Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_392.48.266ON28128114120.0
TDEL0F039308.266ON2802653453e-38
Kwal_56.237778.266ON2672563425e-38
KLTH0G13596g8.266ON2672133322e-36
ZYRO0C01562g8.266ON2772793271e-35
SAKL0H16940g8.266ON3033003254e-35
NDAI0B020108.266ON2812742492e-24
TPHA0J007608.266ON2492362456e-24
NCAS0B050408.266ON2732812273e-21
AGR082C8.266ON2662512142e-19
KLLA0F19228g8.266ON3052362152e-19
Suva_10.1758.266ON2992932125e-19
Ecym_43048.266ON2892911932e-16
Smik_12.1508.266ON2922831923e-16
KAFR0B027408.266ON2562711895e-16
YLR091W (GEP5)8.266ON2932831906e-16
Skud_12.1598.266ON2942951765e-14
KNAG0G020608.266ON2862711572e-11
CAGL0L12320g8.266ON278180740.61
NDAI0A042405.494ON55575667.7
Smik_15.5537.9ON89663659.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_392.4
         (281 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON} com...   548   0.0  
TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.26...   137   3e-38
Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {O...   136   5e-38
KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa] ...   132   2e-36
ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {O...   130   1e-35
SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa] ...   129   4e-35
NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.26...   100   2e-24
TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.2...    99   6e-24
NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.26...    92   3e-21
AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON} Sy...    87   2e-19
KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON} conse...    87   2e-19
Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W...    86   5e-19
Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON} ...    79   2e-16
Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W...    79   3e-16
KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.26...    77   5e-16
YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protei...    78   6e-16
Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W...    72   5e-14
KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.26...    65   2e-11
CAGL0L12320g Chr12 (1332269..1333105) [837 bp, 278 aa] {ON} weak...    33   0.61 
NDAI0A04240 Chr1 complement(956685..958352) [1668 bp, 555 aa] {O...    30   7.7  
Smik_15.553 Chr15 complement(977638..980328) [2691 bp, 896 aa] {...    30   9.9  

>Kpol_392.4 s392 complement(4596..5441) [846 bp, 281 aa] {ON}
           complement(4596..5441) [846 nt, 282 aa]
          Length = 281

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/281 (95%), Positives = 269/281 (95%)

Query: 1   MTSVKDLGKRLKPILLESLERLPLHKPTLDILERRIHVADLPFMEEYVGILNEYEISKIN 60
           MTSVKDLGKRLKPILLESLERLPLHKPTLDILERRIHVADLPFMEEYVGILNEYEISKIN
Sbjct: 1   MTSVKDLGKRLKPILLESLERLPLHKPTLDILERRIHVADLPFMEEYVGILNEYEISKIN 60

Query: 61  SKVENESRALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGT 120
           SKVENESRALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGT
Sbjct: 61  SKVENESRALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGT 120

Query: 121 GSLIYLCLNNDDRFFNFYKSQINNKWFNSVDQYKLTDEQRVSIYNDIFKQIFFLKRHTTI 180
           GSLIYLCLNNDDRFFNFYKSQINNKWFNSVDQYKLTDEQRVSIYNDIFKQIFFLKRHTTI
Sbjct: 121 GSLIYLCLNNDDRFFNFYKSQINNKWFNSVDQYKLTDEQRVSIYNDIFKQIFFLKRHTTI 180

Query: 181 SEVNKNMVPIVEVPLKPIGCDIPACRIKNLFNKKVDYIWKXXXXXXXXXXXXHEKIIMNI 240
           SEVNKNMVPIVEVPLKPIGCDIPACRIKNLFNKKVDYIWK            HEKIIMNI
Sbjct: 181 SEVNKNMVPIVEVPLKPIGCDIPACRIKNLFNKKVDYIWKLLSLSSPAISLSHEKIIMNI 240

Query: 241 LEDTKDNRRINRLYRRSLKNSYVFDDTNPIEITYRYASFLQ 281
           LEDTKDNRRINRLYRRSLKNSYVFDDTNPIEITYRYASFLQ
Sbjct: 241 LEDTKDNRRINRLYRRSLKNSYVFDDTNPIEITYRYASFLQ 281

>TDEL0F03930 Chr6 (731115..731957) [843 bp, 280 aa] {ON} Anc_8.266
           YLR091W
          Length = 280

 Score =  137 bits (345), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 87/265 (32%), Positives = 145/265 (54%), Gaps = 11/265 (4%)

Query: 7   LGKRLKPILLESLERLPLHKPTLDILERRIHVADL-PFMEEYVGILNEYEISKINSKVEN 65
           + ++L   LL++LE+LPLH  TLD+L  ++   +L   +     +++  E S+  ++   
Sbjct: 1   MTQQLVQPLLKALEKLPLHSKTLDLLACKLKGDELKTVIIPLAKLVSNLESSRAETQ--- 57

Query: 66  ESRALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTGSLIY 125
             +ALE I+  TH VW +   P HL+ F++HY ++L HWPYE H  +LNM +P + SL Y
Sbjct: 58  RIKALESIIYHTHFVWGSP-LPVHLKMFQSHYTDMLMHWPYERHRSILNMEKPRSTSLRY 116

Query: 126 LCLNNDDRFFNFYKSQINNKWF-NSVDQYKLTDEQRVSIYNDIFKQIFFLKRHTTISEVN 184
              ++     +  +    N W  +++   KLT  QR  +++ +F    FLK +  +    
Sbjct: 117 RWEDSSKTVLSMAEYS-KNPWIEDNILSKKLTIIQRDLLFHSVFSHYLFLKANPRLCNNG 175

Query: 185 KNM-VPIVEVPLKPIGCDIPACRIKNLFNKKVDYIWKXXXXXXXXXXXXHEKIIMNILED 243
           +N+ +PIVE+P++P+G DI   RIKNLF  KV + ++             E I+  I+ D
Sbjct: 176 RNLPIPIVEIPMRPLGNDIAVSRIKNLFKSKVAHTYRILAIENPVLSRGSENILSEIISD 235

Query: 244 TKDNRRINRLYRRSLKNSYV--FDD 266
              +R+  RLY+ S K +YV  +DD
Sbjct: 236 A-SSRKQRRLYQASCKRAYVMEYDD 259

>Kwal_56.23777 s56 complement(701822..702625) [804 bp, 267 aa] {ON}
           YLR091W - Hypothetical ORF [contig 173] FULL
          Length = 267

 Score =  136 bits (342), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 81/256 (31%), Positives = 138/256 (53%), Gaps = 21/256 (8%)

Query: 16  LESLERLPLHKPTLDILERRIHVAD-LPFMEEYVGILNEYEISKINSKVENESRALEKIV 74
           ++ LE+LPL   TL ++E+R+  A+ L F+E    +  +YE  K       + + LE I+
Sbjct: 5   IQVLEKLPLDVRTLKLIEKRLERAESLRFLE----LARQYEAKK-------DYKTLENII 53

Query: 75  KKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTGSLIYLCLNNDDRF 134
             T+  W N+  P H++ F+ HY EL   WPYE H  +L M  P + S+ +L    + R 
Sbjct: 54  HHTYFSWENE-IPQHIKAFREHYNELRDFWPYECHRTILGMQSPKSQSIRFLWSAGNPRV 112

Query: 135 FNFYKSQINNKWFNSVDQYKLTDEQRVSIYNDIFKQIFFLKRHTTISEVNKNM-VPIVEV 193
               +   +  W       +LT+ +R   +++IF+   FL+R   + +  K++ VPIVE+
Sbjct: 113 LAAMRYG-SYGWNREGGGERLTELERTLRFHEIFQHFLFLQRRPQLCKNRKHLSVPIVEI 171

Query: 194 PLKPIGCDIPACRIKNLFNKKVDYIWKXXXXXXXXXXXXHEKIIMNILEDTK------DN 247
           P+KP+G +I   RIKNLF +KV Y+W+            +E ++M+I+E  +       +
Sbjct: 172 PMKPLGQNIADVRIKNLFKRKVAYVWRILAVDNPALSAENESLLMDIIESPQLPQGQTSS 231

Query: 248 RRINRLYRRSLKNSYV 263
           R + RLY+R+ + +YV
Sbjct: 232 RMLKRLYQRACRGAYV 247

>KLTH0G13596g Chr7 complement(1165293..1166096) [804 bp, 267 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 267

 Score =  132 bits (332), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 69/213 (32%), Positives = 117/213 (54%), Gaps = 13/213 (6%)

Query: 63  VENESRALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTGS 122
            +  S++LE IV  T+  W N+  P H++KF+ HY EL  HWPYEFH  +L+M  P T S
Sbjct: 42  ADGSSKSLESIVHLTYFHWCNEDAP-HIKKFREHYAELRDHWPYEFHRSILSMDTPKTQS 100

Query: 123 LIYLCLNNDDRFFNFYKSQINNKWFNSVDQ--YKLTDEQRVSIYNDIFKQIFFLKRHTTI 180
           + +L  +N  +  +    +   K+ +  ++   +LT+ QR   ++++F+   FLK    +
Sbjct: 101 IRFLWSSNSPKVLSKMSYE---KYAHDTEERPSRLTELQRTVQFHEVFQHFLFLKSRPHL 157

Query: 181 SEVNKNM-VPIVEVPLKPIGCDIPACRIKNLFNKKVDYIWKXXXXXXXXXXXXHEKIIMN 239
            +  K + VPIVE+P+KP+G +IP  R++NLF +K+ Y+WK            +E  +  
Sbjct: 158 CKTRKGLAVPIVEIPMKPLGQNIPEVRVRNLFKRKIAYVWKVLALDSPALSRQNELSLAK 217

Query: 240 IL------EDTKDNRRINRLYRRSLKNSYVFDD 266
           I+      ED    R + RLY+R+ + +Y  + 
Sbjct: 218 IIDSPQLPEDVSSKRELKRLYQRACRGAYTIEQ 250

>ZYRO0C01562g Chr3 complement(111407..112240) [834 bp, 277 aa] {ON}
           weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 277

 Score =  130 bits (327), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 84/279 (30%), Positives = 147/279 (52%), Gaps = 17/279 (6%)

Query: 9   KRLKPILLESLERLPLHKPTLDILERRIHVADLPFMEEYVGILNEYEISKINSKVENESR 68
           + L P L  S+ +LPLH  T  +LE     +       Y  +L   +IS+      N+ +
Sbjct: 7   QELIPALSRSIRQLPLHIETQKVLEFYCRNSS------YKSLLVAQDISEFEK--HNDHK 58

Query: 69  ALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTGSLIYLCL 128
            LE +++KTH +W+N   P  L++F+ ++ EL +HWPYE+   +L+M+ P   S  YL  
Sbjct: 59  YLEALIQKTHFLWDNP-LPPFLKRFQLYHKELTNHWPYEYQRSLLSMSNPRKESQGYLWR 117

Query: 129 NNDDRFFNFYKSQINNKWFNSVDQYKLTDEQRVSIYNDIFKQIFFLKRHTTISEVNKNM- 187
           +  +   +  + +  ++W +     +L+ EQ   + + IF Q FFLK H  +   N+ + 
Sbjct: 118 DGKELALSNLRFE-KHRWADENIIERLSPEQGTQLLHSIFHQYFFLKSHARLCYNNRKIP 176

Query: 188 VPIVEVPLKPIGCDIPACRIKNLFNKKVDYIWKXXXXXXXXXXXXHEKIIMNILEDTKDN 247
           VPIVE+PL+P+G D+  CRI+NLF +K   +W             +E+++  I+  + + 
Sbjct: 177 VPIVEIPLRPMGNDVADCRIRNLFKRKTAVVWNLLAWENRPLSTRNEQLLGEIITKS-ET 235

Query: 248 RRINRLYRRSLKNSYVFD----DTNPIEIT-YRYASFLQ 281
           R + RLY+R+ + +YV      D N +++  +R    LQ
Sbjct: 236 RSMRRLYQRASRRAYVVTNEGKDPNGLQVPEFRPGEILQ 274

>SAKL0H16940g Chr8 complement(1488620..1489531) [912 bp, 303 aa]
           {ON} weakly similar to uniprot|Q12393 Saccharomyces
           cerevisiae YLR091W Hypothetical ORF
          Length = 303

 Score =  129 bits (325), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 86/300 (28%), Positives = 151/300 (50%), Gaps = 43/300 (14%)

Query: 15  LLESLERLPLHKPTLDILERRIHVADLPFMEEYVGILNEYEISKINSKVENESRALEKIV 74
           LL  LE LPL   TLD+LE  + +     ++     L +Y+ ++        S++LE IV
Sbjct: 7   LLNFLECLPLDTRTLDLLEGTVKLCSSALLDTLEQKLFDYQANE-------NSKSLEWIV 59

Query: 75  KKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTGSLIYLCLNNDDRF 134
             T+  WNN   P H++KF+ +Y +L  HWPYE H D+L+M+ P   S+ ++  +N+ + 
Sbjct: 60  YNTYFHWNNTT-PLHIQKFRQNYHDLREHWPYERHRDLLSMSAPERVSIRHMWNDNNKKV 118

Query: 135 FNFYK------------SQINNKWFNSVDQYKLTDEQR-----------------VSIYN 165
            +  +             Q+N    N +  Y+  +E++                   +++
Sbjct: 119 LSSMRFERNPWCRNDPLEQLNAFNVNKILNYQALEEEKNRGSMLSTLPKISQLELTLLFH 178

Query: 166 DIFKQIFFLKRHTTISEVNKNM-VPIVEVPLKPIGCDIPACRIKNLFNKKVDYIWKXXXX 224
           +IF+   FLKR+  + +  K + +PIVE+P+KP+G DIP  RI+NLF +K    WK    
Sbjct: 179 EIFQHYMFLKRNPKLCKYGKKLPIPIVEIPMKPLGQDIPLVRIRNLFKRKAAATWKLLAE 238

Query: 225 XXXXXXXXHEKIIMNILED-----TKDNRRINRLYRRSLKNSYVFDDTNPIEITYRYASF 279
                   +E ++++I+       +  NR+I RLY+R+ K+SYV  +   I + ++ +  
Sbjct: 239 ENPVLSLENEALLLDIIASPHHSTSVSNRKIKRLYQRACKHSYVICEDRSIGLDFQISKL 298

>NDAI0B02010 Chr2 (498932..499777) [846 bp, 281 aa] {ON} Anc_8.266
           YLR091W
          Length = 281

 Score =  100 bits (249), Expect = 2e-24,   Method: Compositional matrix adjust.
 Identities = 75/274 (27%), Positives = 127/274 (46%), Gaps = 17/274 (6%)

Query: 7   LGKRLKPILLESLERLPLHKPTLDILERRIHVADLPFMEEY----VGILNEYEISKINSK 62
           L  +L   LL SL+ LPLH  TL  LER+    ++   + +    + ++N YE ++ + +
Sbjct: 4   LNSKLTKTLLSSLQNLPLHSNTLAQLERKCLTRNIKATKSFKIPLLTLINSYEKAQASGQ 63

Query: 63  VENESRALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTGS 122
            +  ++ LE I+  T+  W ND   +HL+ F+  Y  LL  WP+ +HS +         +
Sbjct: 64  SKLSNKTLESIIYHTYFEWTND-LASHLKPFQRQYSTLLTFWPHIYHSKI-----DSKKN 117

Query: 123 LIYLCLNNDDRFFNFYKSQINNKWFNSVDQYKLTDEQRVSIYNDIFKQIFFLKRHTTISE 182
            I L  N      N  +  +++   N         +    I+  I++   FL  + ++  
Sbjct: 118 SIILTWNKSSNSKNMLRELLSH--LNYTQSLVPQKKDFQVIFKKIYQHYIFLSLNPSLCS 175

Query: 183 VNKNM-VPIVEVPLKPIGCDIPACRIKNLFNKKVDYIWKXXXXXXXXXXXXHEKIIMNIL 241
             K +  PIVE+P+  +G DIP  RI NL   K+   W             +E  +  I+
Sbjct: 176 NGKRLPSPIVEIPMNAMGYDIPKKRINNLLRSKIARTWNYLAITNPILNLENEAQLDEII 235

Query: 242 EDTK--DNRRINRLYRRSLKNSYVF--DDTNPIE 271
             +    +R++ +LYRR+  NSYV   +D N IE
Sbjct: 236 NGSSAIKSRQLRKLYRRACSNSYVIKNEDDNNIE 269

>TPHA0J00760 Chr10 (178665..179414) [750 bp, 249 aa] {ON} Anc_8.266
           YLR091W
          Length = 249

 Score = 99.0 bits (245), Expect = 6e-24,   Method: Compositional matrix adjust.
 Identities = 76/236 (32%), Positives = 121/236 (51%), Gaps = 38/236 (16%)

Query: 11  LKPILLESLERLPLHKPTLDILERRIHVADLPFMEEYVGILNEYEISKINSKVENESRAL 70
            K I+L+ L RLPLH  TLD+L++++H   L    E + +L +Y  + IN +   + + L
Sbjct: 17  FKQIILDGLNRLPLHPNTLDLLQKQVH-TKLTKNSELIELLFDYNNAFINKQKPGQLKCL 75

Query: 71  EKIVKKTHIVWNND-KFPNHLEKFKNHYMELLHHWPYEFHSDVLNMAR---PGTGSLIYL 126
           ++I+ KTH+++NN  K  +HL+ FK  Y  L H+WPYE H D+L  A    P T +L YL
Sbjct: 76  QRIIFKTHLIFNNSYKNYDHLKAFKLKYNYLTHNWPYERH-DILFAANKNVPETKALEYL 134

Query: 127 CLNNDDRFFNFYKS--------QINNKWFNSVDQYKLTDEQR------------------ 160
             N +     F  S        QI NK+    D   +  ++R                  
Sbjct: 135 WNNCNSDNLAFMGSKFMKEITRQIQNKYITEGDYVHVFLKERYNSEIHTLSEIIDEKEIE 194

Query: 161 VSIYNDIFKQIFFLKRHTTISEVNKNMVPIVEVPLKPIGCDIPACRIKNLFNKKVD 216
           ++++ ++FKQ+ +      I+ +NK  +PIV +PL  +G  IP  R+ N F KK+ 
Sbjct: 195 INLFGELFKQLHY------INTINKLQIPIVILPLNALGLKIPKSRLYNKFKKKLQ 244

>NCAS0B05040 Chr2 (935985..936806) [822 bp, 273 aa] {ON} Anc_8.266
           YLR091W
          Length = 273

 Score = 92.0 bits (227), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 77/281 (27%), Positives = 125/281 (44%), Gaps = 25/281 (8%)

Query: 7   LGKRLKPILLESLERLPLHKPTLDILERRIHVAD-----LPFMEEYVGILNEYEISKINS 61
           + K +   LL SL  +PLH+ TLD+LER+I  A+       F    + +L +YE   I  
Sbjct: 1   MEKSVTTTLLRSLPNVPLHRKTLDLLERKIQTANDKSTRHSFKVPLLQLLCKYERYNIQE 60

Query: 62  KVENESRALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTG 121
                 + LE I   T+ +WNN   P+HL+ F+ +   L  +WP  +H   ++  R    
Sbjct: 61  DKRGIEKVLESIAYNTYFIWNNP-VPSHLQVFQKNNEMLRRYWPCVYHRG-MDTKR---D 115

Query: 122 SLI--YLCLNNDDRFFNFYKSQINNKWFNSVDQYKLTDEQRVSIYNDIFKQIFFLKRHTT 179
           S+I  +   NN D       + I                + + ++  IF+   FL  +  
Sbjct: 116 SIIVQWAKSNNGDALLKGTMNHIQPG----------ASAEELLMFKKIFQHYIFLTLNAR 165

Query: 180 ISEVNKNMV-PIVEVPLKPIGCDIPACRIKNLFNKKVDYIWKXXXXXXXXXXXXHEKIIM 238
           I+   K +  P+V VP+  +G  IP  R+KNLF KKV +               +   + 
Sbjct: 166 ITSNAKRLQPPLVGVPMNSMGETIPQVRVKNLFRKKVSWTANALCALNPVLNVENHGFLD 225

Query: 239 NILEDTKDN--RRINRLYRRSLKNSYVFDDTNPIEITYRYA 277
            I+    +N  R + RLY+R+ KN++V    +P  I +  A
Sbjct: 226 EIINADYENTSRSLRRLYQRASKNAHVIAGESPESIQFAIA 266

>AGR082C Chr7 complement(882744..883544) [801 bp, 266 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR091W
          Length = 266

 Score = 87.0 bits (214), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 60/251 (23%), Positives = 111/251 (44%), Gaps = 12/251 (4%)

Query: 19  LERLPLHKPTLDILERRIHVADLPFMEEYVGILNEYEISKINSKVENES-RALEKIVKKT 77
           + RLPLH+ T +++   +      +  E + +     +  +N  +     + L+++V   
Sbjct: 9   VSRLPLHRATSEVILAYLSKQQAQYPTERIEL-----VEPLNDFLRKGGHQGLQRLVFHV 63

Query: 78  HIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTGSLIYLCLNNDDRFFNF 137
           H      + P HL   + H  EL   WPYE H  +L ++   + SL  L  +  +     
Sbjct: 64  HFQLML-RAPEHLRLLRRHREELQRFWPYERHHSLLALSDVRSQSLRRLWEDGQEEVLQQ 122

Query: 138 YKSQINNKWFNSVD---QYKLTDEQRVSIYNDIFKQIFFLKRHTTISEVNKNMVPIVEVP 194
            +    + W    D   +Y LT  QR  + + +F Q  FLK+   +  V +  +P+VE+ 
Sbjct: 123 MQY-CRHHWLREGDVPERYALTQAQREEVLHRVFAQYMFLKQRPALWSVRRLPIPVVEIG 181

Query: 195 LKPIGCDIPACRIKNLFNKKVDYIWKXXXXXXXXXXXXHEKIIMNILEDTKDNRRINRLY 254
           + P+G DIP  R+  LF  K   + +             E+ ++ I+ +    R + R+Y
Sbjct: 182 MTPLGFDIPDVRVDGLFKDKTKSVLRLLYREHPALTPAAEEDMLRIIAEC-PTRAMRRIY 240

Query: 255 RRSLKNSYVFD 265
            R+ + +YV D
Sbjct: 241 LRACRRAYVLD 251

>KLLA0F19228g Chr6 (1781494..1782411) [918 bp, 305 aa] {ON}
           conserved hypothetical protein
          Length = 305

 Score = 87.4 bits (215), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/236 (30%), Positives = 100/236 (42%), Gaps = 26/236 (11%)

Query: 56  ISKINSKVENESR-ALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLN 114
           + ++NS  EN +R  LEK+V   H    ND  P H++  + +  EL   WPYE    +L 
Sbjct: 38  LHRLNSFNENPTRKTLEKLVYSVHFHLLNDP-PKHVDILRQYPNELAKFWPYEMQHSILE 96

Query: 115 MARPG-TGSLIYLCLNNDDRF----FNFYKSQINNKW-------------FNSVDQYKLT 156
           M  P  T   I    NN D      FN +K      W              + +   ++T
Sbjct: 97  MDDPNLTSQTILWSRNNKDALDFLSFNRHKWLRPKNWQTPNEELIKDITGIDGLQSTQIT 156

Query: 157 DEQRV------SIYNDIFKQIFFLKRHTTISEVNKNMVPIVEVPLKPIGCDIPACRIKNL 210
           +  R+           IF+  +FLK +  +    K   PIVE+ +KP G DI   RI NL
Sbjct: 157 EVLRLPAEKIKETLRQIFEHYYFLKTNPKLCATKKLQAPIVEIGMKPDGFDIADIRIDNL 216

Query: 211 FNKKVDYIWKXXXXXXXXXXXXHEKIIMNILEDTKDNRRINRLYRRSLKNSYVFDD 266
           F KKV  I               E I+ +I+ D   NRR  RLY+     SY+F D
Sbjct: 217 FKKKVKLISDLLYSQNPVLTSDAESILTSIVNDPDLNRRTKRLYKNVASRSYLFKD 272

>Suva_10.175 Chr10 (327133..328032) [900 bp, 299 aa] {ON} YLR091W
           (REAL)
          Length = 299

 Score = 86.3 bits (212), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 78/293 (26%), Positives = 128/293 (43%), Gaps = 38/293 (12%)

Query: 14  ILLESLERLPLHKPTLDILERR---IHVADLPFMEEYVGI---LNEYEISKINSKVENES 67
           +LL  ++ LPLH+ T   L  R   IH +D  F E  V +   L  YE ++    +    
Sbjct: 8   LLLPFIDSLPLHQITKTALTTRLTDIH-SDFKFKEIAVPLTESLQVYEKAQRAQDLRTSL 66

Query: 68  RALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTGSLIYLC 127
           +ALE IV +TH  WNN + P H   F+ HY  LL HWP+E H  +++      G LI L 
Sbjct: 67  KALESIVYQTHFQWNNPR-PRHAHLFQKHYHFLLSHWPFENHRSLVDSIPAQNGKLISLT 125

Query: 128 LNNDDRFFNFYKS------QINNKWF---------------NSVDQYKLTDEQRVSIYND 166
                   N+ K+      Q+ N W                NS+ +      +R  +   
Sbjct: 126 SKG-----NWLKADWTTLFQVKNPWVRTPPPPPSPSLSLAQNSIAELDAFTAERTFLVKS 180

Query: 167 IFKQIFFLKRHTTISEVNKNM-VPIVEVPLK-PIGCDIPACRIKNLFNKKVDYIWKXXXX 224
           +     FL  ++ +S  +K    P+V++P++  +G   P  +I  LF +++  I+     
Sbjct: 181 LGNHYKFLVTNSHLSYNHKKYPSPVVQIPIRNALGEISPPKQISKLFARQLAQIYTSLFV 240

Query: 225 XXXXXXXXHEKIIMNILEDTKDNRRINRLYRRSLKNSYVF--DDTNPIEITYR 275
                   +E  +M + +D    RR  RLY R+   +Y     D++   +T+R
Sbjct: 241 ENPPLSTANELALMTVFDDGTLERRHTRLYMRACARAYTIANADSDNEPLTFR 293

>Ecym_4304 Chr4 complement(647890..648759) [870 bp, 289 aa] {ON}
           similar to Ashbya gossypii AGR082C
          Length = 289

 Score = 79.0 bits (193), Expect = 2e-16,   Method: Compositional matrix adjust.
 Identities = 76/291 (26%), Positives = 122/291 (41%), Gaps = 47/291 (16%)

Query: 15  LLESLERLPLHKPTLDILERRIHVADLPFMEEYVGILNEYEISKINS-------KVENES 67
           +LE + RLPLH  T  +      +AD       VG + + E  +++         +  E 
Sbjct: 8   VLEIVSRLPLHAHTKKV------IAD------NVGSVGKGEFKRVDVIEPINRYLLSGEV 55

Query: 68  RALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTGSLIYLC 127
             L +++   +    N K   H+ +F+ +  EL   WPYE HS +L+  RP   S  YL 
Sbjct: 56  SYLRRVIFDVYFRILNPK-AEHVRQFERYLKELQLFWPYERHSCLLSGERPYKDSARYLW 114

Query: 128 LNND----------------DRFFNFYKSQINNKWFNSVDQY--------KLTDEQRVSI 163
             N+                DR   F    I  + F    QY         L + +R+++
Sbjct: 115 SRNNAKVLDIMRYDRHLWLRDREPKFSLDSIFGEPFTQQLQYLRHEKDKNTLGETERIAL 174

Query: 164 YNDIFKQIFFLKRHTTISEVNKNMVPIVEVPLKPIGCDIPACRIKNLFNKKVDYIWKXXX 223
              IF    F+K   T+       +PIVEV + P+G D+P  RI NLF K+     K   
Sbjct: 175 LKLIFSHYLFVKSRPTLCGHKNLPIPIVEVGMSPLGEDMPDVRIDNLFRKRSKATLKTLL 234

Query: 224 XXXXXXXXXHEKIIMNILEDTKDNRRINRLYRRSLKNSYVFD-DTNPIEIT 273
                     E ++ +I+++   +R + RLY+ S   +Y  D  TN  E++
Sbjct: 235 HDFPPLSREVESLLHSIIKEC--DRSMGRLYKWSCNGAYTMDPKTNQFEVS 283

>Smik_12.150 Chr12 (302200..303078) [879 bp, 292 aa] {ON} YLR091W
           (REAL)
          Length = 292

 Score = 78.6 bits (192), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 71/283 (25%), Positives = 126/283 (44%), Gaps = 27/283 (9%)

Query: 7   LGKRLKPILLESLERLPLHKPTLDILERRIH--VADLPFMEEYVGI---LNEYEISKINS 61
           +  R+  +LL  ++ +PLH+ T + L   +    +D  F E  V +   L  +E ++   
Sbjct: 1   MASRVNDLLLPVIQSIPLHQITKNALVTTLTDTQSDYKFKEIAVPLTKLLQVHEKAQRRQ 60

Query: 62  KVENESRALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTG 121
            +    +ALE I+ +TH  WNN + P H   F+ HY  LL HWP+E H  +++      G
Sbjct: 61  DLRTALKALESIIYQTHFKWNNPR-PRHALLFQKHYHFLLTHWPFENHRLLVDSIAAHKG 119

Query: 122 SLIYLCLNNDDRFFNFYKS------QINNKWFNSVDQYKLTDE--------QRVSIYNDI 167
                 LN+      + K+      Q+ N W  +    K   E        +R  + N +
Sbjct: 120 K-----LNSIPSKTTWLKADWATLFQVKNPWVQTPPTPKNLSETDLDAFTPERAFLVNSL 174

Query: 168 FKQIFFLKRHTTISEVNKNM-VPIVEVPLK-PIGCDIPACRIKNLFNKKVDYIWKXXXXX 225
             Q  FL  ++ +S  +K    P V++P++  +G   P  +I  LF++++ YI+      
Sbjct: 175 GNQYKFLIANSHLSYNHKKYPSPGVQIPIRNALGEVSPPKQISRLFSRQLAYIYTSLFEE 234

Query: 226 XXXXXXXHEKIIMNILEDTKDNRRINRLYRRSLKNSYVFDDTN 268
                  ++  +M I  D   +RR  RLY R+   +Y   + +
Sbjct: 235 NPPLSPANDIALMAIFNDKTMDRRFKRLYMRACARAYTITNAD 277

>KAFR0B02740 Chr2 (561513..562283) [771 bp, 256 aa] {ON} Anc_8.266
           YLR091W
          Length = 256

 Score = 77.4 bits (189), Expect = 5e-16,   Method: Compositional matrix adjust.
 Identities = 73/271 (26%), Positives = 121/271 (44%), Gaps = 47/271 (17%)

Query: 7   LGKRLKPILLESLERLPLHKPTL----DILERRIHVADLPFMEEYVGILNEYEISKINSK 62
           + K ++  +  ++E LPLH+ TL    D L+R   +A +P + + V     YE +     
Sbjct: 12  VTKEVRDKITNAIEGLPLHQKTLLQLQDTLKRNDALA-IPLLRDVVS----YETT----- 61

Query: 63  VENESRALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTGS 122
              +S+ LE I+ + +  W N+  P+HL+   N Y  L  +WP E H    N A P   S
Sbjct: 62  --GKSKFLESIIYRLYFQWLNE-VPSHLKPLLNQYEHLKSNWPIERHIKFKN-AEPEAIS 117

Query: 123 LIYLCLNNDDRFFNFYKSQINNKWFNSVDQYKLTDEQRVSIYNDIFKQIFFLKRHTTISE 182
           L                    N W    ++    D   +S  + + K I    R+  ++E
Sbjct: 118 L-------------------RNAWMR--NKATAVD---LSTSDGVIKPILNHFRYLRVNE 153

Query: 183 ----VNKNMVPIVEVPLKPIGCDIPACRIKNLFNKKVDYIWKXXXXXXXXXXXXHEKIIM 238
                 K  +PI+EVPL   G +IP CR+ NL  K++ ++ K             E  + 
Sbjct: 154 DRLCKKKVGLPILEVPLNVFGTEIPECRVNNLLKKRIAHVKKSLLEDNPMLSPKLEDTLH 213

Query: 239 NILEDTKDNRRINRLYRRSLKNSYVFDDTNP 269
           +I+ D+K+ R + R+Y RS   +Y   ++NP
Sbjct: 214 SIINDSKNTRALKRVYLRSCSRAYT-GESNP 243

>YLR091W Chr12 (322297..323178) [882 bp, 293 aa] {ON}  GEP5Protein
           of unknown function, required for mitochondrial genome
           maintenance; detected in highly purified mitochondria in
           high-throughput studies; null mutant has decreased
           levels of cardiolipin and phosphatidylethanolamine
          Length = 293

 Score = 77.8 bits (190), Expect = 6e-16,   Method: Compositional matrix adjust.
 Identities = 72/283 (25%), Positives = 125/283 (44%), Gaps = 27/283 (9%)

Query: 7   LGKRLKPILLESLERLPLHKPTLDILERRIHV--ADLPFMEEYVGI---LNEYEISKINS 61
           +  ++  +LL  +E  PLH+ T   L   +    +D  F E  V +   L  YE ++   
Sbjct: 1   MASQVNALLLPVIESTPLHQITKVALTTTLTSKQSDYKFKEIAVPLTKSLQLYEKAQRRQ 60

Query: 62  KVENESRALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTG 121
            +    +ALE I+ +TH  WNN   P H   F+ HY  LL HWP+E H D+++      G
Sbjct: 61  DLRASLKALESIIYQTHFQWNN-PLPRHAHLFQKHYHFLLTHWPFENHRDLVDSIAVNNG 119

Query: 122 SLIYLCLNNDDRFFNFYKS------QINNKWFN---SVDQYKLTD-----EQRVSIYNDI 167
                 LN+      + K+       + N W     S+ +   TD      +R+ + N +
Sbjct: 120 K-----LNSTSSRSVWLKADWITLFNVKNPWVQTPPSLMRLSGTDLDTFTPERIFLINSL 174

Query: 168 FKQIFFLKRHTTISEVNKNM-VPIVEVPLK-PIGCDIPACRIKNLFNKKVDYIWKXXXXX 225
                FL  ++ +S  +K    P V++P++  +G   PA +I  LF +++ +I+K     
Sbjct: 175 GNHYKFLIANSHLSYNHKKYPSPGVQIPVRNALGEVSPAKQIAQLFARQLSHIYKSLFIE 234

Query: 226 XXXXXXXHEKIIMNILEDTKDNRRINRLYRRSLKNSYVFDDTN 268
                  +E  +  +  D    RR+ RLY R+   +Y   + +
Sbjct: 235 NPPLSPENELALTAVFYDETVERRLRRLYMRACARAYTTTNAD 277

>Skud_12.159 Chr12 (305467..306348) [882 bp, 294 aa] {ON} YLR091W
           (REAL)
          Length = 294

 Score = 72.4 bits (176), Expect = 5e-14,   Method: Compositional matrix adjust.
 Identities = 73/295 (24%), Positives = 128/295 (43%), Gaps = 32/295 (10%)

Query: 7   LGKRLKPILLESLERLPLHKPTLDILERRIHV--ADLPFMEEYVGI---LNEYEISKINS 61
           +  R+K +LL  +E LPLH+ T   L   +    +D  F E  V +   L  YE ++   
Sbjct: 1   MTSRIKGVLLPFIESLPLHRITKTALTTTLVGIQSDYKFKEIAVPLTESLQVYEKAQRRQ 60

Query: 62  KVENESRALEKIVKKTHIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTG 121
            +    +ALE I+ +TH  WNN + P H   F+ H+  LL HWP+E H  +++      G
Sbjct: 61  DLRTSLKALESIIFQTHFQWNNPR-PRHALLFQKHHYFLLSHWPFENHRSLVDSICAHNG 119

Query: 122 SLIYLCLNNDDRFFNFYKS------QINNKW-----------FNSVDQYKLTDEQRVSIY 164
                 LN+      + K+      Q+ N W           ++          +R  + 
Sbjct: 120 K-----LNSMASKGTWLKADWTTLFQVKNTWVQTPPASTSPAYHGGANLDAFTPERTFLV 174

Query: 165 NDIFKQIFFLKRHTTISEVNKNM-VPIVEVPLK-PIGCDIPACRIKNLFNKKVDYIWKXX 222
           N +     FL  ++ +S  +K    P V++P++  +G    + +I  LF++++  I+   
Sbjct: 175 NSLGNHYKFLVANSHLSYNHKKYPPPAVQIPIRNALGELSLSKQIAKLFSRQLTQIYTSL 234

Query: 223 XXXXXXXXXXHEKIIMNILEDTKDNRRINRLYRRSLKNSY--VFDDTNPIEITYR 275
                     +E  +M +  D   +RR  RLY R+   +Y  V  D+    +T+R
Sbjct: 235 FVENPPLSADNELALMAVFHDDSLDRRHKRLYMRACARAYTTVNSDSTIEPLTFR 289

>KNAG0G02060 Chr7 (468363..469223) [861 bp, 286 aa] {ON} Anc_8.266
           YLR091W
          Length = 286

 Score = 65.1 bits (157), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 64/271 (23%), Positives = 107/271 (39%), Gaps = 30/271 (11%)

Query: 15  LLESLERLPLHKPTLDILERRIHVA---DLPFMEEYVGILNEYEISKINSKVENESRALE 71
           LL  L  LPLH  TL  L R  HVA    +P ++     L  +     ++K   + + L 
Sbjct: 8   LLRELRSLPLHSLTLARLSR--HVAATKSIPRLKHVAETLQNFH-DVPSTKKHTQYKILT 64

Query: 72  KIVKKTHIVWNND-----KFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTGSLIYL 126
            ++ + +  W+N        P HL  F+  +  L+  WP E H   L  +  G  +L + 
Sbjct: 65  TLLLQLYCQWDNSFSRLSHLPPHLAPFEQDFPGLVRIWPRESHLS-LKQSTKGHATLKHA 123

Query: 127 CLNNDDRFFNF-YKSQINNKWFNSVDQYKLTDEQRVSIYNDIFKQIFFLKRHTTISEVNK 185
            + N+       + +   N    +++  + +  Q +S Y  ++  +    +        K
Sbjct: 124 WVTNNKHALQMSFDAAAANPTSGNIE-LRGSLRQILSHYQLLYNNMRMFGK-------IK 175

Query: 186 NMVPIVEVPLKPIGCDIPACRIKNLFNKKVDYIWKXXXXXXXXXXXXH-----EKIIMNI 240
             VP+ E+PL   G +IPACR  NL  +KV Y+ +                    II   
Sbjct: 176 LQVPVAEIPLNVFGEEIPACRTANLLQRKVGYVKRVLIEELPALYNTECIAELTAIIAGD 235

Query: 241 LEDTKDN----RRINRLYRRSLKNSYVFDDT 267
               +      R++ RLYRR+    Y    T
Sbjct: 236 GPAARSGNYSPRQLRRLYRRAFAGCYTLAST 266

>CAGL0L12320g Chr12 (1332269..1333105) [837 bp, 278 aa] {ON} weakly
           similar to uniprot|Q12393 Saccharomyces cerevisiae
           YLR091w
          Length = 278

 Score = 33.1 bits (74), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 32/180 (17%), Positives = 62/180 (34%)

Query: 78  HIVWNNDKFPNHLEKFKNHYMELLHHWPYEFHSDVLNMARPGTGSLIYLCLNNDDRFFNF 137
           H++   ++ P HL ++++ Y  L+  WP      +L+    G G  + +  N   R    
Sbjct: 64  HVLAPMNELPAHLRQYQSEYHALVASWPTVTERQILDAMELGKGMAVRIPHNKTLRQMFE 123

Query: 138 YKSQINNKWFNSVDQYKLTDEQRVSIYNDIFKQIFFLKRHTTISEVNKNMVPIVEVPLKP 197
               +  +      + K     R  +             +T  SE++    P+    L P
Sbjct: 124 QHEWLVQQRLLDDKRLKRRRLLRCEVQMATPTTNGSTNGNTNGSEISFRQCPLTIRELTP 183

Query: 198 IGCDIPACRIKNLFNKKVDYIWKXXXXXXXXXXXXHEKIIMNILEDTKDNRRINRLYRRS 257
           +G      + KN     V  +W+            H   ++  L+ T    R +R   R+
Sbjct: 184 LGALESEAKFKNRVRSDVHSLWRLLAVQHPPLSRPHADELVRTLKRTLGTSRTDRSIARA 243

>NDAI0A04240 Chr1 complement(956685..958352) [1668 bp, 555 aa] {ON}
           Anc_5.494 YDR403W
          Length = 555

 Score = 30.0 bits (66), Expect = 7.7,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 38/75 (50%), Gaps = 4/75 (5%)

Query: 99  ELLHHWPYEFHSDVLNMARPGTGSLIYLCLNNDDRFFNFYKSQI-NNKWFNSVDQYKLTD 157
           +++ H+ ++ H    N+A PGT  + +  LN  D FF+    ++ N+KW   V     T 
Sbjct: 284 DIVTHYTHKLHELYANIATPGTDYIGFCGLN--DIFFDGVTQELFNSKWVEDVKIEHYTG 341

Query: 158 EQRVSIYNDIFKQIF 172
             ++   +D+ +QI 
Sbjct: 342 -SKICPTSDLSRQIL 355

>Smik_15.553 Chr15 complement(977638..980328) [2691 bp, 896 aa]
          {ON} YOR371C (REAL)
          Length = 896

 Score = 29.6 bits (65), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 33/63 (52%), Gaps = 8/63 (12%)

Query: 18 SLERLPLH-KPTLDIL---ERRIHVAD----LPFMEEYVGILNEYEISKINSKVENESRA 69
          SLE  PLH +PT+ I    E R H  +    L F+  YV + ++     I+SK+  E+ A
Sbjct: 11 SLEAHPLHTQPTVHIKLSKEERSHYRERYHSLKFISNYVSVFDQAMSDNIDSKIRKENEA 70

Query: 70 LEK 72
          L K
Sbjct: 71 LLK 73

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.139    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,869,964
Number of extensions: 1564706
Number of successful extensions: 5253
Number of sequences better than 10.0: 47
Number of HSP's gapped: 5391
Number of HSP's successfully gapped: 48
Length of query: 281
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 173
Effective length of database: 41,097,471
Effective search space: 7109862483
Effective search space used: 7109862483
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 65 (29.6 bits)