Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_392.38.268ON28128112771e-179
YDR116C (MRPL1)8.268ON2852727601e-100
KLTH0G13552g8.268ON2812447522e-99
Smik_4.3608.268ON2852727522e-99
TPHA0J007708.268ON2782817504e-99
SAKL0H16896g8.268ON2852447504e-99
TDEL0F039508.268ON2762457373e-97
Kwal_56.237758.268ON2812457356e-97
Suva_2.2758.268ON2852407289e-96
KLLA0F19272g8.268ON2662817242e-95
ZYRO0C01518g8.268ON2772437173e-94
Skud_4.3768.268ON2852727062e-92
NCAS0B038108.268ON3142396865e-89
Ecym_43028.268ON2752436782e-88
AGR080W8.268ON2752436513e-84
NDAI0J013308.268ON3142436536e-84
CAGL0B01815g8.268ON2902456151e-78
KNAG0H032108.268ON2852436082e-77
KAFR0B054808.268ON2802445741e-72
TBLA0I031908.268ON2412213999e-47
Suva_4.4288.583ON31250674.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_392.3
         (281 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519) ...   496   e-179
YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}  M...   297   e-100
KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} simil...   294   2e-99
Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}...   294   2e-99
TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {O...   293   4e-99
SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} simil...   293   4e-99
TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON...   288   3e-97
Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C...   287   6e-97
Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}...   285   9e-96
KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa] ...   283   2e-95
ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar...   280   3e-94
Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}...   276   2e-92
NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.26...   268   5e-89
Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to...   265   2e-88
AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic hom...   255   3e-84
NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.2...   256   6e-84
CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {O...   241   1e-78
KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.26...   238   2e-77
KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8....   225   1e-72
TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON...   158   9e-47
Suva_4.428 Chr4 (753224..754162) [939 bp, 312 aa] {ON} YBR176W (...    30   4.6  

>Kpol_392.3 s392 (3674..4519) [846 bp, 281 aa] {ON} (3674..4519)
           [846 nt, 282 aa]
          Length = 281

 Score =  496 bits (1277), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 246/281 (87%), Positives = 246/281 (87%)

Query: 1   MLSRSFGILSRRCEYHSGRXXXXXXXXXXXXXXXKPVSKSVKDKLKRRELRRHSKRKADA 60
           MLSRSFGILSRRCEYHSGR               KPVSKSVKDKLKRRELRRHSKRKADA
Sbjct: 1   MLSRSFGILSRRCEYHSGRVLLAEAVAASETASAKPVSKSVKDKLKRRELRRHSKRKADA 60

Query: 61  RKPASSYPLYMPISQALRYLRAAEVGQPISQQXXXXXXDVVSERGNLNLNGNISYNTPIK 120
           RKPASSYPLYMPISQALRYLRAAEVGQPISQQ      DVVSERGNLNLNGNISYNTPIK
Sbjct: 61  RKPASSYPLYMPISQALRYLRAAEVGQPISQQIITITTDVVSERGNLNLNGNISYNTPIK 120

Query: 121 DVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKSGKQPVDFDKAFATPDISPMLTSQ 180
           DVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKSGKQPVDFDKAFATPDISPMLTSQ
Sbjct: 121 DVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKSGKQPVDFDKAFATPDISPMLTSQ 180

Query: 181 LARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGNSISVSVGRCNFSDKQILEN 240
           LARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGNSISVSVGRCNFSDKQILEN
Sbjct: 181 LARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGNSISVSVGRCNFSDKQILEN 240

Query: 241 IIAVRSAYNTTXXXXXXXXXXXXXXTTITSTHGPGITIDFA 281
           IIAVRSAYNTT              TTITSTHGPGITIDFA
Sbjct: 241 IIAVRSAYNTTLSSQKSKKPSLLGKTTITSTHGPGITIDFA 281

>YDR116C Chr4 complement(682724..683581) [858 bp, 285 aa] {ON}
           MRPL1Mitochondrial ribosomal protein of the large
           subunit
          Length = 285

 Score =  297 bits (760), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 142/272 (52%), Positives = 194/272 (71%), Gaps = 2/272 (0%)

Query: 10  SRRCEYHSGRXXXXXXXXXXXXXXXKPVSKSVKDKLKRRELRRHSKRKADARKPASSYPL 69
           +RRC +H+ +                P     KD+ K+REL+R  +RKA+A++PA++ PL
Sbjct: 16  ARRCFFHTAKKLYADDYKPAAMSSNAP--SLTKDQAKKRELKRLVQRKAEAKRPATASPL 73

Query: 70  YMPISQALRYLRAAEVGQPISQQXXXXXXDVVSERGNLNLNGNISYNTPIKDVKIAVFSN 129
           YMP+++ALRYLRAAEVG+P SQQ       VV ERG   L+G++++  P++ +KIA F+N
Sbjct: 74  YMPVTKALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKIAAFTN 133

Query: 130 DPEKLAKIKEEHNCHLIGGTDLVEKIKSGKQPVDFDKAFATPDISPMLTSQLARVLGPRG 189
           D  KL +++E++  HLIGG DLV KIKSG+  VDFDKAFATPDI P L SQ+AR+LGPRG
Sbjct: 134 DESKLEELREKYPNHLIGGADLVAKIKSGEISVDFDKAFATPDIVPALQSQVARILGPRG 193

Query: 190 VLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGNSISVSVGRCNFSDKQILENIIAVRSAYN 249
           VLP++KKGTVS+D+SSL++ S+G MPFRQ GNSIS+ VG+C F+D++IL+NII+ R+A+ 
Sbjct: 194 VLPSVKKGTVSDDISSLLQESLGSMPFRQRGNSISIGVGKCYFTDREILQNIISARAAFK 253

Query: 250 TTXXXXXXXXXXXXXXTTITSTHGPGITIDFA 281
           T               TT++STHGPGI IDFA
Sbjct: 254 TAVDNQKSKKPNILSKTTLSSTHGPGIVIDFA 285

>KLTH0G13552g Chr7 (1163624..1164469) [846 bp, 281 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 281

 Score =  294 bits (752), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 136/244 (55%), Positives = 185/244 (75%)

Query: 38  SKSVKDKLKRRELRRHSKRKADARKPASSYPLYMPISQALRYLRAAEVGQPISQQXXXXX 97
           SK  KD+LK+RE+RR +++KA AR+PAS +PLYMP+ +ALR+LRAAEVGQP SQQ     
Sbjct: 38  SKLSKDQLKKREVRRFAQKKAAARRPASEHPLYMPVDKALRFLRAAEVGQPQSQQTLSVT 97

Query: 98  XDVVSERGNLNLNGNISYNTPIKDVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKS 157
             V+SERG   L+GN+S+   +K++KIAVF+ND ++    +E+ NCH++GG++LVEKIK 
Sbjct: 98  TIVISERGAPLLSGNVSFPNALKELKIAVFTNDEQQAQIAREKFNCHVVGGSELVEKIKQ 157

Query: 158 GKQPVDFDKAFATPDISPMLTSQLARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFR 217
           G+ P+DFDK+FATP+I+ +L SQL R+LGPRG+LP  KKGTVSE++ SLIK S+G +PFR
Sbjct: 158 GQVPLDFDKSFATPEIATLLASQLGRILGPRGLLPAAKKGTVSENLESLIKDSMGTLPFR 217

Query: 218 QTGNSISVSVGRCNFSDKQILENIIAVRSAYNTTXXXXXXXXXXXXXXTTITSTHGPGIT 277
           Q GN+IS++VGRC+F+DKQ+LENI+A + +                  TT+TST GPGI 
Sbjct: 218 QRGNNISIAVGRCSFTDKQLLENIVAAQKSVKEALANQKAKKPSLLGQTTLTSTRGPGIV 277

Query: 278 IDFA 281
           IDFA
Sbjct: 278 IDFA 281

>Smik_4.360 Chr4 complement(644029..644886) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  294 bits (752), Expect = 2e-99,   Method: Compositional matrix adjust.
 Identities = 140/272 (51%), Positives = 193/272 (70%), Gaps = 2/272 (0%)

Query: 10  SRRCEYHSGRXXXXXXXXXXXXXXXKPVSKSVKDKLKRRELRRHSKRKADARKPASSYPL 69
           +RRC  H+ +                P     KD+ K+REL+R ++RKA+A++PA++ PL
Sbjct: 16  TRRCLSHTAKKLYAEEYKPTAMSSNAP--SLTKDQAKKRELKRLAQRKAEAKRPAATNPL 73

Query: 70  YMPISQALRYLRAAEVGQPISQQXXXXXXDVVSERGNLNLNGNISYNTPIKDVKIAVFSN 129
           YMP++ ALRYLRAAEVG+P SQQ       VV ERG   L+G++++  P++ +K+A F+N
Sbjct: 74  YMPVTMALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVTFPKPLRYIKVAAFTN 133

Query: 130 DPEKLAKIKEEHNCHLIGGTDLVEKIKSGKQPVDFDKAFATPDISPMLTSQLARVLGPRG 189
           D  KL ++++++  HLIGG DLV +IKSG+ PVDFDKAFATPDI P L SQ+AR+LGPRG
Sbjct: 134 DENKLEELRKKYPNHLIGGADLVARIKSGEIPVDFDKAFATPDIVPTLQSQVARILGPRG 193

Query: 190 VLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGNSISVSVGRCNFSDKQILENIIAVRSAYN 249
           VLP++KKGTVS+D++SL++ S+G MPFRQ GNSIS+ VG+C FSD++IL+NII+ RSA+ 
Sbjct: 194 VLPSLKKGTVSDDINSLLEESLGSMPFRQRGNSISLGVGKCYFSDREILQNIISARSAFK 253

Query: 250 TTXXXXXXXXXXXXXXTTITSTHGPGITIDFA 281
                           TT++STHGPGI IDFA
Sbjct: 254 AAVNNQKSKKPNLLSKTTLSSTHGPGIVIDFA 285

>TPHA0J00770 Chr10 complement(179754..180590) [837 bp, 278 aa] {ON}
           Anc_8.268 YDR116C
          Length = 278

 Score =  293 bits (750), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 145/281 (51%), Positives = 199/281 (70%), Gaps = 3/281 (1%)

Query: 1   MLSRSFGILSRRCEYHSGRXXXXXXXXXXXXXXXKPVSKSVKDKLKRRELRRHSKRKADA 60
           ML  +F  ++R+  +H  R                 VSK  KD+LK+RELRR + RK +A
Sbjct: 1   MLKANFLQVTRKNAFHVSRIIREEITGAEGPIAQ--VSKLSKDQLKKRELRRFTIRKREA 58

Query: 61  RKPASSYPLYMPISQALRYLRAAEVGQPISQQXXXXXXDVVSERGNLNLNGNISYNTPIK 120
           + PA+S+PLYM + QALR+LRAAEVGQP+SQQ       VVSE+G+ NL G+I++ TP+K
Sbjct: 59  KMPATSHPLYMQVPQALRFLRAAEVGQPLSQQTINLTTLVVSEKGSPNLAGDIAFVTPLK 118

Query: 121 DVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKSGKQPVDFDKAFATPDISPMLTSQ 180
           +VKIA+F+ND  ++   KE+ NC+++GG++L+ KIK+G+  VDFDKAFATPDI   L S 
Sbjct: 119 EVKIAIFTNDETQMKIAKEKFNCYVVGGSELISKIKNGEIEVDFDKAFATPDIVQELGS- 177

Query: 181 LARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGNSISVSVGRCNFSDKQILEN 240
           +AR+LGPRGV P+IKKGTVSE+V  LIKG++G +PFRQ GN ISV++G+CNFSD+QILEN
Sbjct: 178 VARILGPRGVFPSIKKGTVSENVEDLIKGNLGSIPFRQLGNCISVAIGKCNFSDRQILEN 237

Query: 241 IIAVRSAYNTTXXXXXXXXXXXXXXTTITSTHGPGITIDFA 281
           +I+VR A+  +              T +++THGPGI IDF+
Sbjct: 238 LISVRKAFKDSVSTQKTKKPSILGKTILSTTHGPGIVIDFS 278

>SAKL0H16896g Chr8 (1486354..1487211) [858 bp, 285 aa] {ON} similar
           to uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 285

 Score =  293 bits (750), Expect = 4e-99,   Method: Compositional matrix adjust.
 Identities = 145/244 (59%), Positives = 187/244 (76%)

Query: 38  SKSVKDKLKRRELRRHSKRKADARKPASSYPLYMPISQALRYLRAAEVGQPISQQXXXXX 97
           +K  KD+LKRRELRR  +RKA ARKPA+ +PLYMP++QALR+LRAAEVGQP SQQ     
Sbjct: 42  TKLSKDQLKRRELRRLVQRKAAARKPAADHPLYMPVTQALRFLRAAEVGQPQSQQTISLT 101

Query: 98  XDVVSERGNLNLNGNISYNTPIKDVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKS 157
             V+SERG   LNGNIS+  P+KDVKIAVF+ND +KL   +++ NCHL+GG++L+EKIK 
Sbjct: 102 TLVISERGAPQLNGNISFPKPLKDVKIAVFTNDEDKLKIARDQFNCHLVGGSELIEKIKK 161

Query: 158 GKQPVDFDKAFATPDISPMLTSQLARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFR 217
           G+ P+DFDKAFATPDI+  LTSQL R+LGPRG+LP  KKGTV+ED+SSLIK S+G +PFR
Sbjct: 162 GEVPLDFDKAFATPDIAISLTSQLGRILGPRGLLPNAKKGTVTEDISSLIKDSMGTLPFR 221

Query: 218 QTGNSISVSVGRCNFSDKQILENIIAVRSAYNTTXXXXXXXXXXXXXXTTITSTHGPGIT 277
           Q GN IS++V +C+F+D Q+LENI+A + ++                 TT+T+THGPG+ 
Sbjct: 222 QRGNCISIAVAKCSFTDTQVLENILAAQKSFKLALANQKAKKPSILGQTTLTTTHGPGLV 281

Query: 278 IDFA 281
           IDFA
Sbjct: 282 IDFA 285

>TDEL0F03950 Chr6 complement(732544..733374) [831 bp, 276 aa] {ON}
           Anc_8.268 YDR116C
          Length = 276

 Score =  288 bits (737), Expect = 3e-97,   Method: Compositional matrix adjust.
 Identities = 145/245 (59%), Positives = 184/245 (75%)

Query: 37  VSKSVKDKLKRRELRRHSKRKADARKPASSYPLYMPISQALRYLRAAEVGQPISQQXXXX 96
           VSK  KD+LK+RE+RR ++RKA A+K  S +PLYM I  ALR+LRAAEVGQP +QQ    
Sbjct: 32  VSKLSKDQLKKREIRRLAQRKAAAKKSPSDHPLYMSIPMALRFLRAAEVGQPQTQQTITL 91

Query: 97  XXDVVSERGNLNLNGNISYNTPIKDVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIK 156
              VV+ERG   L G++S+  P+K+VKIAVFS D ++L   +E+ NCHL+GGT+++EKIK
Sbjct: 92  TTAVVAERGVPALAGSVSFPKPLKEVKIAVFSGDEDQLKVAREKFNCHLVGGTEIIEKIK 151

Query: 157 SGKQPVDFDKAFATPDISPMLTSQLARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPF 216
           SG+ PVDFDKAFATPDI+P LTSQLAR+LGPRGVLPT+KKGTV+ DVS L++ S+G MPF
Sbjct: 152 SGEIPVDFDKAFATPDIAPALTSQLARILGPRGVLPTVKKGTVATDVSRLVQDSMGSMPF 211

Query: 217 RQTGNSISVSVGRCNFSDKQILENIIAVRSAYNTTXXXXXXXXXXXXXXTTITSTHGPGI 276
           RQ GN+IS++VG+ +FSD+QILEN IA   A                  TT++STHGPGI
Sbjct: 212 RQRGNAISIAVGKSSFSDRQILENAIATHDAVKEALANQVSKKTSLLGKTTLSSTHGPGI 271

Query: 277 TIDFA 281
            IDFA
Sbjct: 272 VIDFA 276

>Kwal_56.23775 s56 (700146..700991) [846 bp, 281 aa] {ON} YDR116C -
           Hypothetical ORF [contig 173] FULL
          Length = 281

 Score =  287 bits (735), Expect = 6e-97,   Method: Compositional matrix adjust.
 Identities = 132/245 (53%), Positives = 181/245 (73%)

Query: 37  VSKSVKDKLKRRELRRHSKRKADARKPASSYPLYMPISQALRYLRAAEVGQPISQQXXXX 96
           VSK  KD+L++RE+R+ +++KA AR+PA+ +PLYMP+ +ALR+LRAAE GQP SQQ    
Sbjct: 37  VSKLSKDQLRKREIRKLAQKKAAARRPATDHPLYMPVDKALRFLRAAEAGQPHSQQTLSV 96

Query: 97  XXDVVSERGNLNLNGNISYNTPIKDVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIK 156
              V+SERG   L+GN+S+  P+KD+KIAVF+ND ++    +E+  CHL+GG+DLVEKIK
Sbjct: 97  TTIVISERGAPPLSGNLSFPKPLKDLKIAVFTNDEQQAQIAREKFGCHLVGGSDLVEKIK 156

Query: 157 SGKQPVDFDKAFATPDISPMLTSQLARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPF 216
            G   +DFDK+FATP+I+ +L SQL R+LGPRG+LP  KKGTV+E++  L+K S+G +PF
Sbjct: 157 EGAVSLDFDKSFATPEITTLLASQLGRILGPRGLLPAAKKGTVAENLEPLLKNSMGTLPF 216

Query: 217 RQTGNSISVSVGRCNFSDKQILENIIAVRSAYNTTXXXXXXXXXXXXXXTTITSTHGPGI 276
           RQ GN +SV+VG+C+F+DKQ+LENI+A +                    TT+TSTHGPGI
Sbjct: 217 RQRGNVVSVAVGKCSFTDKQLLENILAAQKGLKEALATQKTKKPSLLGQTTLTSTHGPGI 276

Query: 277 TIDFA 281
            IDFA
Sbjct: 277 VIDFA 281

>Suva_2.275 Chr2 complement(477386..478243) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  285 bits (728), Expect = 9e-96,   Method: Compositional matrix adjust.
 Identities = 128/240 (53%), Positives = 186/240 (77%)

Query: 42  KDKLKRRELRRHSKRKADARKPASSYPLYMPISQALRYLRAAEVGQPISQQXXXXXXDVV 101
           KD+ K+REL+R ++R+A+A++PA++ PL+MP++ ALRYLRAAEVG+P SQQ       VV
Sbjct: 46  KDQAKKRELKRLAQRRAEAKRPAATSPLHMPVTMALRYLRAAEVGRPQSQQTINLTTLVV 105

Query: 102 SERGNLNLNGNISYNTPIKDVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKSGKQP 161
            ERG   ++GN++++ P++ VK+AVF+ND  KL +++E++   ++GGTDLV KIK+ + P
Sbjct: 106 GERGTAPISGNVTFSKPLRYVKVAVFTNDEVKLKELREKYPNLIVGGTDLVAKIKNNESP 165

Query: 162 VDFDKAFATPDISPMLTSQLARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGN 221
           VDFDKAFATPDI P L SQ+AR+LGPRGVLP++KKGTVS+D++SL++ S+G MPFRQ GN
Sbjct: 166 VDFDKAFATPDIVPTLQSQVARILGPRGVLPSVKKGTVSDDITSLLQESLGSMPFRQRGN 225

Query: 222 SISVSVGRCNFSDKQILENIIAVRSAYNTTXXXXXXXXXXXXXXTTITSTHGPGITIDFA 281
           +IS+ +G+C F+D+++L+NII+ R+A+                 TT++STHGPGI IDFA
Sbjct: 226 AISLGIGKCYFTDRELLQNIISARTAFRAAVDNQKAKKPSLLSKTTLSSTHGPGIVIDFA 285

>KLLA0F19272g Chr6 complement(1783497..1784297) [801 bp, 266 aa]
           {ON} similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116C MRPL1 Mitochondrial ribosomal protein of the
           large subunit
          Length = 266

 Score =  283 bits (724), Expect = 2e-95,   Method: Compositional matrix adjust.
 Identities = 137/281 (48%), Positives = 189/281 (67%), Gaps = 19/281 (6%)

Query: 1   MLSRSFGILSRRCEYHSGRXXXXXXXXXXXXXXXKPVSKSVKDKLKRRELRRHSKRKADA 60
           + +R F I S R    +G                   +K  K++L++RELR+  +R+  A
Sbjct: 5   IFTRQFQITSFRLAEETG-------------------TKLTKEQLRKRELRKMVQRRLQA 45

Query: 61  RKPASSYPLYMPISQALRYLRAAEVGQPISQQXXXXXXDVVSERGNLNLNGNISYNTPIK 120
           + PAS +PLYMP+S+ALRYLRA EVGQP SQQ       VV+ERG   L GN+S+  P+K
Sbjct: 46  KTPASDHPLYMPVSRALRYLRAIEVGQPASQQTITLTTLVVAERGVPPLTGNVSFGKPLK 105

Query: 121 DVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKSGKQPVDFDKAFATPDISPMLTSQ 180
           DVK+AVF+ND  + A +K++++ HL+GG+DLV +IK+G+  +DFDKAFATPDI P L SQ
Sbjct: 106 DVKVAVFTNDEAQAALMKDKYSVHLVGGSDLVSQIKAGEVSIDFDKAFATPDIVPQLASQ 165

Query: 181 LARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGNSISVSVGRCNFSDKQILEN 240
           + R+LGPRG+LPT KKGTV+ED+  LIK S+  +PFRQ GNSIS+ V + +F+DK++LEN
Sbjct: 166 VGRILGPRGLLPTAKKGTVAEDLEPLIKDSMSSVPFRQRGNSISLGVAKTHFTDKEVLEN 225

Query: 241 IIAVRSAYNTTXXXXXXXXXXXXXXTTITSTHGPGITIDFA 281
           ++A + A+  +              TT+TSTHGPGI IDFA
Sbjct: 226 LLATQKAFKQSITNQQTKKPSILSQTTLTSTHGPGIVIDFA 266

>ZYRO0C01518g Chr3 (110061..110894) [834 bp, 277 aa] {ON} similar to
           uniprot|Q04599 Saccharomyces cerevisiae YDR116C MRPL1
           Mitochondrial ribosomal protein of the large subunit
          Length = 277

 Score =  280 bits (717), Expect = 3e-94,   Method: Compositional matrix adjust.
 Identities = 129/243 (53%), Positives = 178/243 (73%)

Query: 38  SKSVKDKLKRRELRRHSKRKADARKPASSYPLYMPISQALRYLRAAEVGQPISQQXXXXX 97
           SK  K++L++RE+RR ++RK +A+KPA ++PLYMP   ALRYLRA EVG P SQQ     
Sbjct: 34  SKLTKEQLRKREVRRAARRKVEAKKPAHTHPLYMPTPLALRYLRAVEVGYPASQQVITVT 93

Query: 98  XDVVSERGNLNLNGNISYNTPIKDVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKS 157
             VV++RGN  + GN+S  +P+KDV +AVFSND ++L+  +++  CHL+GG+D++ KIK 
Sbjct: 94  TSVVADRGNPPIAGNVSLPSPLKDVLVAVFSNDEQQLSMARDKFRCHLVGGSDIIAKIKQ 153

Query: 158 GKQPVDFDKAFATPDISPMLTSQLARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFR 217
           G+ PVDFDKAFATPDI+  LTSQ+AR+LGP+ VLP  K+GTV+ D+  LIK S G +PFR
Sbjct: 154 GEIPVDFDKAFATPDIAQELTSQVARILGPKQVLPMAKRGTVASDLEPLIKDSFGSIPFR 213

Query: 218 QTGNSISVSVGRCNFSDKQILENIIAVRSAYNTTXXXXXXXXXXXXXXTTITSTHGPGIT 277
           Q GNSIS++V +C FSD+Q+LEN++AV++A+                 TT+T+THGPGI 
Sbjct: 214 QKGNSISLAVAKCEFSDRQVLENLLAVQTAFKEAVSNQKAKRPSILGRTTLTTTHGPGIV 273

Query: 278 IDF 280
           ID 
Sbjct: 274 IDL 276

>Skud_4.376 Chr4 complement(654375..655232) [858 bp, 285 aa] {ON}
           YDR116C (REAL)
          Length = 285

 Score =  276 bits (706), Expect = 2e-92,   Method: Compositional matrix adjust.
 Identities = 134/272 (49%), Positives = 192/272 (70%), Gaps = 2/272 (0%)

Query: 10  SRRCEYHSGRXXXXXXXXXXXXXXXKPVSKSVKDKLKRRELRRHSKRKADARKPASSYPL 69
           +RRC  H+                  P     K++ K+REL+R ++R+A+A++PA++ PL
Sbjct: 16  TRRCLSHTASKLYAEEYKSTAMSSNAP--SLTKEQAKKRELKRLAQRRAEAKRPAATNPL 73

Query: 70  YMPISQALRYLRAAEVGQPISQQXXXXXXDVVSERGNLNLNGNISYNTPIKDVKIAVFSN 129
           YMP++ ALRYLRAAEVG+P SQQ       VV ERG   L+G++++  P++ +K+AVF+N
Sbjct: 74  YMPVTVALRYLRAAEVGRPQSQQTINLTTLVVGERGTAPLSGSVAFPKPLRYIKVAVFTN 133

Query: 130 DPEKLAKIKEEHNCHLIGGTDLVEKIKSGKQPVDFDKAFATPDISPMLTSQLARVLGPRG 189
           D  KL +++E++  HLIGG DLV +IK+G+ PVDFDKA+AT DI P L SQ+AR+LGPRG
Sbjct: 134 DENKLKELREKYPNHLIGGADLVSRIKNGEIPVDFDKAYATADIVPALQSQVARILGPRG 193

Query: 190 VLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGNSISVSVGRCNFSDKQILENIIAVRSAYN 249
           VLP++KKGTVS+D++SL++ S+G MPFRQ GNSIS+ +G+C F+D+++L+NIIA R+A+ 
Sbjct: 194 VLPSVKKGTVSDDITSLLQESLGSMPFRQRGNSISLGIGKCYFTDREVLQNIIAARAAFK 253

Query: 250 TTXXXXXXXXXXXXXXTTITSTHGPGITIDFA 281
                           TT++STHGPGI IDFA
Sbjct: 254 AAVSDQKSKKPNILSKTTLSSTHGPGIVIDFA 285

>NCAS0B03810 Chr2 (680870..681814) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  268 bits (686), Expect = 5e-89,   Method: Compositional matrix adjust.
 Identities = 126/239 (52%), Positives = 175/239 (73%)

Query: 42  KDKLKRRELRRHSKRKADARKPASSYPLYMPISQALRYLRAAEVGQPISQQXXXXXXDVV 101
           K++LK+RELRR S+RK +A++PAS +PLYMP+ +ALRY+RAAEVG+P  QQ       VV
Sbjct: 75  KEQLKKRELRRLSQRKTEAKRPASIHPLYMPVVEALRYIRAAEVGRPSGQQTITLTSLVV 134

Query: 102 SERGNLNLNGNISYNTPIKDVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKSGKQP 161
           +E+G   LNG+IS   P+K +K+AVFS + E L ++KE+++CHL+GG +L+ KIK+G+  
Sbjct: 135 NEKGVAPLNGHISLPRPLKALKVAVFSQNEELLTRMKEKYHCHLVGGVELINKIKNGEVK 194

Query: 162 VDFDKAFATPDISPMLTSQLARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGN 221
            DFDKAFA+ D++ +L++QL + LG RG+LP  KKGTVS+D+ SL+   IG +PFRQTGN
Sbjct: 195 TDFDKAFASSDMANILSAQLGKTLGRRGLLPNAKKGTVSDDLESLLADKIGSLPFRQTGN 254

Query: 222 SISVSVGRCNFSDKQILENIIAVRSAYNTTXXXXXXXXXXXXXXTTITSTHGPGITIDF 280
            IS+ +G+C+FSD++IL NIIA RSA                  TT++STHGPGI IDF
Sbjct: 255 CISIGIGKCHFSDEEILRNIIAARSAVMKALSEQKSKKPSILGKTTLSSTHGPGIVIDF 313

>Ecym_4302 Chr4 (646221..647048) [828 bp, 275 aa] {ON} similar to
           Ashbya gossypii AGR080W
          Length = 275

 Score =  265 bits (678), Expect = 2e-88,   Method: Compositional matrix adjust.
 Identities = 124/243 (51%), Positives = 175/243 (72%)

Query: 38  SKSVKDKLKRRELRRHSKRKADARKPASSYPLYMPISQALRYLRAAEVGQPISQQXXXXX 97
           +K  K+++K++ELR   +++A A+K    +PLYMP+ QA R+LRAAEVGQP SQQ     
Sbjct: 32  TKLSKEQMKKKELRALLQKRAAAKKSPFEHPLYMPVQQAFRFLRAAEVGQPPSQQTISLT 91

Query: 98  XDVVSERGNLNLNGNISYNTPIKDVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKS 157
             VVS++G   L+GNI +  P++DVK+AVF+N+ E+    +E+  CHL+GGT+L+E IK+
Sbjct: 92  TVVVSDKGAPLLSGNILFPNPLRDVKVAVFTNNKEQEEVAREQFKCHLVGGTELIEAIKN 151

Query: 158 GKQPVDFDKAFATPDISPMLTSQLARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFR 217
           G  P+DFDKA ATPD+   LTSQLA VLGPR +LP +KKGTVSE++++LI+ ++  +PFR
Sbjct: 152 GDTPIDFDKALATPDVVAQLTSQLASVLGPRRLLPAVKKGTVSENIANLIRENMFTVPFR 211

Query: 218 QTGNSISVSVGRCNFSDKQILENIIAVRSAYNTTXXXXXXXXXXXXXXTTITSTHGPGIT 277
           Q G  +SV+VG+C+FSDKQ+L+NI+AV+ A+                 TT+TSTHGPGI 
Sbjct: 212 QRGPFLSVAVGKCDFSDKQLLQNIVAVQKAFKQALADQQGKKSSILGKTTVTSTHGPGIV 271

Query: 278 IDF 280
           IDF
Sbjct: 272 IDF 274

>AGR080W Chr7 (881213..882040) [828 bp, 275 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR116C (MRPL1)
          Length = 275

 Score =  255 bits (651), Expect = 3e-84,   Method: Compositional matrix adjust.
 Identities = 124/243 (51%), Positives = 181/243 (74%)

Query: 38  SKSVKDKLKRRELRRHSKRKADARKPASSYPLYMPISQALRYLRAAEVGQPISQQXXXXX 97
           SK  KD+LK+RELRR ++RKA AR+PAS+ PLYMP+ QALR+LRAAEVGQP +QQ     
Sbjct: 31  SKLSKDQLKKRELRRLAQRKAAARRPASASPLYMPVQQALRFLRAAEVGQPATQQTISVN 90

Query: 98  XDVVSERGNLNLNGNISYNTPIKDVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKS 157
             V+ ++G   L+G ++  +P+++ K+AVF+NDPE+    + ++ C+L+GG +LVE++KS
Sbjct: 91  TMVIGDKGAALLSGTVTLPSPMRETKVAVFTNDPEQAETARTKYGCYLVGGAELVEQLKS 150

Query: 158 GKQPVDFDKAFATPDISPMLTSQLARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFR 217
           G+  VDFDKAFATPDI+P++ ++L RVLGP+G+LP++KKGTV+ D+S L+   I   PF+
Sbjct: 151 GEVKVDFDKAFATPDIAPLMAAKLGRVLGPKGLLPSVKKGTVAGDLSELLGDDINSTPFK 210

Query: 218 QTGNSISVSVGRCNFSDKQILENIIAVRSAYNTTXXXXXXXXXXXXXXTTITSTHGPGIT 277
           Q  N IS+++G+C+FSD+QI+EN++AV++A+                 TT+TSTHGPGI 
Sbjct: 211 QRNNCISLAIGKCHFSDRQIMENLLAVQAAFRAAMTSQKTKKTSLFGTTTLTSTHGPGIV 270

Query: 278 IDF 280
           IDF
Sbjct: 271 IDF 273

>NDAI0J01330 Chr10 (309586..310530) [945 bp, 314 aa] {ON} Anc_8.268
           YDR116C
          Length = 314

 Score =  256 bits (653), Expect = 6e-84,   Method: Compositional matrix adjust.
 Identities = 123/243 (50%), Positives = 166/243 (68%)

Query: 38  SKSVKDKLKRRELRRHSKRKADARKPASSYPLYMPISQALRYLRAAEVGQPISQQXXXXX 97
           +K  K++LK+RE+RR S+RK  AR+PA+S+PLYM +  ALR++RAAEVG+P  QQ     
Sbjct: 71  TKLSKEQLKKREIRRLSQRKQQARQPANSHPLYMEVVDALRFIRAAEVGRPEGQQTITLT 130

Query: 98  XDVVSERGNLNLNGNISYNTPIKDVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKS 157
             +VSE+G   LNGN+    P+K++KIAVFS D E L ++K + NC L+GG + VE IK 
Sbjct: 131 TLIVSEKGTSLLNGNMKLFRPLKELKIAVFSTDKELLEEVKSQFNCQLVGGNETVEGIKD 190

Query: 158 GKQPVDFDKAFATPDISPMLTSQLARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFR 217
           G    +FD AFATP+I P + SQL + LG RG+LP  KKGTVS+D+ +L+   +G +PF+
Sbjct: 191 GTIRANFDVAFATPEIVPFINSQLGKQLGRRGILPNTKKGTVSDDLVTLMNAKMGNIPFK 250

Query: 218 QTGNSISVSVGRCNFSDKQILENIIAVRSAYNTTXXXXXXXXXXXXXXTTITSTHGPGIT 277
           QTGN+IS+ +G+C FSDK IL NIIA R A+                 TT++STHGPGI 
Sbjct: 251 QTGNNISIPIGKCYFSDKDILLNIIAARDAFKEALANQKAKRPSILSKTTLSSTHGPGIV 310

Query: 278 IDF 280
           IDF
Sbjct: 311 IDF 313

>CAGL0B01815g Chr2 complement(165648..166520) [873 bp, 290 aa] {ON}
           similar to uniprot|Q04599 Saccharomyces cerevisiae
           YDR116c
          Length = 290

 Score =  241 bits (615), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 123/245 (50%), Positives = 172/245 (70%), Gaps = 6/245 (2%)

Query: 42  KDKLKRRELRRHSKRKADARKPASSYPLYMPISQALRYLRAAEVGQPISQQXXXXXXDVV 101
           K++ K+RE++R + +KA+A+KPA+ +PLYMPI  ALRYLR+AEVG+P   Q       VV
Sbjct: 45  KEQAKKREMKRLALKKAEAKKPANIHPLYMPIPLALRYLRSAEVGRPTQHQTITVTTLVV 104

Query: 102 SERGNLNLNGNISYNTPIKDVKIAVFSNDPEKLAKIKEEHN--CHLIGGTDLVEKIKSGK 159
           +++GN  L GNI +  P+K +KIA+FS++ EKL ++K +++    + GG D++  IKSGK
Sbjct: 105 ADKGNAALAGNILFPHPLKQMKIAIFSSNKEKLDELKSKYSKQVKIAGGEDMIADIKSGK 164

Query: 160 QPVD-FDKAFATPDISPMLTSQLARVLGPRGVLPTIKK---GTVSEDVSSLIKGSIGLMP 215
             VD  +K FATP+I P + SQL RVLGP+G++P +KK    TV ED+ SLI+ ++G + 
Sbjct: 165 IKVDGVNKVFATPEIFPTIASQLGRVLGPKGLMPNLKKQHQNTVGEDLDSLIEENLGQVS 224

Query: 216 FRQTGNSISVSVGRCNFSDKQILENIIAVRSAYNTTXXXXXXXXXXXXXXTTITSTHGPG 275
           FRQ GNS+SVSVGRCNFSD+ ILENIIAVR+A+  +              TTI++T GPG
Sbjct: 225 FRQRGNSLSVSVGRCNFSDRDILENIIAVRNAFKQSVSSQVAKKPSILGKTTISTTAGPG 284

Query: 276 ITIDF 280
           I IDF
Sbjct: 285 IVIDF 289

>KNAG0H03210 Chr8 (601470..602327) [858 bp, 285 aa] {ON} Anc_8.268
           YDR116C
          Length = 285

 Score =  238 bits (608), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 112/243 (46%), Positives = 163/243 (67%)

Query: 39  KSVKDKLKRRELRRHSKRKADARKPASSYPLYMPISQALRYLRAAEVGQPISQQXXXXXX 98
           K  K++L+RRELR+  + K  A++PAS   +Y+ + +A+R LRA EVGQP SQQ      
Sbjct: 43  KLTKEQLRRRELRKMIRSKMLAKRPASQDKVYLSVPEAMRILRAVEVGQPTSQQTITLTT 102

Query: 99  DVVSERGNLNLNGNISYNTPIKDVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKSG 158
            VVSE+G   L+G++   TP+K V+IA FS DPE L +++EE    ++GG +L++++KSG
Sbjct: 103 MVVSEKGVPPLHGDVVLPTPLKPVRIAAFSADPELLKRLQEEVELEIVGGAELIDQLKSG 162

Query: 159 KQPVDFDKAFATPDISPMLTSQLARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFRQ 218
           + PV FDKAFATPDI+P L S+L  +LG RG+LP IKKGTV  D+ ++I+  +G MPFRQ
Sbjct: 163 EVPVQFDKAFATPDIAPQLNSKLGALLGRRGLLPNIKKGTVGPDLLAMIRSKVGAMPFRQ 222

Query: 219 TGNSISVSVGRCNFSDKQILENIIAVRSAYNTTXXXXXXXXXXXXXXTTITSTHGPGITI 278
              +++  + +C+FSD+Q+L N+IA R A+                 +T++STHGPGI I
Sbjct: 223 RAANLAFGIAKCHFSDRQVLGNLIAAREAFQLAIQNQKSKKRSILGRSTLSSTHGPGIVI 282

Query: 279 DFA 281
           D A
Sbjct: 283 DLA 285

>KAFR0B05480 Chr2 (1122727..1123569) [843 bp, 280 aa] {ON} Anc_8.268
           YDR116C
          Length = 280

 Score =  225 bits (574), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 112/244 (45%), Positives = 157/244 (64%), Gaps = 1/244 (0%)

Query: 38  SKSVKDKLKRRELRRHSKRKADARKPASSYPLYMPISQALRYLRAAEVGQPISQQXXXXX 97
           SK+ K + K++ LR   + +  AR+PAS++PLYM +  ALR+LRA EVGQP SQQ     
Sbjct: 36  SKTNKQQAKKKMLRDFLRSRKQAREPASNHPLYMKVPDALRFLRAVEVGQPRSQQTITLT 95

Query: 98  XDVVSERGNLNLNGNISYNTPIKDVKIAVFSNDPEKLAKIKEEH-NCHLIGGTDLVEKIK 156
             V+SE+G   + GN+   TP+++ K+ V S+DP+KL ++++   N HL+GG +LV+K K
Sbjct: 96  TLVISEKGVPPVYGNVQLPTPLRNSKVVVLSDDPKKLEEVQDNFKNVHLVGGRELVDKFK 155

Query: 157 SGKQPVDFDKAFATPDISPMLTSQLARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPF 216
           +    +DFDK  ATPDI       L ++ GP+G+LP +KKGTVSE++  L+  ++  MPF
Sbjct: 156 NEDIEIDFDKVVATPDILNYTNQNLGKMFGPKGLLPNVKKGTVSENLIELMNENVSSMPF 215

Query: 217 RQTGNSISVSVGRCNFSDKQILENIIAVRSAYNTTXXXXXXXXXXXXXXTTITSTHGPGI 276
           RQ    IS+ +G+  FSDKQILENIIA R A+  T              TT+TSTHGPGI
Sbjct: 216 RQRAGCISLGIGKVEFSDKQILENIIATREAFLNTLSNQKTKKQSTLGKTTLTSTHGPGI 275

Query: 277 TIDF 280
            IDF
Sbjct: 276 VIDF 279

>TBLA0I03190 Chr9 complement(768942..769667) [726 bp, 241 aa] {ON}
           Anc_8.268 YDR116C
          Length = 241

 Score =  158 bits (399), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 86/221 (38%), Positives = 131/221 (59%), Gaps = 2/221 (0%)

Query: 60  ARKPASSYPLYMPISQALRYLRAAEVGQPISQQXXXXXXDVVSERGNLNLNGNISYNTPI 119
           AR  + ++PL M +  ALRYLRA E G+  S+Q       V + RGN  L G I+++  I
Sbjct: 22  ARILSKNHPLKMEVPLALRYLRAIESGRKSSEQTVTLQTVVAAARGNTPLRGEINFHMLI 81

Query: 120 KDVKIAVFSNDPEKLAKIKEEHNCHLIGGTDLVEKIKSGKQPVDFDKAFATPDISPMLTS 179
           +   IAVF+ DPE+  KI +E    +IGG++L++KI SG+Q + F  AFAT D+   L +
Sbjct: 82  RKPVIAVFTEDPEQ-HKIAKEMGIDIIGGSELIDKIASGEQKITFQTAFATTDMVQDL-A 139

Query: 180 QLARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGNSISVSVGRCNFSDKQILE 239
           ++A+ LG + VLP +KK TV +++  L++  + ++PF +  + IS  VG+C+F+D++IL 
Sbjct: 140 RVAQKLGKQKVLPQLKKKTVGDNIRELLQDKLYVVPFAEKASFISFPVGKCSFTDEEILR 199

Query: 240 NIIAVRSAYNTTXXXXXXXXXXXXXXTTITSTHGPGITIDF 280
           N+I  R                     T+TSTHGPGI ID 
Sbjct: 200 NLIKAREGLQKALREQNNKKPSTIIKATLTSTHGPGIDIDL 240

>Suva_4.428 Chr4 (753224..754162) [939 bp, 312 aa] {ON} YBR176W
           (REAL)
          Length = 312

 Score = 30.4 bits (67), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 17/50 (34%), Positives = 24/50 (48%)

Query: 179 SQLARVLGPRGVLPTIKKGTVSEDVSSLIKGSIGLMPFRQTGNSISVSVG 228
           S + R  GP  V+  +  GT   D+S  +K +I +M       SI V VG
Sbjct: 92  SSVCRAEGPSLVVADMPFGTFESDISDGLKNAIDIMKLHSKVTSIKVEVG 141

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.133    0.373 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,377,598
Number of extensions: 936230
Number of successful extensions: 2679
Number of sequences better than 10.0: 27
Number of HSP's gapped: 2733
Number of HSP's successfully gapped: 27
Length of query: 281
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 173
Effective length of database: 41,097,471
Effective search space: 7109862483
Effective search space used: 7109862483
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 65 (29.6 bits)