKVEITHDPETQGI 223

Query: 229 ---WSTDINEIEEVINDSLDKGIKPTALVIINPG-NPTGSILSVESMEKIIEVAATHGIV 284
              +  D+ E  EV         KP  L  I  G NPTG  LS E  + I E+A TH  +
Sbjct: 224 DVQYLCDLLENWEV--GPYKHLSKPRVLYTIATGQNPTGMTLSPEKRKAIYELAETHNFI 281

Query: 285 IIADEVY 291
           I+ D+ Y
Sbjct: 282 IVEDDPY 288

>Ecym_3290 Chr3 (546773..547933) [1161 bp, 386 aa] {ON} similar to
           Ashbya gossypii ADL249W
          Length = 386

 Score = 38.9 bits (89), Expect = 0.027,   Method: Compositional matrix adjust.
 Identities = 33/122 (27%), Positives = 55/122 (45%), Gaps = 7/122 (5%)

Query: 171 DIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPY-YLDESKGW 229
           +I L  G+   VD L+   C  +   VL+  P Y                   + E   +
Sbjct: 89  NICLGVGSDEGVDSLIRATCVPKTDKVLVLPPTYSMYSVFAMINDTEVVECPLITEDNSF 148

Query: 230 STDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVIIADE 289
             D++ + E +++  D  IK   L I  PGNPTG+ +S + +E ++    + GIV++ DE
Sbjct: 149 DMDLDNVLETLSN--DDSIK--LLFITTPGNPTGASISTQKIEMLLN-NWSAGIVVV-DE 202

Query: 290 VY 291
            Y
Sbjct: 203 AY 204

>TPHA0O01520 Chr15 (304547..306058) [1512 bp, 503 aa] {ON} Anc_2.102
           YHR137W
          Length = 503

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 25/44 (56%), Gaps = 1/44 (2%)

Query: 249 KPTALVIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
           KP  L  I  G NPTG  LS+E   KI E+   H I+I+ D+ Y
Sbjct: 208 KPKMLYTIATGQNPTGMTLSMEKRRKIYEICQKHDIIILEDDPY 251

>SAKL0E08492g Chr5 complement(692049..693203) [1155 bp, 384 aa] {ON}
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 384

 Score = 38.5 bits (88), Expect = 0.036,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 57/125 (45%), Gaps = 7/125 (5%)

Query: 168 TPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPYYL-DES 226
           T  +I L  G+  ++D L+ + C   K  ++I  P Y                  L  E 
Sbjct: 86  TAENICLGVGSDESIDALIRVCCVPSKDKIMIMPPTYGMYSICADINDVGCVKVPLVAED 145

Query: 227 KGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVII 286
             +  D +++ E +  + D  IK   + I +PGNPT +++    +EK++    T G+V++
Sbjct: 146 NSFQMDTSKVLETL--AQDPTIK--LIFITSPGNPTAALIDTAEIEKVLN-NWTGGLVVV 200

Query: 287 ADEVY 291
            DE Y
Sbjct: 201 -DEAY 204

>CAGL0G01254g Chr7 (119281..120795) [1515 bp, 504 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202w ARO8
          Length = 504

 Score = 38.5 bits (88), Expect = 0.039,   Method: Compositional matrix adjust.
 Identities = 31/122 (25%), Positives = 51/122 (41%), Gaps = 5/122 (4%)

Query: 171 DIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESKGWS 230
           D+  T G ++A +  L + C N    +L     +               P  +D      
Sbjct: 132 DVVATTGNTNAWESTLRVFC-NRGDVILAEAHSFSSSLASAEAQGIITFPVPIDAH---G 187

Query: 231 TDINEIEEVINDSLDKGIKPTALVIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADE 289
               ++E ++++  +   KP  L  I  G NPTGS L+ E  ++I  +A  H  +II DE
Sbjct: 188 IIPEKLEALLDNWTEGAPKPKLLYTIPTGQNPTGSSLNAERKKEIYRIAQKHDFLIIEDE 247

Query: 290 VY 291
            Y
Sbjct: 248 PY 249

>NCAS0B07220 Chr2 (1366278..1367810) [1533 bp, 510 aa] {ON}
           Anc_2.102
          Length = 510

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 19/44 (43%), Positives = 27/44 (61%), Gaps = 1/44 (2%)

Query: 249 KPTALVIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
           KP  L  I+ G NP G  LS+E  EKI ++A  H ++I+ D+ Y
Sbjct: 223 KPKILYTISTGQNPMGMTLSMEKREKIYQIAQQHDLIILEDDPY 266

>Skud_8.198 Chr8 (349159..350712) [1554 bp, 517 aa] {ON} YHR137W
           (REAL)
          Length = 517

 Score = 38.5 bits (88), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 37/166 (22%), Positives = 75/166 (45%), Gaps = 19/166 (11%)

Query: 141 YSSSQGIPAIRKTVANFITKRD----DGEISTPNDIFLTAGASSAVDYLLSILCKNEKSG 196
           Y+ S+G P + + V + +++ +      E+ +  D+ L+ G++ ++  +   +C +E + 
Sbjct: 102 YAESKGTPPLLRFVKDMVSRINRPVFSDEMQSNWDVILSGGSNDSMFKVFETIC-DESTT 160

Query: 197 VLIPIPQYPXXXXXXXXXXXXXXPYYLD-----ESKGWSTDINEIEEVINDSLDKG---- 247
           VLI    +               P  ++     +S+G   D++ + +++ D+   G    
Sbjct: 161 VLIEEFTFTPAMSNVEATGAKVVPIKINLTLDRDSQG--IDVDHLTQLL-DNWSTGPYKH 217

Query: 248 -IKPTALVIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
             KP  L  I  G NPTG  +     EKI  +A  H  +I+ D+ Y
Sbjct: 218 LAKPRVLYTIATGQNPTGMSVPQWKREKIYRLAQKHDFLIVEDDPY 263

>KLTH0G09614g Chr7 (804939..806108) [1170 bp, 389 aa] {ON} similar
           to uniprot|P07172 Saccharomyces cerevisiae YIL116W HIS5
           Histidinol-phosphate aminotransferase catalyzes the
           seventh step in histidine biosynthesis responsive to
           general control of amino acid biosynthesis mutations
           cause histidine auxotrophy and sensitivity to Cu Co and
           Ni salts
          Length = 389

 Score = 37.4 bits (85), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 56/125 (44%), Gaps = 7/125 (5%)

Query: 168 TPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPY-YLDES 226
           + +++ L  G+  ++D L+   C   K  +LI  P Y                   + E 
Sbjct: 86  SADNLCLGVGSDESIDALIRACCVPGKDKILIMTPTYGMYSICADINDVEIIKVPLIVED 145

Query: 227 KGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVII 286
             +  + +++ E +    D  IK     + +PGNPTG+++ + S+EKI+      GIV I
Sbjct: 146 NSFQMNTDKVIETLQG--DSNIKIA--FVTSPGNPTGALIDIASIEKILS-QWQSGIVAI 200

Query: 287 ADEVY 291
            DE Y
Sbjct: 201 -DEAY 204

>Kpol_480.1 s480 (215..1357) [1143 bp, 380 aa] {ON} (215..1357)
           [1143 nt, 381 aa]
          Length = 380

 Score = 37.0 bits (84), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 39/167 (23%), Positives = 73/167 (43%), Gaps = 20/167 (11%)

Query: 140 SYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLI 199
           SY + +G   +R ++A+       G   T +DI LT GA  A ++L           V+ 
Sbjct: 54  SYGAIKGSDELRTSIASLY-----GPDFTMDDILLTNGAIGA-NFLAFYTLVGAGDHVIC 107

Query: 200 PIPQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIIN-P 258
             P Y                  L +   +  ++  ++ +I ++       T L+IIN P
Sbjct: 108 VEPTYSQLYSVPEMFGAEVDLLTLKKEDDFLPNLQTLKSMIKNN-------TKLIIINNP 160

Query: 259 GNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFHSMK 305
            NP GS++  + +++I ++   + I + +DEVY+        FHS++
Sbjct: 161 NNPLGSVIKKDLLKQICKLCEENDIYLHSDEVYR------PIFHSLE 201

>Kpol_1032.39 s1032 complement(90576..91937) [1362 bp, 453 aa] {ON}
           complement(90576..91937) [1362 nt, 454 aa]
          Length = 453

 Score = 37.0 bits (84), Expect = 0.099,   Method: Compositional matrix adjust.
 Identities = 48/190 (25%), Positives = 76/190 (40%), Gaps = 41/190 (21%)

Query: 140 SYSSSQGIPAIRKTVANFITK------RDDGEISTPNDIFLTAGASSAVDYLLSILCKNE 193
           +Y S++G   +R  +  F+ +      RDD   S P  + LT+GAS  V   L+IL +  
Sbjct: 50  TYGSNEGALWVRTAITEFVNEKAFKFDRDDKARSKPEYLNLTSGASYGV---LNILLQAT 106

Query: 194 --KSGV----LIPIPQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIE---------- 237
              +GV     I  P Y                  +DE    S D+  +E          
Sbjct: 107 LPHTGVTKQAFIVSPTYFLINDCFIDAGFGGKLTAIDEKGEESIDLELLEAKLKHFESID 166

Query: 238 -----------EVINDSLD-----KGIKPTALVIINPGNPTGSILSVESMEKIIEVAATH 281
                       +I + +D     K  K    VI    NP+G   ++E+  K+IE+A  +
Sbjct: 167 PNPVNENGKELSIIKNPIDISHLKKVYKYVIYVIPTYSNPSGKTYNLETRCKLIELARKY 226

Query: 282 GIVIIADEVY 291
            ++II D+VY
Sbjct: 227 DMLIITDDVY 236

>Smik_7.69 Chr7 (111132..112634) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 37.0 bits (84), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 29/122 (23%), Positives = 51/122 (41%), Gaps = 5/122 (4%)

Query: 171 DIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESKGWS 230
           D+F TAG ++A +  L + C N    +L     +               P  +D      
Sbjct: 134 DVFATAGNTNAWESTLRLFC-NRGDVILAEAHSFSSSLASAEAQGVITFPVPIDAD---G 189

Query: 231 TDINEIEEVINDSLDKGIKPTALVIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADE 289
               ++ +++++      KP  L  I  G NPTG+ ++    E I ++A  H  +I+ DE
Sbjct: 190 IIPEKLAKIMDNWTPNAPKPKLLYTIPTGQNPTGTSIANHRKEAIYKIAQKHDFLIVEDE 249

Query: 290 VY 291
            Y
Sbjct: 250 PY 251

>YIL116W Chr9 (142928..144085) [1158 bp, 385 aa] {ON}
           HIS5Histidinol-phosphate aminotransferase, catalyzes the
           seventh step in histidine biosynthesis; responsive to
           general control of amino acid biosynthesis; mutations
           cause histidine auxotrophy and sensitivity to Cu, Co,
           and Ni salts
          Length = 385

 Score = 37.0 bits (84), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 58/126 (46%), Gaps = 9/126 (7%)

Query: 168 TPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESK 227
           T +++ L  G+  ++D ++   C   K  +L+  P Y                  L  S 
Sbjct: 86  TADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLTVSD 145

Query: 228 G-WSTDINEIEEVI-NDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVI 285
           G +  D   +  ++ NDSL K      + + +PGNPTG+ +    +EK+++    +G+V+
Sbjct: 146 GSFQMDTEAVLTILKNDSLIK-----LMFVTSPGNPTGAKIKTSLIEKVLQ-NWDNGLVV 199

Query: 286 IADEVY 291
           + DE Y
Sbjct: 200 V-DEAY 204

>KLLA0A04906g Chr1 (437523..438965) [1443 bp, 480 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 480

 Score = 37.0 bits (84), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 37/160 (23%), Positives = 67/160 (41%), Gaps = 8/160 (5%)

Query: 135 IGSVGSYSSSQGIPAIRKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEK 194
           +G    Y +S+G P +   +    +   +  I+   D+  TAG++ A D  L + C N  
Sbjct: 93  LGVALQYGNSRGQPELISFLKEHTSIFHNISINDW-DLITTAGSTQAWDACLRLFC-NRG 150

Query: 195 SGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVIND--SLDKGIKPTA 252
             VL+    Y                  +D+       ++++ E++ D     +G  P  
Sbjct: 151 ETVLMEEYTYSSSLEAAVAQGLNCVAMKMDKD---GIKVDKLSEMLRDWDVAVQGPFPKL 207

Query: 253 LVII-NPGNPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
           L  I N  NPTG  L  E   +++ +A+ +  +II D+ Y
Sbjct: 208 LYTIPNGHNPTGCTLHEERKPELVRLASQYDFIIIEDDPY 247

>Kwal_47.18982 s47 complement(1051414..1052904) [1491 bp, 496 aa]
           {ON} YGL202W (ARO8) - 1:1 [contig 188] FULL
          Length = 496

 Score = 37.0 bits (84), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/91 (30%), Positives = 45/91 (49%), Gaps = 11/91 (12%)

Query: 236 IEEVINDSLDKGIKPTALVIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADE----- 289
           +E ++++      KP  L  I  G NPTGS LS +   +I  +A  H ++II DE     
Sbjct: 196 LEAILDNWNPDTAKPKLLYTIPTGQNPTGSSLSDDRKVEIYRIAKKHDLLIIEDEPYYFL 255

Query: 290 ---VYQENVFNNAKFH--SMKKVLRNLQKAF 315
               YQ++V    + H  S +  + +L K+F
Sbjct: 256 QMDAYQKDVSQRKETHFASQEDFVNSLAKSF 286

>Kwal_23.4888 s23 (907745..908914) [1170 bp, 389 aa] {ON} YIL116W
           (HIS5) - histidinol-phosphate aminotransferase [contig
           5] FULL
          Length = 389

 Score = 36.2 bits (82), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 32/125 (25%), Positives = 55/125 (44%), Gaps = 7/125 (5%)

Query: 168 TPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPYYLD-ES 226
           T  ++ L  G+   +D L+   C   K  +LI  P Y                  L  E 
Sbjct: 86  THENLCLGVGSDECIDALIRACCVPGKDKILIMPPTYGMYSICTDINDVEYVKVPLVVED 145

Query: 227 KGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVII 286
             +  D  ++ E + +  D  IK   + I +PGNPTG+++  E++EK++    +  +V+ 
Sbjct: 146 NSFQMDTEKVIETLQN--DPSIK--LVFITSPGNPTGALIKPENIEKLLSQWQSGFVVV- 200

Query: 287 ADEVY 291
            DE Y
Sbjct: 201 -DEAY 204

>ZYRO0C06028g Chr3 (457564..459054) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 36.2 bits (82), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 74/158 (46%), Gaps = 22/158 (13%)

Query: 235 EIEEVINDSLDKGIKPTALVIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADEVY-- 291
           ++E+++++      KP  L  I  G NPTG+ L  +  E I  +A  H  +I+ DE Y  
Sbjct: 191 KLEDLLDNWTPNAPKPKLLYTIPTGQNPTGTSLPNDRREAIYRIAQKHDFLIVEDEPYYF 250

Query: 292 ------------QENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLASLHSTSKGVSGECG 339
                       +E V++  K  S ++  ++L K+F       ++  L S SK +    G
Sbjct: 251 LQVGDYIEDLKKREQVYSAPK-QSHEEFKKSLVKSFLSLDTEGRVIRLDSFSKVLG--PG 307

Query: 340 QRGGYMELTGFNPEIKQVILKLCSISL-CPVVTGQALV 376
            R G+  +TG + ++ +  + L  +++ CP    Q LV
Sbjct: 308 TRLGW--ITG-SKQLMKAYVSLHEMTIQCPSGFSQVLV 342

>Smik_8.218 Chr8 (352556..354097) [1542 bp, 513 aa] {ON} YHR137W
           (REAL)
          Length = 513

 Score = 36.2 bits (82), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 57/265 (21%), Positives = 109/265 (41%), Gaps = 38/265 (14%)

Query: 141 YSSSQGIPAIRKTVANFITKRD----DGEISTPNDIFLTAGASSAVDYLLSILCKNEKSG 196
           Y+ ++G+P +   V + + + +      E  +  D+ L+ G++ ++  +   +C +E + 
Sbjct: 102 YAETKGLPPLLHFVKDMVCRINRPVFSDETESNWDVILSGGSNDSMFKVFETIC-DESTT 160

Query: 197 VLIPIPQYPXXXXXXXXXXXXXXPYYLD-----ESKGWSTDINEIEEVINDSLDKGI--- 248
           V+I    +               P  +D     E +G   D+ ++  ++ D+   G    
Sbjct: 161 VMIEEFTFTPAMSNVEATGAKVIPIKMDLTFDRERQG--IDVEDLTRLL-DNWSTGPYKH 217

Query: 249 --KPTALVIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADEVYQ------------- 292
             KP  L  I  G NPTG  +     EKI ++A  H  +I+ D+ Y              
Sbjct: 218 LNKPKVLYTIATGQNPTGMSVPRWKREKIYQLAQKHDFLIVEDDPYGYMYFPSYNPQNPL 277

Query: 293 ENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLASLHSTSKGVSGECGQRGGYMELTGFNP 352
           EN ++++     + +   L K+F       ++  L + SK  +   G R  ++    F  
Sbjct: 278 ENPYDSSDLTIERYLNDFLMKSFLTLDTDARVIRLETFSKIFAP--GLRLSFIVANKF-- 333

Query: 353 EIKQVILKLCSISL-CPVVTGQALV 376
            + Q IL L  I+   P  T QA+V
Sbjct: 334 -LLQKILDLADITTRAPSGTSQAIV 357

>NDAI0B03730 Chr2 complement(935131..936291) [1161 bp, 386 aa] {ON}
           Anc_2.252 YIL116W
          Length = 386

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 32/126 (25%), Positives = 56/126 (44%), Gaps = 9/126 (7%)

Query: 168 TPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPY-YLDES 226
           T  ++ L  G+  ++D ++   C   K  +L+  P Y                   L ++
Sbjct: 87  TSENLCLGVGSDESIDAIIRATCVPGKEKILVLPPTYSMYSVCAEINDIEIVECPLLYKN 146

Query: 227 KGWSTDINEIEEVI-NDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVI 285
             +  D   +  V+ ND L K      L I +PGNPTG+ +  E +E +++   T G+V+
Sbjct: 147 NSFQMDTESVLTVLQNDPLIK-----LLFITSPGNPTGARIETERIETVLQ-NWTDGLVV 200

Query: 286 IADEVY 291
           + DE Y
Sbjct: 201 V-DEAY 205

>KLTH0G02002g Chr7 (155219..156709) [1491 bp, 496 aa] {ON} highly
           similar to uniprot|P53090 Saccharomyces cerevisiae
           YGL202W ARO8 Aromatic aminotransferase expression is
           regulated by general control of amino acid biosynthesis
          Length = 496

 Score = 35.8 bits (81), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 32/57 (56%), Gaps = 1/57 (1%)

Query: 236 IEEVINDSLDKGIKPTALVIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
           +E ++++   +  KP  L  I  G NPTGS LS +  ++I  +A  H  +II DE Y
Sbjct: 196 LEAILDNWNPETPKPKLLYTIPTGQNPTGSSLSDDRKKEIYRIAQKHDFIIIEDEPY 252

>Suva_5.281 Chr5 complement(444090..445442) [1353 bp, 450 aa] {ON}
           YER152C (REAL)
          Length = 450

 Score = 35.8 bits (81), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 47/97 (48%), Gaps = 6/97 (6%)

Query: 259 GNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKFH----SMKKVLRNLQKA 314
            NP+G+  S+E+  ++IE+A  + +++I D+VY    + +A        ++ V  +   A
Sbjct: 202 ANPSGNTYSLETRRRLIEIARKYDMLVITDDVYDILDYTSAADQLPSPPLRMVHLDRATA 261

Query: 315 FPGEYDTVQLASLHSTSKGVSGECGQRGGYMELTGFN 351
            PGE       S  + SK ++   G R GY E    N
Sbjct: 262 APGEDSFGNTVSNATFSKLIA--PGLRFGYHETINAN 296

>Smik_5.319 Chr5 complement(477840..479171) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 35.8 bits (81), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 21/70 (30%), Positives = 39/70 (55%), Gaps = 1/70 (1%)

Query: 223 LDESKGWSTDINEIEEVINDSLDKGIKPTALVII-NPGNPTGSILSVESMEKIIEVAATH 281
           LD  +G S   +  E +   +L K I    L  I    NP+G+  S+E+  ++I++A  +
Sbjct: 158 LDHHEGESQPDSTTEIIQGPALTKKIYKYVLYCIPTFANPSGNTYSLETRRRLIDIARKY 217

Query: 282 GIVIIADEVY 291
            +++I+D+VY
Sbjct: 218 DMLVISDDVY 227

>SAKL0H18612g Chr8 (1655787..1657124) [1338 bp, 445 aa] {ON} highly
           similar to gnl|GLV|KLLA0E00935g Kluyveromyces lactis
           KLLA0E00935g and similar to YER152C uniprot|P10356
           Saccharomyces cerevisiae YER152C Hypothetical ORF
          Length = 445

 Score = 35.8 bits (81), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 47/191 (24%), Positives = 75/191 (39%), Gaps = 50/191 (26%)

Query: 140 SYSSSQGIPAIRKTVANF---ITKRDDGEISTPNDIFLTAGASSAVDYLL---SILCKNE 193
           +Y S +G   +R+ + +F   +    D   S P  I LT GAS  V  +L   ++     
Sbjct: 50  TYGSDEGALWVRQAICDFSNHVFGLSDSVKSKPEFINLTGGASYGVMNILEQTTLAHTGY 109

Query: 194 KSGVLIPIPQYPXXXXXXXXXXXXXXPYYLDES-KGWSTDINEIEEVIN----------- 241
                I  P Y                 ++D    G  T INE+ + I+           
Sbjct: 110 TRQAFIVSPTY-----------FLINETFIDAGFNGKLTAINELGDSIDFETLKSKLEHF 158

Query: 242 DSLDKGIKPTA-LVIINP--------------------GNPTGSILSVESMEKIIEVAAT 280
           DS+D GI  +  L +IN                      NP G   ++E+  K+I++A  
Sbjct: 159 DSIDDGIDHSKDLDLINSPSTAHPKKIYKYVLYFVPTYSNPGGKTYNLETRLKLIDLARK 218

Query: 281 HGIVIIADEVY 291
           H ++II+D+VY
Sbjct: 219 HDMLIISDDVY 229

>KLTH0G19624g Chr7 complement(1697587..1698993) [1407 bp, 468 aa]
           {ON} similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 468

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 24/32 (75%)

Query: 260 NPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
           NPTG+I S  S  K++E+A  + I+II+D+VY
Sbjct: 198 NPTGAIYSRSSRLKLLELARKYDILIISDDVY 229

>KLTH0B06270g Chr2 (508642..510219) [1578 bp, 525 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 525

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 53/131 (40%), Gaps = 13/131 (9%)

Query: 171 DIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESKGWS 230
           D+ L  G+S A   ++  LC +  + VL+    +               P  LD +    
Sbjct: 155 DVTLANGSSDATFKIIETLCDSSVT-VLVEEFTFSPTLAIITAAGGTTVPLKLDITA--D 211

Query: 231 TDINEIE-EVINDSLDKGI--------KPTALVIINPG-NPTGSILSVESMEKIIEVAAT 280
            D+  I  E + D LD           KP  L  I  G NPTG  LS E  ++I  +A  
Sbjct: 212 PDVQGINVEYLTDLLDNWSQGPNAHLSKPKLLYTIPTGQNPTGMTLSFEKRKQIYALAEK 271

Query: 281 HGIVIIADEVY 291
           H  +II D+ Y
Sbjct: 272 HDFIIIEDDPY 282

>KLLA0E00969g Chr5 (101430..102767) [1338 bp, 445 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 445

 Score = 35.4 bits (80), Expect = 0.36,   Method: Compositional matrix adjust.
 Identities = 14/32 (43%), Positives = 23/32 (71%)

Query: 260 NPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
           NP G   S+E+  K+IE+A  H ++I++D+VY
Sbjct: 197 NPGGQTYSLETRVKLIELARKHDMLIVSDDVY 228

>KLTH0B00176g Chr2 (10791..12137) [1347 bp, 448 aa] {ON} similar to
           uniprot|P10356 Saccharomyces cerevisiae YER152C
           Hypothetical ORF
          Length = 448

 Score = 35.0 bits (79), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 16/32 (50%), Positives = 24/32 (75%)

Query: 260 NPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
           NPTG+I S  S  K++E+A  + I+II+D+VY
Sbjct: 199 NPTGAIYSRSSRLKLLELARKYDILIISDDVY 230

>ZYRO0G05346g Chr7 complement(430373..431887) [1515 bp, 504 aa] {ON}
           similar to uniprot|P38840 Saccharomyces cerevisiae
           YHR137W ARO9 Aromatic aminotransferase catalyzes the
           first step of tryptophan phenylalanine and tyrosine
           catabolism
          Length = 504

 Score = 35.0 bits (79), Expect = 0.43,   Method: Compositional matrix adjust.
 Identities = 18/44 (40%), Positives = 24/44 (54%), Gaps = 1/44 (2%)

Query: 249 KPTALVIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
           KP AL  +  G NPTG  LS     +I E+A  H  +I+ D+ Y
Sbjct: 207 KPKALYTVATGQNPTGMTLSPTKRRRIYEIAQKHDFLIVEDDPY 250

>ZYRO0B11088g Chr2 complement(872804..874156) [1353 bp, 450 aa] {ON}
           similar to uniprot|P10356 Saccharomyces cerevisiae
           YER152C Hypothetical ORF
          Length = 450

 Score = 34.7 bits (78), Expect = 0.53,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 24/33 (72%)

Query: 259 GNPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
            NP+G   ++E+  ++IE+A  + ++I+AD+VY
Sbjct: 204 ANPSGQTYTLETRRRLIEIARKYDMLILADDVY 236

>CAGL0I06578g Chr9 (637311..638621) [1311 bp, 436 aa] {ON} similar
           to uniprot|P10356 Saccharomyces cerevisiae YER152c
          Length = 436

 Score = 34.7 bits (78), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 23/33 (69%)

Query: 259 GNPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
            NP+G   S+E+  K+IE+A  + ++II D+VY
Sbjct: 193 ANPSGKSYSLETRTKLIEIARRYDMLIICDDVY 225

>ZYRO0A01672g Chr1 (136284..137444) [1161 bp, 386 aa] {ON} highly
           similar to uniprot|P07172 Saccharomyces cerevisiae
           YIL116W HIS5 Histidinol-phosphate aminotransferase
           catalyzes the seventh step in histidine biosynthesis
           responsive to general control of amino acid biosynthesis
           mutations cause histidine auxotrophy and sensitivity to
           Cu Co and Ni salts
          Length = 386

 Score = 34.3 bits (77), Expect = 0.79,   Method: Compositional matrix adjust.
 Identities = 37/148 (25%), Positives = 61/148 (41%), Gaps = 10/148 (6%)

Query: 149 AIRKTVANFITK-----RDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQ 203
           A +  +ANF        +D  +  T  ++ L  G+  ++D ++   C   K  +L+  P 
Sbjct: 61  AFKTAMANFRNGENHQYKDLPQPLTAENLCLGVGSDESIDAIIRACCVPAKEKILVLPPT 120

Query: 204 YPXXXXXXXXXXXXXXPYYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTG 263
           Y                  L  S   S   N  E +     D  IK   + I +PGNPTG
Sbjct: 121 YSMYSVCAHINDVEIVKCPLITSDN-SFQANTDEVIKTAQNDPSIK--LIFITSPGNPTG 177

Query: 264 SILSVESMEKIIEVAATHGIVIIADEVY 291
           + +    +EKI++     G+V++ DE Y
Sbjct: 178 AKVETSRIEKILQ-NWDRGMVVV-DEAY 203

>KAFR0J01580 Chr10 complement(287313..288464) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 34.3 bits (77), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 31/126 (24%), Positives = 55/126 (43%), Gaps = 9/126 (7%)

Query: 168 TPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPY-YLDES 226
           T  +  L  G+  ++D ++   C   K  +L+  P Y                   + E 
Sbjct: 85  TDENFCLGVGSDESIDAIIRASCVPSKEKILVLPPTYSMYSVCANINDVDVVTCPLITED 144

Query: 227 KGWSTDINEIEEVI-NDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVI 285
             +  D  EI  ++ ND L K      + I +PGNPTG+ + ++ +E +++     G+VI
Sbjct: 145 NSFQIDATEILNILANDPLIK-----LVFITSPGNPTGAKIEIDRIEYLLK-NWDQGLVI 198

Query: 286 IADEVY 291
           + DE Y
Sbjct: 199 V-DEAY 203

>Suva_15.334 Chr15 (578774..580456) [1683 bp, 560 aa] {ON} YHR137W
           (REAL)
          Length = 560

 Score = 34.3 bits (77), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 55/269 (20%), Positives = 110/269 (40%), Gaps = 34/269 (12%)

Query: 135 IGSVGSYSSSQGIPAIRKTVANFITKRD----DGEISTPNDIFLTAGASSAVDYLLSILC 190
           I     Y+ ++G+P + +   + + + +      E  +  D+ L+ G++ ++  +    C
Sbjct: 144 IARSFQYAETKGMPPLLQFTKDMVARINRPAFSDETDSNWDVILSGGSNDSMYKVFETFC 203

Query: 191 KNEKSGVLIPIPQYPXXXXXXXXXXXXXXPYYLDES---KGWSTDINEIEEVINDSLDKG 247
            +E + V+I    +               P  ++ S   +  S D++ + +++ ++   G
Sbjct: 204 -DESTTVMIEEFTFTPAVSNVEATGATVVPIKINLSADRETQSVDVDYLSQLL-ENWSTG 261

Query: 248 I-----KPTALVIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADEVYQ--------- 292
                 KP  L  I  G NPTG  +     EKI E+A  H  +I+ D+ Y          
Sbjct: 262 PYRHLNKPRVLYTIATGQNPTGMSVPQWKREKIYELAQRHDFLIVEDDPYGYLYFPPFDP 321

Query: 293 ----ENVFNNAKFHSMKKVLRNLQKAFPGEYDTVQLASLHSTSKGVSGECGQRGGYMELT 348
               EN + ++   + + +   L K+F       ++  L + SK  +   G R  ++   
Sbjct: 322 ENPLENPYQSSSVTTERYLNEFLMKSFLTLDTDARVIRLETFSKIFAP--GLRLSFIVAN 379

Query: 349 GFNPEIKQVILKLCSISL-CPVVTGQALV 376
            F   I + +L L  I+   P  T QA+V
Sbjct: 380 KF---ILEKVLDLADITTRAPSGTSQAIV 405

>NCAS0B06440 Chr2 complement(1218759..1219916) [1158 bp, 385 aa]
           {ON} Anc_2.252 YIL116W
          Length = 385

 Score = 33.9 bits (76), Expect = 0.99,   Method: Compositional matrix adjust.
 Identities = 36/144 (25%), Positives = 63/144 (43%), Gaps = 13/144 (9%)

Query: 151 RKTVANFITKRDDGEISTPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXX 210
           R T + F  K  D    T  ++ L  G+  ++D ++   C   K  +L+  P Y      
Sbjct: 71  RNTTSAF--KDRDLATLTNENLCLGVGSDESIDAIIRACCVPAKEKILVLPPTYSMYSVC 128

Query: 211 XXXXXXXXXP---YYLDESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILS 267
                         Y D S   ++D   ++ + ND L K +      I +PGNPTG  + 
Sbjct: 129 ANINDIEVVECPLIYEDNSFQLNSD-KVLDILKNDPLIKLV-----FITSPGNPTGVKIE 182

Query: 268 VESMEKIIEVAATHGIVIIADEVY 291
            + +EK+++    +G+V++ DE Y
Sbjct: 183 TKRIEKVLQ-NWDNGLVVV-DEAY 204

>NDAI0C05960 Chr3 complement(1365183..1366619) [1437 bp, 478 aa]
           {ON} Anc_8.204 YER152C
          Length = 478

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 20/67 (29%), Positives = 37/67 (55%), Gaps = 3/67 (4%)

Query: 242 DSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKF 301
           +S+ K  K     + +  NP+G   S+++  K+I++A  + I+II D+VY+   F N K 
Sbjct: 208 NSMKKIYKYVLYCVPSFANPSGKSYSLKTKRKLIDLACLYDILIITDDVYE---FLNYKV 264

Query: 302 HSMKKVL 308
           +    V+
Sbjct: 265 NPATSVI 271

>YER152C Chr5 complement(472657..473988) [1332 bp, 443 aa] {ON}
           Protein with 2-aminoadipate transaminase activity;
           shares amino acid similarity with the aminotransferases
           Aro8p and Aro9p; YER152C is not an essential gene
          Length = 443

 Score = 33.9 bits (76), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 12/33 (36%), Positives = 24/33 (72%)

Query: 259 GNPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
            NP+G+  S+E+  ++I++A  + ++II D+VY
Sbjct: 195 ANPSGNTYSLETRRRLIDIARKYDMLIITDDVY 227

>Suva_7.61 Chr7 (112022..113524) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 50/122 (40%), Gaps = 5/122 (4%)

Query: 171 DIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESKGWS 230
           D+  TAG ++A +  L + C N    +L     +               P  +D      
Sbjct: 134 DVVATAGNTNAWESTLRVFC-NRGDVILAEAHSFSSSLAAAEAQGIIAFPVPIDAD---G 189

Query: 231 TDINEIEEVINDSLDKGIKPTALVIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADE 289
               ++ +++++      KP  L  I  G NPTG+ ++    E I ++A  H  +I+ DE
Sbjct: 190 IIPEKLAKIMDNWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFLIVEDE 249

Query: 290 VY 291
            Y
Sbjct: 250 PY 251

>TDEL0D05790 Chr4 complement(1045218..1046711) [1494 bp, 497 aa]
           {ON} Anc_3.511 YGL202W
          Length = 497

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 18/58 (31%), Positives = 33/58 (56%), Gaps = 1/58 (1%)

Query: 235 EIEEVINDSLDKGIKPTALVIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
           ++E+++++      +P  L  I  G NPTG+ L+ +  ++I  +A  H  +II DE Y
Sbjct: 191 KLEKILDEWTPGAPRPKLLYTIPTGQNPTGTSLADDRKKEIYRIAQKHDFLIIEDEPY 248

>AGR141C Chr7 complement(1013956..1015272) [1317 bp, 438 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER152C
          Length = 438

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 11/32 (34%), Positives = 25/32 (78%)

Query: 260 NPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
           NP+GS  S+E+  +++E+A  + +++I+D++Y
Sbjct: 191 NPSGSTYSLETRTRLVELARRYDMLLISDDIY 222

>KNAG0G01680 Chr7 complement(369892..371250) [1359 bp, 452 aa] {ON}
           Anc_8.204 YER152C
          Length = 452

 Score = 33.5 bits (75), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 13/33 (39%), Positives = 25/33 (75%)

Query: 259 GNPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
            NP+G   S+E+ +K++++A  + ++IIAD+VY
Sbjct: 205 ANPSGMSFSLETKKKLLDLARKYDMLIIADDVY 237

>Ecym_5542 Chr5 (1099530..1100870) [1341 bp, 446 aa] {ON} similar to
           Ashbya gossypii AGR141C
          Length = 446

 Score = 33.5 bits (75), Expect = 1.4,   Method: Compositional matrix adjust.
 Identities = 14/38 (36%), Positives = 26/38 (68%)

Query: 260 NPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFN 297
           NP+G   SV +  K++E+A  + I++I+D+VY   V++
Sbjct: 199 NPSGKTYSVSTRLKLVELARKYDILLISDDVYDLLVYD 236

>KLTH0E07678g Chr5 (702610..704088) [1479 bp, 492 aa] {ON} similar
           to uniprot|P53090 Saccharomyces cerevisiae YGL202W ARO8
           Aromatic aminotransferase expression is regulated by
           general control of amino acid biosynthesis
          Length = 492

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 47/189 (24%), Positives = 74/189 (39%), Gaps = 18/189 (9%)

Query: 171 DIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESKGWS 230
           DI  T G++   D  L I C N+   VL+    Y               P  LD      
Sbjct: 132 DIITTTGSTQGWDASLRIFC-NKGDTVLLEDYTYSSSVEAADAQGLNCVPMPLDGEGIVP 190

Query: 231 TDINEIEEVINDSLDKGIKPTALVIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADE 289
           + + E+    +    +   P  L  I  G NPTG  LS      I  +A  + I+II D+
Sbjct: 191 SKLEEMLANWSSLYGEMPMPKLLYTIPTGQNPTGCTLSDNRKPHIYRLAQQYDIIIIEDD 250

Query: 290 VY----------QENVFNNAKFHSMKKV--LRNLQKAFPGEYDT-VQLASLHSTSKGVSG 336
            Y          ++     A+  +M +   + +L ++F  E DT  ++  L S SK  + 
Sbjct: 251 PYYFLQMDPYVSEDARLETAEASTMSQATFMNSLNRSFL-ELDTDGRVVRLESVSKTFAP 309

Query: 337 ECGQRGGYM 345
            C  R G++
Sbjct: 310 GC--RMGWL 316

>Skud_7.69 Chr7 (120729..122231) [1503 bp, 500 aa] {ON} YGL202W
           (REAL)
          Length = 500

 Score = 33.1 bits (74), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 27/122 (22%), Positives = 49/122 (40%), Gaps = 5/122 (4%)

Query: 171 DIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESKGWS 230
           D+  TAG ++  +  L + C N    +L     +               P  +D      
Sbjct: 134 DVLATAGNTNGWESTLRVFC-NRGDVILAEAHSFSSSLASAEAQGVITFPIPIDAG---G 189

Query: 231 TDINEIEEVINDSLDKGIKPTALVIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADE 289
               ++ +++++      KP  L  I  G NPTG+ ++    E I ++A  H  +I+ DE
Sbjct: 190 IIPEKLAKIMDNWTAGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKHDFIIVEDE 249

Query: 290 VY 291
            Y
Sbjct: 250 PY 251

>Suva_10.209 Chr10 complement(392668..393351) [684 bp, 227 aa] {ON}
           YLR118C (REAL)
          Length = 227

 Score = 32.7 bits (73), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 22/76 (28%), Positives = 38/76 (50%), Gaps = 4/76 (5%)

Query: 225 ESKGWSTDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIV 284
           +S G+   +N IE+++   +DKGIKP  ++I   G   G+ L++ S   +    A  GIV
Sbjct: 85  DSDGFMNSLNAIEKMVKQEIDKGIKPEQIII--GGFSQGAALALASSVTLPWRVA--GIV 140

Query: 285 IIADEVYQENVFNNAK 300
            ++   Y   +    K
Sbjct: 141 ALSGFCYIPGILKQHK 156

>YGL202W Chr7 (116059..117561) [1503 bp, 500 aa] {ON}  ARO8Aromatic
           aminotransferase I, expression is regulated by general
           control of amino acid biosynthesis
          Length = 500

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 50/122 (40%), Gaps = 5/122 (4%)

Query: 171 DIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESKGWS 230
           D+  TAG ++A +  L + C N    +L+    +               P  +D      
Sbjct: 134 DVLATAGNTNAWESTLRVFC-NRGDVILVEAHSFSSSLASAEAQGVITFPVPIDAD---G 189

Query: 231 TDINEIEEVINDSLDKGIKPTALVIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADE 289
               ++ +V+ +      KP  L  I  G NPTG+ ++    E I ++A  +  +I+ DE
Sbjct: 190 IIPEKLAKVMENWTPGAPKPKLLYTIPTGQNPTGTSIADHRKEAIYKIAQKYDFLIVEDE 249

Query: 290 VY 291
            Y
Sbjct: 250 PY 251

>Skud_5.290 Chr5 complement(463643..464974) [1332 bp, 443 aa] {ON}
           YER152C (REAL)
          Length = 443

 Score = 33.1 bits (74), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 11/33 (33%), Positives = 24/33 (72%)

Query: 259 GNPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
            NP+G+  S+E+  ++I++A  + +++I D+VY
Sbjct: 195 ANPSGNTYSLETRRRLIDIARQYDMLVITDDVY 227

>TPHA0F01260 Chr6 complement(290133..291311) [1179 bp, 392 aa] {ON}
           Anc_2.252 YIL116W
          Length = 392

 Score = 32.7 bits (73), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 28/122 (22%), Positives = 52/122 (42%), Gaps = 7/122 (5%)

Query: 171 DIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPY-YLDESKGW 229
           ++ L  G+   +D L+   CK     +++  P Y                   + E   +
Sbjct: 86  NLCLGVGSDECIDALIRACCKPAVQKIMVLPPTYSMYSVCANINDVDVVNCPLIVEDNSF 145

Query: 230 STDINEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVIIADE 289
             D+    E    +L K      L I +PGNPTG I++++ +  ++E    +G+V++ DE
Sbjct: 146 QMDVKRTLE----TLKKDDLIRLLFITSPGNPTGKIIAIKDIIYVLE-HWKNGLVVV-DE 199

Query: 290 VY 291
            Y
Sbjct: 200 AY 201

>KLTH0D05478g Chr4 (488881..490146) [1266 bp, 421 aa] {ON} similar
           to uniprot|Q01802 Saccharomyces cerevisiae YKL106W AAT1
           Mitochondrial aspartate aminotransferase catalyzes the
           conversion of oxaloacetate to aspartate in aspartate and
           asparagine biosynthesis
          Length = 421

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 43/199 (21%), Positives = 74/199 (37%), Gaps = 19/199 (9%)

Query: 124 AIERARKLLK---EIGSVGSYSSSQGIPAIRKTVANFITKR---DDGEISTPNDIFLT-- 175
           ++ RA+ +L    E+ +  SY   +G P  +  V  F+ K    +  E  + N I     
Sbjct: 59  SVARAQMVLDQSFEMNTDLSYLPIEGCPDFQSNVLQFLYKESCPEGAEFLSKNRISFVQT 118

Query: 176 ---AGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESKGWSTD 232
               GA +    LLS+        V IP P +P               YY     G   D
Sbjct: 119 LSGTGALAVASKLLSLFMS---KAVWIPNPSWPNHANVFQNNGFKRINYYTYYRDG-GLD 174

Query: 233 INEIEEVINDSLDKGIKPTALVIINP--GNPTGSILSVESMEKIIEVAATHGIVIIADEV 290
           ++   + +  ++  G      ++++    NPTG   S+E    I++      ++ I D  
Sbjct: 175 VDSWLQDLEQAVRDGDGSPQCIVLHACCHNPTGVDPSLEQWRTILDKINELNLIPIIDMA 234

Query: 291 YQENVFNNAKFHSMKKVLR 309
           YQ    +    H    +LR
Sbjct: 235 YQG--LDTGDLHKDAYLLR 251

>NCAS0A03830 Chr1 (778327..779667) [1341 bp, 446 aa] {ON} Anc_8.204
          Length = 446

 Score = 32.3 bits (72), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 25/32 (78%)

Query: 260 NPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
           NP+G+  S+++  K+IE+A  + ++II+D+VY
Sbjct: 199 NPSGNTYSLKTKLKLIELARRYDMLIISDDVY 230

>Smik_4.704 Chr4 complement(1246246..1249215) [2970 bp, 989 aa] {ON}
           YDR430C (REAL)
          Length = 989

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 26/82 (31%), Positives = 38/82 (46%), Gaps = 7/82 (8%)

Query: 400 ILNDLSNRAILLWEA----FNSMEGVSCQKPEGAMYLFPKIDLPFKVLQKSQELDITPDE 455
           ILND    A  L EA    F  ++  +  K EG MY    +    K +++ Q LD++  +
Sbjct: 893 ILNDAKWGATDLDEAKLTIFQQVDAPTSPKGEGVMYFMSDVTDDMKQVRREQLLDVSLLD 952

Query: 456 FYC---KALLEATGICTVPGSG 474
            +    K LL   G+ TV G G
Sbjct: 953 VHRVAEKYLLNKRGVSTVIGPG 974

>TDEL0C04090 Chr3 complement(722310..723461) [1152 bp, 383 aa] {ON}
           Anc_2.252 YIL116W
          Length = 383

 Score = 32.0 bits (71), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 31/54 (57%), Gaps = 2/54 (3%)

Query: 238 EVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
           E + D+L K      + I +PGNPTG+ +    +EKI++     GI+++ DE Y
Sbjct: 150 EAVLDTLKKDPLIKLVFITSPGNPTGAKIETSRIEKILQ-NWDQGILVV-DEAY 201

>Kwal_47.17462 s47 (413555..415033) [1479 bp, 492 aa] {ON} YGL202W
           (ARO8) - aromatic amino acid aminotransferase [contig
           207] FULL
          Length = 492

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 34/122 (27%), Positives = 45/122 (36%), Gaps = 2/122 (1%)

Query: 171 DIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXXXXXXXPYYLDESKGWS 230
           DI  T G++   D  L I C N+   VL+    Y               P  LD      
Sbjct: 132 DIITTTGSTQGWDASLRIFC-NKGDTVLLEEYTYSSSVEAADAQGLNCIPMPLDGEGIIP 190

Query: 231 TDINEIEEVINDSLDKGIKPTALVIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADE 289
             + E+    +D       P  L  I  G NPTG  LS      I  +A  + ++II DE
Sbjct: 191 EKLEEMLINWSDLYPDIPMPKLLYTIPTGQNPTGCTLSDSRKPYIYHLAQKYDMIIIEDE 250

Query: 290 VY 291
            Y
Sbjct: 251 PY 252

>Ecym_8365 Chr8 complement(732418..733752) [1335 bp, 444 aa] {ON}
           similar to Ashbya gossypii ADL031W
          Length = 444

 Score = 32.0 bits (71), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 21/53 (39%), Positives = 26/53 (49%), Gaps = 8/53 (15%)

Query: 249 KPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQENVFNNAKF 301
           K  AL + + GNP     +V   EKI EVA  HGI ++ D     N F  A F
Sbjct: 146 KTKALYVESIGNPK---YTVPDFEKITEVAHKHGIPVVVD-----NTFGAAGF 190

>Skud_12.190 Chr12 complement(367635..368318) [684 bp, 227 aa] {ON}
           YLR118C (REAL)
          Length = 227

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 21/31 (67%)

Query: 225 ESKGWSTDINEIEEVINDSLDKGIKPTALVI 255
           +S G+ T ++ IE+ +   +DKGIKP  ++I
Sbjct: 85  DSDGFMTSLDAIEKTVKQEIDKGIKPEHIII 115

>NDAI0D02880 Chr4 (669487..670830) [1344 bp, 447 aa] {ON} Anc_4.53
          Length = 447

 Score = 31.6 bits (70), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/63 (28%), Positives = 33/63 (52%), Gaps = 9/63 (14%)

Query: 234 NEIEEVINDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIVIIADEVYQE 293
           ++ E++I+D      K  A+ + + GNP     +V   EKI+E+A  HG+ ++ D  +  
Sbjct: 138 DDFEKLIDD------KTKAVYLESIGNPK---YNVPDFEKIVEIAHKHGVPVVVDNTFGA 188

Query: 294 NVF 296
             F
Sbjct: 189 GGF 191

>YLR118C Chr12 complement(384725..385408) [684 bp, 227 aa] {ON}
           Acyl-protein thioesterase responsible for
           depalmitoylation of Gpa1p; green fluorescent protein
           (GFP)-fusion protein localizes to both the cytoplasm and
           nucleus and is induced in response to the DNA-damaging
           agent MMS
          Length = 227

 Score = 31.2 bits (69), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 12/31 (38%), Positives = 20/31 (64%)

Query: 225 ESKGWSTDINEIEEVINDSLDKGIKPTALVI 255
           +S G+   +N IE+ +   +DKGIKP  ++I
Sbjct: 85  DSDGFMNSLNSIEKTVKQEIDKGIKPEQIII 115

>Suva_16.403 Chr16 complement(700071..702113) [2043 bp, 680 aa] {ON}
           YPR074C (REAL)
          Length = 680

 Score = 31.6 bits (70), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 17/28 (60%)

Query: 483 HLRTTFLAPGTEWIDRWNKFHAEFYDKY 510
           H + T L PG E  ++WNK  +E+  KY
Sbjct: 296 HYQKTILKPGVEANNKWNKLFSEYQKKY 323

>Kwal_8.585 s8 (15757..17097) [1341 bp, 446 aa] {ON} YER152C -
           Hypothetical ORF [contig 311] FULL
          Length = 446

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 33/55 (60%), Gaps = 2/55 (3%)

Query: 239 VINDSLDKGIKPTALVIINP--GNPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
           +IN + DK      ++ + P   NP+G+  S E   K++++A  + I+II+D+VY
Sbjct: 177 IINAADDKKKFYRYVIYLVPTFSNPSGATYSQECRLKLLDLARRYDILIISDDVY 231

>Smik_16.318 Chr16 complement(569893..571935) [2043 bp, 680 aa] {ON}
           YPR074C (REAL)
          Length = 680

 Score = 31.6 bits (70), Expect = 5.8,   Method: Compositional matrix adjust.
 Identities = 12/28 (42%), Positives = 17/28 (60%)

Query: 483 HLRTTFLAPGTEWIDRWNKFHAEFYDKY 510
           H + T L PG E  ++WNK  +E+  KY
Sbjct: 296 HYQKTILKPGVEANNKWNKLFSEYQKKY 323

>Suva_9.78 Chr9 (137747..138907) [1161 bp, 386 aa] {ON} YIL116W
           (REAL)
          Length = 386

 Score = 31.2 bits (69), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 27/127 (21%), Positives = 59/127 (46%), Gaps = 11/127 (8%)

Query: 168 TPNDIFLTAGASSAVDYLLSILCKNEKSGVLIPIPQYPXXXXXXXXX--XXXXXPYYLDE 225
           T +++ L  G+  ++D ++   C   K  +L+  P Y                 P  + +
Sbjct: 86  TADNLCLGVGSDESIDAIIRACCVPGKEKILVLPPTYSMYSVCANINDIEVVQCPLVVSD 145

Query: 226 SKGWSTDINEIEEVI-NDSLDKGIKPTALVIINPGNPTGSILSVESMEKIIEVAATHGIV 284
           +  +  D+  +  ++ ND L K +      + +PGNPTG+ +    +E++++    +G+V
Sbjct: 146 N-SFQMDVEAVLTILENDPLIKLV-----FVTSPGNPTGAKIKTSLIEQVLQ-NWQNGLV 198

Query: 285 IIADEVY 291
           ++ DE Y
Sbjct: 199 VV-DEAY 204

>KLLA0D11110g Chr4 (948248..949840) [1593 bp, 530 aa] {ON} similar
           to uniprot|P38840 Saccharomyces cerevisiae YHR137W ARO9
           Aromatic aminotransferase catalyzes the first step of
           tryptophan phenylalanine and tyrosine catabolism
          Length = 530

 Score = 30.8 bits (68), Expect = 9.0,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 23/44 (52%), Gaps = 1/44 (2%)

Query: 249 KPTALVIINPG-NPTGSILSVESMEKIIEVAATHGIVIIADEVY 291
           KP  L  I  G NPTG     E  +KI ++   H I+I+ D+ Y
Sbjct: 244 KPRLLYTIVTGQNPTGMTQCKEKRQKIYDLCEKHDIIIVEDDPY 287

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.395 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,066,167
Number of extensions: 2205104
Number of successful extensions: 6340
Number of sequences better than 10.0: 145
Number of HSP's gapped: 6417
Number of HSP's successfully gapped: 145
Length of query: 512
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 398
Effective length of database: 40,409,475
Effective search space: 16082971050
Effective search space used: 16082971050
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)