Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_392.28.269ON56656627100.0
TDEL0F039608.269ON55855916320.0
TPHA0J007808.269ON58357116320.0
Skud_4.3778.269ON56256816170.0
Suva_2.2768.269ON56556416170.0
YDR117C (TMA64)8.269ON56556115940.0
Smik_4.3618.269ON56556315160.0
ZYRO0C01496g8.269ON56756114850.0
NCAS0B038008.269ON56556014670.0
SAKL0H16874g8.269ON56355913930.0
Kwal_56.237718.269ON56256113610.0
KLTH0G13530g8.269ON57456613610.0
NDAI0J013108.269ON57957713570.0
KAFR0B054708.269ON56256413301e-178
CAGL0B01837g8.269ON56956413161e-176
TBLA0I032008.269ON56356812591e-167
KNAG0H032008.269ON56157311461e-150
Ecym_43018.269ON56456911191e-146
KLLA0F19294g8.269ON57056410931e-142
AGR079W8.269ON54256310091e-130
NCAS0A091701.324ON62895741.9
YGL233W (SEC15)3.554ON91064752.0
Ecym_54565.505ON31283714.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_392.2
         (566 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)...  1048   0.0  
TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {O...   633   0.0  
TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {...   633   0.0  
Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON...   627   0.0  
Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON...   627   0.0  
YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}  ...   618   0.0  
Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON...   588   0.0  
ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} simila...   576   0.0  
NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.2...   569   0.0  
SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} simi...   541   0.0  
Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117...   528   0.0  
KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} simi...   528   0.0  
NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8....   527   0.0  
KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON} Anc_8...   516   e-178
CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {...   511   e-176
TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {O...   489   e-167
KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.2...   446   e-150
Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar t...   435   e-146
KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]...   425   e-142
AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic ho...   393   e-130
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    33   1.9  
YGL233W Chr7 (59122..61854) [2733 bp, 910 aa] {ON}  SEC15Essenti...    33   2.0  
Ecym_5456 Chr5 complement(936012..936950) [939 bp, 312 aa] {ON} ...    32   4.4  

>Kpol_392.2 s392 (1564..3264) [1701 bp, 566 aa] {ON} (1564..3264)
           [1701 nt, 567 aa]
          Length = 566

 Score = 1048 bits (2710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/566 (94%), Positives = 534/566 (94%)

Query: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60
           MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE
Sbjct: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60

Query: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120
           EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS
Sbjct: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120

Query: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180
           RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK
Sbjct: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180

Query: 181 RDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSNDVSELAQEESALTVEDI 240
           RDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSNDVSELAQEESALTVEDI
Sbjct: 181 RDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSNDVSELAQEESALTVEDI 240

Query: 241 DHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKFLKH 300
           DHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKFLKH
Sbjct: 241 DHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKFLKH 300

Query: 301 FEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRXXXXXXXXXXXXXXXRQESENMMYS 360
           FEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYR               RQESENMMYS
Sbjct: 301 FEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRISNSSSNSGKKINSNRQESENMMYS 360

Query: 361 LVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDRLYD 420
           LVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDRLYD
Sbjct: 361 LVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDRLYD 420

Query: 421 MCYTKKSTNPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRIKIVTEM 480
           MCYTKKSTNPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRIKIVTEM
Sbjct: 421 MCYTKKSTNPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRIKIVTEM 480

Query: 481 KIGRKIVTRVSNFESFGIDADALAGDLRRLCXXXXXXXXXXXXXXXXXVQVQGPHSKIII 540
           KIGRKIVTRVSNFESFGIDADALAGDLRRLC                 VQVQGPHSKIII
Sbjct: 481 KIGRKIVTRVSNFESFGIDADALAGDLRRLCSGSTTIGETTTSPKTTEVQVQGPHSKIII 540

Query: 541 DHLNSLSIPTKWIDFENKLKPKKIRN 566
           DHLNSLSIPTKWIDFENKLKPKKIRN
Sbjct: 541 DHLNSLSIPTKWIDFENKLKPKKIRN 566

>TDEL0F03960 Chr6 complement(733512..735188) [1677 bp, 558 aa] {ON}
           Anc_8.269 YDR117C
          Length = 558

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 315/559 (56%), Positives = 397/559 (71%), Gaps = 13/559 (2%)

Query: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60
           MFKK PHIK+LSNLKNSERKKLLQSCK QTG++DYNF TS++KQTN+  Q S G +YTD+
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQSCKEQTGASDYNFSTSIVKQTNYKGQHSDGTVYTDQ 60

Query: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120
              P+WFKEKH ELLFPTVY+CW  P LLPIVLTHD VI E +FNGANLM++GTLPPFD 
Sbjct: 61  NNVPIWFKEKHGELLFPTVYSCWTAPNLLPIVLTHDFVIEERLFNGANLMLAGTLPPFDE 120

Query: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180
           R VPA +CGIA+R +P  I+A+GVVQL++PSYSSVIG+ G+AV V+HY+ DG+  AFK+ 
Sbjct: 121 RCVPAKVCGIASRTDPKVILAIGVVQLNLPSYSSVIGQPGIAVKVMHYFTDGLCQAFKI- 179

Query: 181 RDI-PTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSNDVSELAQEESALTVED 239
            DI P ++  +    +  E  +  +  + + +T      EIS  DV+++  E   L+VED
Sbjct: 180 -DIEPAVLSSEPVEEEEEEEGKEKLTESPKRETFHT---EISIEDVAQVLDE---LSVED 232

Query: 240 IDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKFLK 299
           +DHF TR+LYYT T+D  L  PI +S+FISNHI+ NLPPVD + VN+KKTSWKK++KFLK
Sbjct: 233 VDHFFTRALYYTFTHDTGLNIPINASNFISNHILPNLPPVDQSQVNMKKTSWKKTAKFLK 292

Query: 300 HFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRXXXXXXXXXXXXXXXRQESENMMY 359
           HFEK GF++LKGKG+DL IVG NK K+ELK F PY+               +  S  MMY
Sbjct: 293 HFEKVGFLQLKGKGDDLVIVGVNKNKDELKNFVPYK---TSGQTASKKNSNKDSSPGMMY 349

Query: 360 SLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDRLY 419
           S   Y P    K F+  ++LP KN YT  ELK++V +YI  K+LVD KN KM  LDD L+
Sbjct: 350 SEKLYKPINLGKDFIQCSDLPPKNLYTVTELKDSVNQYITAKKLVDSKNKKMVLLDDLLF 409

Query: 420 DMCYTKKSTNP-PRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRIKIVT 478
           DM Y KK T   PR ++RA +++ F  NNFTE YQLFK++DTPL KNP+RG  PR+KIVT
Sbjct: 410 DMFYRKKKTQETPRCVSRAQIMDPFIANNFTEFYQLFKDEDTPLFKNPIRGPLPRVKIVT 469

Query: 479 EMKIGRKIVTRVSNFESFGIDADALAGDLRRLCXXXXXXXXXXXXXXXXXVQVQGPHSKI 538
           EMKIGRK+VTRVS+FE+F +D + LA +LR+LC                 VQVQG H  +
Sbjct: 470 EMKIGRKVVTRVSHFETFKLDPEDLAANLRKLCSGSTTIGETVTSPKVAEVQVQGAHGPL 529

Query: 539 IIDHLNSLSIPTKWIDFEN 557
           IID+LN   IPTKWIDFE+
Sbjct: 530 IIDYLNKQGIPTKWIDFES 548

>TPHA0J00780 Chr10 complement(180939..182690) [1752 bp, 583 aa] {ON}
           Anc_8.269 YDR117C
          Length = 583

 Score =  633 bits (1632), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/571 (54%), Positives = 402/571 (70%), Gaps = 7/571 (1%)

Query: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60
           MFKKTP++K+ SNLKNSERKKLLQSCK Q  S+DYNFP+S+IKQ N+  QTS G +YTDE
Sbjct: 1   MFKKTPNVKASSNLKNSERKKLLQSCKEQRNSSDYNFPSSIIKQANYKGQTSAGTVYTDE 60

Query: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120
           +  P+WFKEKHS++LFP+VYTCW++P LLPI++T+  VI E I NGANLMISGTL PFD 
Sbjct: 61  QNVPIWFKEKHSDMLFPSVYTCWKNPKLLPIIVTNSYVIEEKILNGANLMISGTLLPFDE 120

Query: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180
           RL+   +CGIA+   PN ++A+G+VQLD+ SY+ V+G+TGVAVNVLHY GDG+S +FKM 
Sbjct: 121 RLICGALCGIASYKKPNVVMAIGIVQLDLQSYTKVVGETGVAVNVLHYLGDGLSDSFKMN 180

Query: 181 RDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSNDVSELAQEESALTVEDI 240
            + P      D++ +   N     +  E   +  D  P+   ND  +LA+    L V+ I
Sbjct: 181 LEPPETGAEVDETNEMLLNQDKQDVNNELTNSNKDLAPDARPND--DLAEVLETLPVDII 238

Query: 241 DHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKFLKH 300
           D FIT+SLYY+LTND KL FPI +S+FISN+IM NLPPVD+++VN+KK+SWKK++KFL+H
Sbjct: 239 DDFITKSLYYSLTNDPKLEFPISASNFISNYIMSNLPPVDNDMVNLKKSSWKKTAKFLRH 298

Query: 301 FEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRX-XXXXXXXXXXXXXXRQESENMMY 359
           FEKEGFIKLKGK +DL I G NKEK ELK F PYR                  ++ +MM 
Sbjct: 299 FEKEGFIKLKGKNDDLVITGFNKEKTELKSFVPYRTGNGNSTKSKKDKTNDTSDNGDMMQ 358

Query: 360 SLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDRLY 419
           S+ +Y P    K  +  +  P K+ YTA EL++ +TEYI KK LVD KN KM  +DD +Y
Sbjct: 359 SVSYYKPISLGKDLIRESVAPEKSLYTAHELRDFITEYINKKNLVDSKNKKMILMDDLMY 418

Query: 420 DMCYTKKSTNPPRHITRAAVIESFTTNNFTELYQLFKNDD----TPLTKNPVRGSPPRIK 475
            + Y KK++  PR I+RA VIE  T NNF E +Q++K  D     PL K P+RGS P+++
Sbjct: 419 SLVYKKKNSAEPRLISRADVIEPITKNNFNEHFQIYKKGDNETAVPLFKKPIRGSIPKVE 478

Query: 476 IVTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCXXXXXXXXXXXXXXXXXVQVQGPH 535
           IVTEMKIGRK++TRVSNFE F IDA+ LA DLR+LC                 VQVQGPH
Sbjct: 479 IVTEMKIGRKVITRVSNFEVFHIDAETLAADLRKLCNGATTIGETLTSPKTAEVQVQGPH 538

Query: 536 SKIIIDHLNSLSIPTKWIDFENKLKPKKIRN 566
           S++II HLNSLSIPTKWIDF+N +KPK+ +N
Sbjct: 539 SQVIIKHLNSLSIPTKWIDFKNSVKPKRKKN 569

>Skud_4.377 Chr4 complement(655577..657265) [1689 bp, 562 aa] {ON}
           YDR117C (REAL)
          Length = 562

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/568 (53%), Positives = 401/568 (70%), Gaps = 13/568 (2%)

Query: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60
           MFKK PHIK+LSNLKNSERKKLLQ+CK QT + +Y FPTS IKQTNF +Q SVGV+YTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNDEYTFPTSTIKQTNFCSQKSVGVVYTDE 60

Query: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120
             +P+ FKEKH+E LFPTVY+CWE+PTLLPI+LTH  VI EH+FNGANLMISG++PPFD 
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENPTLLPIILTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180
           R    T+CG+A+R  P  ++A+G+V++D+PSY  V+G+TGVAV V+H++ DG+S A K+K
Sbjct: 121 RSKVGTLCGVASREAPKVVLAIGIVEMDLPSYDRVLGETGVAVKVIHHFNDGLSKALKVK 180

Query: 181 RDIPTIVGGKDKSVDATE---NDQSPVIITEEEKTEDDSIPEISSNDVSELAQEESALTV 237
            D P I    D+ +++ +    +++ ++   +E  +   +       V ELA+     +V
Sbjct: 181 LD-PPIAKSGDEDINSKQVQPPEEAKIVENAQENMQKAQV------HVEELAEVLDHFSV 233

Query: 238 EDIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKF 297
            D+D+FITR+LYYTLT D  L  PI  S+FISNHIMRNLPP+DHN VN+KKTSW+KS+KF
Sbjct: 234 SDVDYFITRALYYTLTQDKSLVLPISPSNFISNHIMRNLPPIDHNEVNVKKTSWRKSAKF 293

Query: 298 LKHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRXXXXXXXXXXXXXXXRQE-SEN 356
           LKHFEKEGF+KLKGKG+DLTIVG   +K+ELK F PY+                +E +  
Sbjct: 294 LKHFEKEGFLKLKGKGDDLTIVGKTIDKDELKNFVPYKVGSSTSAQESGEHANSKEKTPG 353

Query: 357 MMYSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDD 416
           MMYS+  Y P   AK F+    L ++ +YT+ ++++A+++YI    L D K+     +DD
Sbjct: 354 MMYSMTLYKPFSIAKDFLKEANLGFRTYYTSQDIRSALSQYISTNNLADTKDKGKVVMDD 413

Query: 417 RLYDMC-YTKKSTNPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRIK 475
            L++M    KK+ N  R + RA +++    NNFTE YQ+FKNDD+ L K P++GSPPRIK
Sbjct: 414 LLFNMVNKKKKNLNAARIMPRAQILDPLLANNFTEFYQIFKNDDSLLFKAPIKGSPPRIK 473

Query: 476 IVTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCXXXXXXXXXXXXXXXXXVQVQGPH 535
           I TEMKIGRK++TRVSNFE F ID ++LAGDLR++C                 VQVQGPH
Sbjct: 474 ITTEMKIGRKVITRVSNFEVFQIDPESLAGDLRKIC-SGSTTIGESQTFKSAEVQVQGPH 532

Query: 536 SKIIIDHLNSLSIPTKWIDFENKLKPKK 563
            ++IIDHLN+L +P KWIDFENKLK KK
Sbjct: 533 GQLIIDHLNNLGVPNKWIDFENKLKKKK 560

>Suva_2.276 Chr2 complement(478604..480301) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  627 bits (1617), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/564 (54%), Positives = 403/564 (71%), Gaps = 14/564 (2%)

Query: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60
           MFKK PHIK+LSNLKNSERKKLLQ+CK QT + +Y FPTS IKQTNF+ Q S+G +YTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCKKQTNNEEYTFPTSTIKQTNFSGQKSLGTVYTDE 60

Query: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120
             +P+ FKEKH+E LFPTVY+CWE+ TLLPIVLTH  VI EH+FNGANLMISG++PPFD 
Sbjct: 61  NNTPILFKEKHNEQLFPTVYSCWENHTLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180
           R    T+CG+A+R  P  ++AVG+V++D+PSYS VIG+TGVAV ++H++ DG+S AFK+K
Sbjct: 121 RCKIGTLCGVASRQAPKIVLAVGIVEMDLPSYSRVIGETGVAVKIVHHFNDGLSKAFKVK 180

Query: 181 RDIPTI--VGGKDKSVDATENDQSPVIITEEEKTED---DSIPEISSNDVSELAQEESAL 235
            + P    V  +D+ +D T+     + I E  KT +   +++ E + N + E+A+    L
Sbjct: 181 LEPPAAFDVASEDEDIDNTQ-----IEIQEGTKTTEKTRENVQEANIN-IEEIAEVLDHL 234

Query: 236 TVEDIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSS 295
           +V D+D+FITR+LYYTLT D  LA PI +S+FISNHIMRNLPP+DHN VN+K+TSWKKS+
Sbjct: 235 SVSDVDYFITRALYYTLTQDKSLALPISASNFISNHIMRNLPPIDHNEVNVKRTSWKKSA 294

Query: 296 KFLKHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRXXXXXXXXXXXXXXXRQE-S 354
           KFLKHFEKEGF+KLKGKG+DLTIVG N +K+ELK F PY+                +E +
Sbjct: 295 KFLKHFEKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGVNNSAKEKGENTNSKEKT 354

Query: 355 ENMMYSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANL 414
             MMYSL  Y P   AK  +    LP++ +YT+ ++++A+T+YI  K LVD K+     +
Sbjct: 355 SGMMYSLTLYKPFNLAKDLVKEANLPFQTYYTSQDIRSAITQYISIKNLVDAKDKGKVVM 414

Query: 415 DDRLYDMCYTKKST-NPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPR 473
           DD LY+M   KK   +  R I RA +++    NNFTE YQ++KNDDT L++ P++GSPPR
Sbjct: 415 DDLLYNMVNKKKKDPDVARVIPRAQILDPLLANNFTEFYQIYKNDDTLLSRTPMKGSPPR 474

Query: 474 IKIVTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCXXXXXXXXXXXXXXXXXVQVQG 533
           IKI+TEMKIGRK++T+VSNFE+  ID + LA DLR++C                 VQVQG
Sbjct: 475 IKIITEMKIGRKVITKVSNFEALQIDPELLAADLRKIC-SGSTTIGESQTFKSAEVQVQG 533

Query: 534 PHSKIIIDHLNSLSIPTKWIDFEN 557
           PH ++IIDHLN   +P KWIDFEN
Sbjct: 534 PHGQLIIDHLNKSGVPNKWIDFEN 557

>YDR117C Chr4 complement(683946..685643) [1698 bp, 565 aa] {ON}
           TMA64Protein of unknown function that associates with
           ribosomes; has a putative RNA binding domain; in mammals
           the corresponding protein, eIF2D, has been shown to
           possess translation initiation factor activity
          Length = 565

 Score =  618 bits (1594), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/561 (54%), Positives = 392/561 (69%), Gaps = 8/561 (1%)

Query: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60
           MFKK PHIK+LSNLKNSERKKLLQ+ + QT + +Y+F TS IKQTNFN Q SVG +YTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTFQKQTNNEEYSFRTSTIKQTNFNGQKSVGTVYTDE 60

Query: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120
             +P+ FKEKH E LFPTVY+CWE P LLPIVLTH  VI EH+FNGANLMISG++PPFD 
Sbjct: 61  NNTPILFKEKHKEQLFPTVYSCWEYPALLPIVLTHGFVIEEHLFNGANLMISGSIPPFDP 120

Query: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180
           R    T+CGIA++  P T++A+G+V+LD+PS+  VIG+TGVAV ++H++ DG+S  FKMK
Sbjct: 121 RCKIGTLCGIASKQAPETVLAIGIVELDLPSFDKVIGETGVAVKIIHHFNDGLSKVFKMK 180

Query: 181 RDIPTIVG--GKDKSVDATENDQSPVIITEEEKTEDDSIPEISSNDVSELAQEESALTVE 238
            + P ++    KD ++ + + + S  I   E++ ED  + E +S DV E+A+     TV 
Sbjct: 181 LEPPFVLSTQSKDNNISSKQIESSEQIKAVEKEQED--VKE-ASVDVEEIAEVLDHFTVS 237

Query: 239 DIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKFL 298
           D+D+FITR+LYYTLT D  L  PI +S+FISNHIMRNLPP+DHN VN+KKTSWKKS+KFL
Sbjct: 238 DVDYFITRALYYTLTQDKGLELPISASNFISNHIMRNLPPIDHNEVNVKKTSWKKSAKFL 297

Query: 299 KHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRXXXXXXXXXXXXXXXRQE-SENM 357
           KHFEKEGF+KLKGKG+DLTIVG N +K+ELK F PY+                +E +  M
Sbjct: 298 KHFEKEGFLKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSKSATESRESTTSKEKTSGM 357

Query: 358 MYSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDR 417
           MYSL  Y P   AK  +    L    +YT+ ++++AV++YI  K L D K+     +DD 
Sbjct: 358 MYSLTLYKPFNLAKDLLKEVNLASHTYYTSQDIRSAVSQYISVKNLADTKDKGKVIMDDL 417

Query: 418 LYDMCYTKKST-NPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRIKI 476
           L+DM   KK   N  R I R  ++    TNNFTE YQ+FK+DDT L K P++GS P IKI
Sbjct: 418 LFDMVNKKKKVLNASRIIARGEILHPLLTNNFTEFYQIFKSDDTLLFKAPMKGSLPHIKI 477

Query: 477 VTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCXXXXXXXXXXXXXXXXXVQVQGPHS 536
           +TEMKIGRK++TRVSNFE F +D ++LA DLR++C                 VQVQGPH 
Sbjct: 478 ITEMKIGRKVITRVSNFEVFQVDPESLAADLRKIC-SGSTTISESQTFKCAEVQVQGPHG 536

Query: 537 KIIIDHLNSLSIPTKWIDFEN 557
           + IIDHLN L IP+KWIDFEN
Sbjct: 537 QSIIDHLNKLGIPSKWIDFEN 557

>Smik_4.361 Chr4 complement(645227..646924) [1698 bp, 565 aa] {ON}
           YDR117C (REAL)
          Length = 565

 Score =  588 bits (1516), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/563 (53%), Positives = 398/563 (70%), Gaps = 12/563 (2%)

Query: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60
           MFKK PHIK+LSNLKNSERKKLLQ+C  QT + +Y FPTS+IKQTNF  Q SVG +YTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLLQTCIKQTNNEEYTFPTSIIKQTNFGGQKSVGTVYTDE 60

Query: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120
              P+ FKEKH E L+PTVY+CW++P+LLPIVLTH  VI EH+FNGANLMISG++PPFDS
Sbjct: 61  NNIPILFKEKHCEQLYPTVYSCWKNPSLLPIVLTHGFVIEEHLFNGANLMISGSIPPFDS 120

Query: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180
           R    T+CG+A + +P  ++A+GVV+LD+PSY  VIG+TGVAV V+H++ DG+  AFK+K
Sbjct: 121 RCNVGTLCGVAGKQSPKVVLAIGVVELDLPSYDRVIGETGVAVKVIHHFNDGLFKAFKVK 180

Query: 181 RDIPTIVG--GKDKSVDATENDQSPVIITEEEKTEDDSIPEI--SSNDVSELAQEESALT 236
            + P ++    +D+++++ +  ++P    E+ K+ D S   I  ++ D+ E+A+    LT
Sbjct: 181 LEPPVVLNTESEDENINSKQT-ETP----EQVKSADKSQESIKKTAPDLEEVAEVLDHLT 235

Query: 237 VEDIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSK 296
           V D+D+FITR+LYY+LT D  L  PI +S FISNHIMRNLPP+DHN VN+KK+SWKKS+K
Sbjct: 236 VSDVDYFITRALYYSLTQDKGLILPISASKFISNHIMRNLPPIDHNEVNVKKSSWKKSAK 295

Query: 297 FLKHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRXXXXX-XXXXXXXXXXRQESE 355
           FLKHFEKEG +KLKGKG+DLTIVG N +K+ELK F PY+                +  + 
Sbjct: 296 FLKHFEKEGILKLKGKGDDLTIVGKNTDKDELKNFVPYKLGCSSPSKGSGENATSKDRTS 355

Query: 356 NMMYSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLD 415
            MM+SL  Y P   AK  +   +L    +YT+ +++NAV+EYI  K L DKK+ +   +D
Sbjct: 356 GMMHSLTLYKPFSLAKDLLREAKLGCDTYYTSQDVRNAVSEYISVKNLADKKDKRKVVMD 415

Query: 416 DRLYDMCYTKKST-NPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRI 474
           D L++M   KK T +  R I R+ +++   +NNFTE YQ+F+NDDT L + P++G PPRI
Sbjct: 416 DLLFNMVNKKKKTPDTTRIIARSEILQPLLSNNFTEFYQIFRNDDTLLFRVPMKGCPPRI 475

Query: 475 KIVTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCXXXXXXXXXXXXXXXXXVQVQGP 534
           KIVTEMKIGRK++T+VSNFE F ID + LA DLR++C                 VQVQGP
Sbjct: 476 KIVTEMKIGRKVITKVSNFEVFHIDPELLAADLRKIC-SGSTTIGESQTFKSAEVQVQGP 534

Query: 535 HSKIIIDHLNSLSIPTKWIDFEN 557
           H + IID+LN   IP+KWIDFEN
Sbjct: 535 HGQFIIDYLNKSGIPSKWIDFEN 557

>ZYRO0C01496g Chr3 (108150..109853) [1704 bp, 567 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 567

 Score =  576 bits (1485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/561 (51%), Positives = 376/561 (67%), Gaps = 9/561 (1%)

Query: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60
           MFKK PH+K+LSNLKNSE KKLL +C+AQTG+ +Y+FPT VIKQTNF AQ+ +G +YTD 
Sbjct: 1   MFKKDPHVKALSNLKNSEAKKLLATCRAQTGNQEYSFPTGVIKQTNFQAQSGIGTVYTDA 60

Query: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120
           +  P+WFKEKH  LL+PTV+ CW  P LLP+VLTH  V+ E +FNGANLM++GT+ PFDS
Sbjct: 61  DNKPIWFKEKHGNLLYPTVFACWSHPGLLPVVLTHGFVVEERLFNGANLMLAGTVLPFDS 120

Query: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180
           RL P T+CGIA++N P+ ++AVGVVQLD+PSY SV+GKTGVAV ++HY  DG+S  FK+ 
Sbjct: 121 RLKPGTVCGIASKNAPDVVMAVGVVQLDLPSYDSVLGKTGVAVQLVHYLPDGLSKVFKVN 180

Query: 181 RDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIP-EISSNDVSELAQEESALTVED 239
            + P  +   D+  +  E           ++     IP +  + D+ ++A+      +ED
Sbjct: 181 AEPPVSLEDSDEEEEEEEEVLE----ESAQQPSSQEIPSQEKAVDIDDIAEVLDEFRLED 236

Query: 240 IDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKFLK 299
           +D F+TR+LYYTLT+D KL  PI +S+FISNHI  NLP VDH  VN+KK+SWKK++KFLK
Sbjct: 237 VDQFLTRALYYTLTHDTKLELPISASNFISNHINHNLPSVDHEKVNVKKSSWKKTAKFLK 296

Query: 300 HFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYR-XXXXXXXXXXXXXXXRQESENMM 358
           +FEKEGF+KLKGKG+DLTI+G NK+K EL+ F+PY+                +++    +
Sbjct: 297 NFEKEGFLKLKGKGDDLTIIGINKQKPELQNFQPYQISGGSGGGGNSSSNNNKKDGSPQL 356

Query: 359 YSLVFYSPKGSAKQFMTLTEL-PYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDR 417
                Y P   AK F+  T+L P    YTA ELKNA+ +YI    L D KN KM  LDD 
Sbjct: 357 RCETLYKPINLAKDFIQQTDLNPQDILYTAQELKNALNDYIASNNLADSKNKKMVILDDL 416

Query: 418 LYDMCYTK-KSTNPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRIKI 476
           LY +   K K T  PR ++RA +IE    N+FT  +Q++K  D PL KNP RG+ P I+I
Sbjct: 417 LYHLVNKKQKDTTAPRLVSRATIIEPLLANSFTPHFQIYKG-DIPLFKNPSRGNLPNIEI 475

Query: 477 VTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCXXXXXXXXXXXXXXXXXVQVQGPHS 536
           VTEMKIGRK++TRVS FE F ID D LA  LRRLC                 V VQGPH 
Sbjct: 476 VTEMKIGRKVITRVSRFEIFHIDEDELAATLRRLCSGSTTIGETMTSPKYKEVTVQGPHG 535

Query: 537 KIIIDHLNSLSIPTKWIDFEN 557
            +IIDHLNSL IPTKWI F+N
Sbjct: 536 PLIIDHLNSLGIPTKWIKFDN 556

>NCAS0B03800 Chr2 (678984..680681) [1698 bp, 565 aa] {ON} Anc_8.269
           YDR117C
          Length = 565

 Score =  569 bits (1467), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/560 (50%), Positives = 383/560 (68%), Gaps = 7/560 (1%)

Query: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60
           MF+K PHIK+LSNLKNS+RKKL Q+  AQTG+  Y  P S++KQTNF   T++G IYTDE
Sbjct: 1   MFRKEPHIKALSNLKNSDRKKLAQTIHAQTGNDKYTCP-SIVKQTNFQTPTTIGTIYTDE 59

Query: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120
           +  P+WFKEKH   L+ TVYTCW    LLPI L+HD VI E +FNGANLMISGT+PPFD 
Sbjct: 60  KNIPIWFKEKHDPRLYATVYTCWNCEDLLPICLSHDFVIQEKLFNGANLMISGTIPPFDE 119

Query: 121 RLVPATICGIATRNNPNTIV-AVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKM 179
           +L   T+CG+A+  +P  +V A+G+V +D+P +  V+G++GVAV ++H++ D +  +FK+
Sbjct: 120 KLKVGTLCGVASCQDPGRVVYAIGIVMMDLPKFEKVVGESGVAVQIIHHFEDELFKSFKI 179

Query: 180 KRDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSNDVSELAQEESALTVED 239
               P +V  +  SV+  E ++      +  + ++ +    ++ +V +LA+    L+V+D
Sbjct: 180 DLK-PPVVDVQKGSVNDEEEEEEEKEQEKANEEDETTKEMSTATNVEDLAEVLDHLSVQD 238

Query: 240 IDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKFLK 299
           +D+FITR+LYYT+T D KL+ PI +S+FIS HI +NLP VDHN VNIKK+SWKK++KFLK
Sbjct: 239 VDYFITRALYYTITTDTKLSLPISASNFISQHINKNLPDVDHNEVNIKKSSWKKTAKFLK 298

Query: 300 HFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRXXXXXXXXXXXXXXXRQESENMMY 359
           HFEKEGF+KLKGKG+DLT+VG NK K+ELK F PY+                 +S  MMY
Sbjct: 299 HFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKLGSSNGENKGAKKEGDSQS-GMMY 357

Query: 360 SLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDRLY 419
           S+ FY P   AK  +  + +P KN Y   E+++ V  YI  K LVD KN KM  LDD L+
Sbjct: 358 SITFYKPINLAKDLIKESGMPMKNLYLPTEIRDGVNNYITLKNLVDNKNKKMVLLDDLLF 417

Query: 420 DMCYTKKSTNP--PRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRIKIV 477
            M   KK T+P   R I+RA ++E    NNFTE +Q++ +  TPL K+P+RGSPPRIKI+
Sbjct: 418 GMV-NKKRTDPTVSRSISRAQILEPTLKNNFTEHFQIYDSQGTPLFKSPMRGSPPRIKIL 476

Query: 478 TEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCXXXXXXXXXXXXXXXXXVQVQGPHSK 537
           TEMKIGRK++T+VSNFE FGI+ + LA DLR++C                 VQVQGPH +
Sbjct: 477 TEMKIGRKVITKVSNFEQFGINPETLAADLRKMCSGSTTIGETMTSPKTAEVQVQGPHGQ 536

Query: 538 IIIDHLNSLSIPTKWIDFEN 557
           IIIDHLN L +PTKWID+EN
Sbjct: 537 IIIDHLNKLGVPTKWIDYEN 556

>SAKL0H16874g Chr8 (1484425..1486116) [1692 bp, 563 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 563

 Score =  541 bits (1393), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/559 (50%), Positives = 369/559 (66%), Gaps = 11/559 (1%)

Query: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60
           MFKK PHIK+LSNLKNSERKKLL S + Q   +DY FPT V+KQT F  QTS G +YTDE
Sbjct: 1   MFKKDPHIKALSNLKNSERKKLLASVREQREVSDYQFPTQVVKQTTFKGQTSAGTVYTDE 60

Query: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120
           +  P+WFKEKH  L+FPTV+TCW +P +LP+V TH  V+ E +  GA+LM+ G +PPF S
Sbjct: 61  QNVPIWFKEKHGSLMFPTVFTCWSNPDILPVVQTHKHVVEEKLLKGADLMLPGMVPPFSS 120

Query: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180
           +    ++ G+A+  +P  I A+G+VQLD+PSY+ VIG+TGVAVN++H + DG+  AFKMK
Sbjct: 121 KCSKGSLVGVASTRSPRVIKAIGIVQLDLPSYTRVIGETGVAVNIIHTFDDGLCKAFKMK 180

Query: 181 RDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPE--ISSNDVSELAQEESALTVE 238
            + P  +  +D S    E ++  V   +E K    +     +++ D SE   E   L+ E
Sbjct: 181 LEPPEAI--EDTSSKTEEQEEEHVDSADEAKAIATTTQARMVNTEDASEQLNE---LSAE 235

Query: 239 DIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKFL 298
           DIDHF+TRSLYYTLT D +L  P+ +S+F+SNHI+ NLPPVDHN +N+KK+SWKKS+KFL
Sbjct: 236 DIDHFLTRSLYYTLTQDDRLQLPVNASNFVSNHILHNLPPVDHNQINMKKSSWKKSAKFL 295

Query: 299 KHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRXXXXXXXXXXXXXXXRQESENMM 358
           KHFEK  F+KLKGKG+DL +VG NK+K+ELKKF PYR                QE+ NMM
Sbjct: 296 KHFEKANFLKLKGKGDDLVVVGINKDKDELKKFVPYRIGSHGEPTQTKAKA--QENSNMM 353

Query: 359 YSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDRL 418
            ++  Y P  SAK+F    +LP    +TA ELK A+  YI KK LV+K + KM  LDD L
Sbjct: 354 QAVSLYKPISSAKEFSKAVDLPPNKIFTAQELKAALDSYILKKNLVNKDDKKMVLLDDTL 413

Query: 419 YDMC-YTKKSTNPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRIKIV 477
           + M   + K  N  R I+RA ++  F  NNFTE +Q+ K  D PL K  ++G+ P I+IV
Sbjct: 414 FPMINRSTKKENALRTISRAQIMPPFLANNFTEHFQILKG-DVPLFKTALKGAIPEIQIV 472

Query: 478 TEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCXXXXXXXXXXXXXXXXXVQVQGPHSK 537
           TEMKIGRK+VT+VSNFE F +DA+ LA +LR+ C                 V VQGPH  
Sbjct: 473 TEMKIGRKVVTKVSNFEKFQLDAETLAAELRKRCSGSTTIGETMSSPKTLEVTVQGPHGA 532

Query: 538 IIIDHLNSLSIPTKWIDFE 556
           I+I  LN   IPTKWI+F+
Sbjct: 533 IVIGMLNEYGIPTKWINFQ 551

>Kwal_56.23771 s56 (698257..699945) [1689 bp, 562 aa] {ON} YDR117C -
           Hypothetical ORF [contig 173] FULL
          Length = 562

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/561 (48%), Positives = 363/561 (64%), Gaps = 12/561 (2%)

Query: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60
           MFKK P IK+LSNLKNSERKKL   C+ Q   +DY+FP+ VIKQT F    + G +YTD+
Sbjct: 1   MFKKEPQIKALSNLKNSERKKLQSQCREQVQPSDYSFPSQVIKQTTFKTPFTTGTVYTDD 60

Query: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120
           +  P+WFKEK S+LL+PTV++CW +  L+PIVL H+ V+ E +  GANLM+ GT+PPFD 
Sbjct: 61  KNIPIWFKEKFSDLLYPTVFSCWSNKDLVPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180
           R V   + G+A+ ++P+ + A+G+VQL++P YS VIG++GVAV ++H + D +  AFK+K
Sbjct: 121 RCVKTKMVGVASTHSPDVVKAIGIVQLNLPQYSRVIGESGVAVEIVHTFDDELCKAFKVK 180

Query: 181 RDIPTIVGGKDKSVDATENDQSPV---IITEEEKTEDDSIPEISSNDVSELAQEESALTV 237
              P    G  +S D+ EN  + V   I  E + +     P ++ +D +E   + S L+V
Sbjct: 181 LQPPEGADGIAES-DSEENSDAEVSGAIKIEPKPSAPLQEPIVNIDDAAE---QLSQLSV 236

Query: 238 EDIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKF 297
           ED+DHF TR+LYYTLT D KL  P  +S+F+SNHI+RNLPP+DH  VN+KKTSWKK++KF
Sbjct: 237 EDVDHFFTRALYYTLTQDSKLEVPCSASNFVSNHILRNLPPLDHTQVNMKKTSWKKTAKF 296

Query: 298 LKHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRXXXXXXXXXXXXXXXRQESENM 357
           LKHFEKEGF+KLKGKG+DLTIVG +K K+ELK F PYR                 E  +M
Sbjct: 297 LKHFEKEGFLKLKGKGDDLTIVGLDKTKDELKHFVPYR----TGGNSGGSTGSESEQNSM 352

Query: 358 MYSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDR 417
           M +LV Y P  SAK F+  T+L   + ++  ELK AV  YI  K LV + N     LDD 
Sbjct: 353 MKALVIYKPMSSAKPFLCATDLSPNSMFSPQELKGAVDAYIASKGLVSQDNKAAVRLDDL 412

Query: 418 LYDMC-YTKKSTNPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRIKI 476
           L+ +   + K  N  R I RA ++      NF E + + K D TPL K+PV+G  P+I+I
Sbjct: 413 LFSLVNRSTKKENAVRTILRAQIMPPILKGNFAEHFLVLKPDGTPLFKHPVKGDIPQIQI 472

Query: 477 VTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCXXXXXXXXXXXXXXXXXVQVQGPHS 536
           VTEMKIGRK+VT+VSNFE F +DAD LA  LR+ C                 V VQGPH 
Sbjct: 473 VTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGETTTSPKTTEVTVQGPHG 532

Query: 537 KIIIDHLNSLSIPTKWIDFEN 557
             +I+ LN L+IPTKWI+F N
Sbjct: 533 PAVIELLNQLAIPTKWINFVN 553

>KLTH0G13530g Chr7 (1161702..1163426) [1725 bp, 574 aa] {ON} similar
           to uniprot|Q04600 Saccharomyces cerevisiae YDR117C RBF64
           Hypothetical ORF
          Length = 574

 Score =  528 bits (1361), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/566 (46%), Positives = 360/566 (63%), Gaps = 14/566 (2%)

Query: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60
           MFKK P IK+LSNLKNSERK +   CK QTGS++Y FP+ VIKQT F    + G ++TD+
Sbjct: 1   MFKKEPQIKALSNLKNSERKNIQSQCKEQTGSSEYAFPSQVIKQTTFKTPFTTGTVFTDQ 60

Query: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120
           +  P+WFKEK S+LL+PTV+TCW +  LLPIVL H+ V+ E +  GANLM+ GT+PPFD 
Sbjct: 61  KNVPIWFKEKFSDLLYPTVFTCWSNSKLLPIVLAHEYVVEEKLLKGANLMLPGTVPPFDE 120

Query: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180
           R V   +  +A+   P+ + A+G+VQ+++P YS VIG++GVAV ++H +GD +   FK+K
Sbjct: 121 RCVKTRMVSVASTAAPDVVKAIGIVQINLPQYSRVIGESGVAVEIVHTFGDELCKVFKVK 180

Query: 181 RDIP----TIVGGKDKSVDATEND----QSPVIITEEEKTEDDSIPEISSNDVSELAQEE 232
              P     I+  + +     E+D     +P  +   +  +D   P ++  D+SE   E 
Sbjct: 181 LQPPEGSAAILDSESEEEADIEDDTGVPSAPESLAAPKSLQDVQEPLVNVEDISEQLTE- 239

Query: 233 SALTVEDIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWK 292
             L VED+DHF TRSLYY+L +D KL  PI +S+F+SNHI+RNLPP+DH  VN+KKTSWK
Sbjct: 240 --LRVEDVDHFFTRSLYYSLAHDAKLETPISASNFVSNHILRNLPPIDHTQVNMKKTSWK 297

Query: 293 KSSKFLKHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRXXXXXXXXXXXXXXXRQ 352
           K++KFLK+FEKEGF+KLKGKG+DLTI+G ++ K ELK F PYR                 
Sbjct: 298 KTAKFLKYFEKEGFLKLKGKGDDLTIIGVDRTKSELKNFAPYRIGGGASSSEKGASSVAN 357

Query: 353 ESE--NMMYSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPK 410
           E E  ++M ++  Y P  S K F++ T+LP    +T  ++K+AV +YI  K LV   N  
Sbjct: 358 EKEQASVMKAVSLYRPISSTKAFLSATDLPPNQMFTQQDIKSAVDKYISAKNLVSPDNKS 417

Query: 411 MANLDDRLYDMC-YTKKSTNPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRG 469
              LDD LYD+   + K  N  R I RA ++      NF+E + + K D TPL K+PV+G
Sbjct: 418 AVRLDDLLYDLVNRSSKKENAVRTIARAQIMAPVLKGNFSEHFLILKADGTPLFKHPVKG 477

Query: 470 SPPRIKIVTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCXXXXXXXXXXXXXXXXXV 529
           S P+++IVTEMKIGRK+VT+VSNFE F +DAD LA  LR+ C                 V
Sbjct: 478 SIPQVQIVTEMKIGRKVVTKVSNFEKFQVDADELAEALRKKCSGSTTIGEANTSPKTLEV 537

Query: 530 QVQGPHSKIIIDHLNSLSIPTKWIDF 555
            VQGPH   +I+ LN   IPTKWI+F
Sbjct: 538 TVQGPHGPAVIELLNESGIPTKWINF 563

>NDAI0J01310 Chr10 (306474..308213) [1740 bp, 579 aa] {ON} Anc_8.269
           YDR117C
          Length = 579

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 280/577 (48%), Positives = 371/577 (64%), Gaps = 31/577 (5%)

Query: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTS-VIKQTNFNAQT--SVGVIY 57
           MFKK PHIK+LSNLKNS+RKKLLQ+ K QT    YNF  S +IKQTNF      S+G I+
Sbjct: 1   MFKKEPHIKALSNLKNSDRKKLLQTIKTQTNLETYNFNNSNIIKQTNFQTTNPPSIGTIF 60

Query: 58  TDEEGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPP 117
           T++   P+WFK KH++LL+PTV+TCW +  +LP +L+HD VI E +FNGANLMISGT+PP
Sbjct: 61  TNDSNIPIWFKSKHNDLLYPTVFTCWNNHDILPTLLSHDFVIQEKLFNGANLMISGTIPP 120

Query: 118 FDSRLVPATICGIATRNNPNTIV-AVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVA 176
           FDSRL+P T+CGIA+  +P  IV A+GVV+++MPS+  V+G+TGVAV V+H++ D +   
Sbjct: 121 FDSRLIPGTLCGIASVQDPKRIVWAIGVVKMNMPSFDKVVGETGVAVEVIHHFEDELFKI 180

Query: 177 FKMKRDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSNDVSELAQEE--SA 234
           FK     P      D+ V    N + P    + +  ++D+  +   N  S     E    
Sbjct: 181 FKCNDLKP------DEFVKEQLNTEHP---QDNDVADEDTTRKKEENRESNEPDFEVLDH 231

Query: 235 LTVEDIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKS 294
              ED+D+FITRSLYYT+T D K+  PI +S+FIS HI +NLP + HN VNIKKTSWKK+
Sbjct: 232 FKTEDVDYFITRSLYYTITQDTKVELPISASNFISQHINKNLPDISHNEVNIKKTSWKKT 291

Query: 295 SKFLKHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRXXXXXX---XXXXXXXXXR 351
           +KFLKHFEKEGF+KLKGKG+DLT+VG NK K+ELK F PY+                  +
Sbjct: 292 AKFLKHFEKEGFLKLKGKGDDLTVVGMNKTKDELKNFVPYKIGKSTTPSFSLSSPNTNDK 351

Query: 352 QESENMMYSLVFYSPKGSAKQFM-TLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPK 410
            +++ MMYS  FY P   AK  +  +  +P K  YT  E+++ VT YI  K L+D KN K
Sbjct: 352 SDTKGMMYSETFYKPINHAKDLLKAVPTIPTKPLYTQQEIRDIVTSYINSKNLIDMKNKK 411

Query: 411 MANLDDRLYDMCYTKKS--TNPPRHITRAAVIESFTTNNFTELYQLFK---------NDD 459
           M  LDD L++M + ++S     PR + R  ++E    NNFTE YQ+++          D 
Sbjct: 412 MILLDDLLFNMVHKRQSEANAAPRTMMRGTILEPILANNFTEHYQIYRKRNGKGELMEDV 471

Query: 460 TPLTKNPVRGSPPRIKIVTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCXXXXXXXX 519
            PL K+P RG  P+I I+TEMKIGRK++T+VSNFE FGI +D LA DLR+LC        
Sbjct: 472 EPLFKSPQRGHLPQIDILTEMKIGRKVITKVSNFEIFGISSDFLAADLRKLCSGSTTIGE 531

Query: 520 XXXXXXXXXVQVQGPHSKIIIDHLN-SLSIPTKWIDF 555
                    VQVQGPH +IIIDHLN    +PTKWI++
Sbjct: 532 TMTSPKTPEVQVQGPHGQIIIDHLNKKFGVPTKWINY 568

>KAFR0B05470 Chr2 (1120794..1122482) [1689 bp, 562 aa] {ON}
           Anc_8.269 YDR117C
          Length = 562

 Score =  516 bits (1330), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 267/564 (47%), Positives = 362/564 (64%), Gaps = 18/564 (3%)

Query: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGS-TDYNFPTSVIKQTNFNAQTSVGVIYTD 59
           MFKK P IK+LS LKNS+RKKL+QS KAQ  S  D +     I QTNF + T+ G IYTD
Sbjct: 1   MFKKEPRIKALSKLKNSDRKKLVQSLKAQLKSDEDISVAGDSIMQTNFISTTAAGTIYTD 60

Query: 60  EEGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFD 119
               P+ FK KHS+ L+PT +  W +  LL  V TH +V+  +IFNGA+LMI+GT+PPFD
Sbjct: 61  SNSIPIMFKTKHSDTLYPTSFLLWSNNGLLSTVRTHSVVVENYIFNGADLMIAGTVPPFD 120

Query: 120 SRLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKM 179
           S L   TIC +AT+  P+  +AVG+V+L++P Y  V+GKTGVAV +LH++ D +   FK 
Sbjct: 121 STLTIGTICAVATKEAPDVAIAVGIVKLNLPEYQQVLGKTGVAVEILHHFEDALFSTFKA 180

Query: 180 KRDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSI----PEISSNDVSELAQEESAL 235
           K +IP        SV +   +++   + +E   E +S     P   S    ++A+    L
Sbjct: 181 KLEIPA-------SVKSILQEETTADVAKESDAEQESQSVTEPPSGSEGPDDIAEVLDEL 233

Query: 236 TVEDIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSS 295
           TVED+D+FI R+LY+T+  D  L  P+ +S+F+SNHIMRNLP VDH  VNIK+TSWKK++
Sbjct: 234 TVEDVDYFIRRALYFTMVQDNTLTLPVVASAFMSNHIMRNLPDVDHKKVNIKRTSWKKTA 293

Query: 296 KFLKHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRXXXXXXXXXXXXXXXRQESE 355
           KFLK+FEKEGF+KLKGKG+DL IVG NK+K+ELK F PY+               + +  
Sbjct: 294 KFLKYFEKEGFLKLKGKGDDLIIVGMNKDKDELKNFVPYKIGNTAKKAASKSDSTQTQGV 353

Query: 356 NMMYSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLD 415
           + + S+  Y P    ++F+  + +     YT++E++N + +YI KK LVD+K+ KM  LD
Sbjct: 354 S-VSSVNLYKPINLGQKFIKESNISGGPMYTSLEIRNCINDYIIKKNLVDEKDKKMVMLD 412

Query: 416 DRLYDMCYTKKSTNP--PRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPR 473
           D L+ M   +K  NP  PR I RA ++E    NNF E +QL+K D+TPL KNP++G  P+
Sbjct: 413 DLLFAMV-NRKIQNPIFPRIIPRANILEPLIANNFNEYFQLYKGDNTPLFKNPIKGQTPK 471

Query: 474 IKIVTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCXXXXXXXXXXXXXXXXXVQVQG 533
           I IVTEMKIGRK+VTRVSNFE+F I  + LA DLR+LC                 VQVQG
Sbjct: 472 IDIVTEMKIGRKVVTRVSNFENFRISPEELAADLRKLC--SGSTTISETPKKVSEVQVQG 529

Query: 534 PHSKIIIDHLNSLSIPTKWIDFEN 557
           PH ++IIDH N   IP+K+I FEN
Sbjct: 530 PHGQLIIDHFNKSGIPSKFIQFEN 553

>CAGL0B01837g Chr2 complement(166953..168662) [1710 bp, 569 aa] {ON}
           similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117c
          Length = 569

 Score =  511 bits (1316), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 274/564 (48%), Positives = 370/564 (65%), Gaps = 13/564 (2%)

Query: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60
           MFKK PHIK+LSNLKNSERKKL + C+ QT + +Y+F ++ IKQTNF   T++G IYTDE
Sbjct: 1   MFKKEPHIKALSNLKNSERKKLQEKCRIQTSNEEYSFGSNTIKQTNFKGITTIGTIYTDE 60

Query: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120
             +P+WFKEKH E L+PTV  CW  P L+P+VLTH IV+ +HIFNGANLMISGT+PPFD 
Sbjct: 61  GNAPIWFKEKHDEKLYPTVLACWRCPNLIPVVLTHSIVLEDHIFNGANLMISGTIPPFDE 120

Query: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180
           RL   T+CGIA +  PN IVAVG+VQ+++PS++ VIG+TGVAV ++H+  D +   FK+K
Sbjct: 121 RLTVGTVCGIADKRTPNLIVAVGIVQMNLPSFTRVIGETGVAVQIVHHLEDELFKVFKVK 180

Query: 181 RDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSNDVSELAQEESALTVEDI 240
            + P  +  + +S  + E +    I  +E K E +S  E   +++ ++A+    L +EDI
Sbjct: 181 EEPPAEL-LQTQSSSSEELELEADIHEDETKVESNSDTEKEKSNLDDMAEVLDELRLEDI 239

Query: 241 DHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNL--VNIKKTSWKKSSKFL 298
           D+FITR+LYYT++ D KL  P  +S+F+SNHI  NLP    NL  VNIKK+SWKK++KFL
Sbjct: 240 DYFITRALYYTISQDTKLETPTSASNFVSNHINHNLPK-GTNLAEVNIKKSSWKKTAKFL 298

Query: 299 KHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRXXXXXXXXXXXXXXXRQESENMM 358
           KHFEKEGF+KLKG G+DLTIV  NK+K+E+K+F PY                   ++  +
Sbjct: 299 KHFEKEGFLKLKGVGDDLTIVEVNKDKDEIKQFLPYPVIGNQGSNTGSEGG---NAKTTI 355

Query: 359 YSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDRL 418
             +  Y P   AK F++  ++P K  Y   E+K  + +YI  K+LVDKK+ K   +DD L
Sbjct: 356 KIVTLYKPINLAKDFISSNKVPLKQLYMEPEIKELINKYITMKDLVDKKDKKCVLVDDML 415

Query: 419 YDMCYTKK--STNPPRHITRAAVIESFTTNNFTELYQLFK---NDDTPLTKNPVRGSPPR 473
             M Y KK       R I RA +++    NNF + Y LF+   N+ TPLTK P++G PP+
Sbjct: 416 MTMIYKKKEDQATKSRVIPRANILQPVLQNNFNKNYHLFRITGNEQTPLTKTPLKGEPPK 475

Query: 474 IKIVTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCX-XXXXXXXXXXXXXXXXVQVQ 532
           I IVTEMKIGRK++T+VSNFE F ID +  A D+R+ C                  VQVQ
Sbjct: 476 INIVTEMKIGRKVITKVSNFEVFQIDPEEFAADIRKKCSGSTTIGETTSSAKKTAEVQVQ 535

Query: 533 GPHSKIIIDHLNSLSIPTKWIDFE 556
           GPH ++I+ +LN L IP KWIDFE
Sbjct: 536 GPHGQLIMSYLNDLGIPNKWIDFE 559

>TBLA0I03200 Chr9 complement(769960..771651) [1692 bp, 563 aa] {ON}
           Anc_8.269 YDR117C
          Length = 563

 Score =  489 bits (1259), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 253/568 (44%), Positives = 356/568 (62%), Gaps = 9/568 (1%)

Query: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60
           MFKK   I +LSNLKNSE + + Q+C+    + +Y FP S +KQT F +  + GVIYTD 
Sbjct: 1   MFKKNLTITTLSNLKNSESRNIRQTCRDALSNNEYEFPGSQVKQTTFESTVANGVIYTDS 60

Query: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120
              P+WFK+K+S  + PTVYT WE P  +PI+ THD +I   IFNGANLMI GT+ P D 
Sbjct: 61  NNVPIWFKQKYSNTIVPTVYTAWEYPNNIPIIRTHDFIIETKIFNGANLMIPGTVGPHDE 120

Query: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180
           RL P  ICGIA+   P TI+A+G+   DM +  + +GKTGVAV VLH++ D ++  FK+K
Sbjct: 121 RLKPGKICGIASTKVPGTILAIGLCTFDMSTVDTPLGKTGVAVEVLHWYSDELTNIFKIK 180

Query: 181 RDIPTIVGGKD-KSVDATENDQSPVIITEEEKTEDDSIP--EISSNDVSELAQEESALTV 237
            + PTI+   + K++++   +     I+E E       P  +  +++  +LA+    L V
Sbjct: 181 LNPPTIMNTSNLKTLESMTQESMTQEISEAESEVKPDAPFNDTFTSNADDLAETLEQLRV 240

Query: 238 EDIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKF 297
           EDID+F+T+SLYYT+T +  L  PI SS+F+S ++M+NLP VDHN VNIKK+SWKK++KF
Sbjct: 241 EDIDNFLTQSLYYTITQETSLQLPIISSTFVSGYLMKNLPNVDHNQVNIKKSSWKKTAKF 300

Query: 298 LKHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRXXXXXXXXXXXXXXXRQESENM 357
           LKHFEKEGF+KLKGKG+DLTI G NKEK +LK F PYR               +Q+++N 
Sbjct: 301 LKHFEKEGFLKLKGKGDDLTITGFNKEKPQLKTFVPYR---IGKPAGALPSKDKQDNKNF 357

Query: 358 MYSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDR 417
           +  +  YSPK       T   L  K+++T+ E+ +A+  YI KK L + K+    ++DD 
Sbjct: 358 LKVVTLYSPKKKNDSCWTALGLTSKSYFTSAEITSAIQGYIAKKNLANPKDKAKISMDDV 417

Query: 418 LYDMCYTKKSTNPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRIKIV 477
           L+D+  T    N  R+I R+ V+E    NNF   +QLF +D+  L+K+P +GSPP +K+V
Sbjct: 418 LFDLVITNNKANANRNIMRSQVVEPVLVNNFLLYHQLFTHDNISLSKHPKKGSPPTVKMV 477

Query: 478 TEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCXXXXXXXXXXXXXXXXXVQVQGPHSK 537
           TE     K++TRVSNFE F IDA  ++ +L+ LC                 VQVQGPH  
Sbjct: 478 TEKVKRGKVITRVSNFEVFNIDAKDMSNELKVLC---SGSTSIEELPNGSEVQVQGPHGD 534

Query: 538 IIIDHLNSLSIPTKWIDFENKLKPKKIR 565
           I++++     IP KW D+ NK+KPKK R
Sbjct: 535 IVMEYFEKHGIPRKWFDYTNKVKPKKRR 562

>KNAG0H03200 Chr8 (599611..601296) [1686 bp, 561 aa] {ON} Anc_8.269
           YDR117C
          Length = 561

 Score =  446 bits (1146), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 248/573 (43%), Positives = 349/573 (60%), Gaps = 37/573 (6%)

Query: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60
           MFKKTPHIK LSNLKNSE++KL Q  + Q G  ++ F  + +KQTNF + TSVG IY ++
Sbjct: 1   MFKKTPHIKPLSNLKNSEQRKLQQEVQKQFGVDEFVFSGNTVKQTNFQSTTSVGTIYLND 60

Query: 61  EG--SPLWFKEKH-SELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPP 117
           E    PL+FKEKH S  L+P+VY CW  P LLPI+LTH +VI +H+FNGANLMISGT+PP
Sbjct: 61  EKIPVPLFFKEKHGSGPLWPSVYACWSHPGLLPIILTHSVVIEDHLFNGANLMISGTMPP 120

Query: 118 FD-SRLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVL--HYWGDGMS 174
           FD + L     CGIA   +P+ I+AVG +++D+  +++        V V   H++ DG++
Sbjct: 121 FDVAHLHKGRPCGIANYKSPDVIIAVGTLKMDLEPFNTTGVVGHSGVVVEVAHHFADGLA 180

Query: 175 VAFKMKRDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDD-SIPEISSNDVSELAQEES 233
            AF++K DIP      DK   AT  +     + EE   E   + P  +   V +LA+   
Sbjct: 181 DAFRLKLDIP------DKLESATTQE-----VAEEPPVEAKPTSPVTNPVAVDDLAEVLE 229

Query: 234 ALTVEDIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPP-VDHNLVNIKKTSWK 292
            L+VED+D+F+TR+LYYTLT + KLA PI +S+F+S H+M+ LP  +D   VN+KK+SWK
Sbjct: 230 TLSVEDVDYFMTRALYYTLTQEPKLALPINASNFMSMHLMKCLPKGIDATEVNVKKSSWK 289

Query: 293 KSSKFLKHFEKEGFIKLKGKGEDLTIVGSNKEKEE--LKKFEPYRXXXXXXXXXXXXXXX 350
           K++K+LKHFEKEG +KLKGKG+DL +VGS   K    LK F PY                
Sbjct: 290 KTAKYLKHFEKEGLLKLKGKGDDLVVVGSTDSKTHAGLKDFVPY-----LVGNSIAESGP 344

Query: 351 RQESEN--MMYSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKN 408
           + ++ N  +M+++  + P  +A+   T   L  + +++  E++  + EYI   +L    N
Sbjct: 345 KSQTTNGPVMFAVTSFQPDSTAQ---TALPLGGQRYFSGPEIREVLNEYITANKLAQPNN 401

Query: 409 PKMANLDDRLYDMCYT----KKSTNPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTK 464
           PKM  L+D L+ M       K++T   R + R  ++E     +F  LYQLFK+ DTPLTK
Sbjct: 402 PKMVLLNDTLFGMVTKGNEEKQTTK--RIMARPEILERVMKYHFKTLYQLFKDKDTPLTK 459

Query: 465 NPVRGSPPRIKIVTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCXXXXXXXXXXXXX 524
           +P +G PP++ I+TEMKIGRK+VTRV NF+   I     A DLR+LC             
Sbjct: 460 HPQKGEPPKVHIITEMKIGRKVVTRVYNFDHLNIRDTEFAADLRKLCSASTTIGKTVSTP 519

Query: 525 XXXXVQVQGPHSKIIIDHLNSLSIPTKWIDFEN 557
               +QVQG H  +IIDHL  L +P+ W+ FEN
Sbjct: 520 VVSEIQVQGAHGPLIIDHLRELGVPSSWVVFEN 552

>Ecym_4301 Chr4 (644340..646034) [1695 bp, 564 aa] {ON} similar to
           Ashbya gossypii AGR079W
          Length = 564

 Score =  435 bits (1119), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 226/569 (39%), Positives = 346/569 (60%), Gaps = 12/569 (2%)

Query: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60
           MFKK P IKS SNLKNSERKKLL + +AQ  + ++ F T+++KQ  F   T+ G I+TDE
Sbjct: 1   MFKKKPTIKSASNLKNSERKKLLGNVRAQCANQEFQFSTTIVKQATFKTPTATGTIFTDE 60

Query: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120
           +  P++FKEKHSE L PT+ TCW+ P LL +VLTH  V++  + NGA+LM+ GT+PPF  
Sbjct: 61  DNKPIFFKEKHSEFLIPTILTCWQYPGLLHVVLTHKHVLDNKLKNGADLMLPGTIPPFSD 120

Query: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180
                 + G+A+   P  + A+GV QL++     V+G+TGVAV VLH   DG+   FKM 
Sbjct: 121 NCTRGKLVGVASSETPFVVEAIGVCQLNLAGIVKVVGETGVAVKVLHTINDGLWEVFKMS 180

Query: 181 RDIPT--IVGGKDK-SVDATENDQSPVIITEEE---KTEDDSIPEISSNDVSELAQEESA 234
            + P+  +V  K +  ++A         I E+E     +  S P    N +SE+A++   
Sbjct: 181 VEPPSQLLVSQKHEVELEALAQADDAGGIQEDEDLPTAKTASGPLEEPNSLSEVAEQLEE 240

Query: 235 LTVEDIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKS 294
           L++E +DHF+T+++YYTL  D  L  PI +S+FI+NH+M+NLP +    V++K++SW ++
Sbjct: 241 LSIETVDHFLTQAVYYTLALDNTLKLPIGASNFIANHVMKNLPRIHKTQVSLKRSSWARA 300

Query: 295 SKFLKHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRXXXXXXXXXXXXXXXRQES 354
           SKFLK+FE +GF+KLKGK E+LT+V  NK+K E+K F+PYR               +   
Sbjct: 301 SKFLKYFENQGFLKLKGKVENLTVVSVNKDKTEIKSFQPYR-----TIQKSVSTSSKNND 355

Query: 355 ENMMYSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANL 414
           ++ +  +V+Y P  +AK  +            A ++K  + +Y+ +K+LV+  + ++  L
Sbjct: 356 KHDVEVVVYYQPLNTAKATLHALGNNPNAMLKAKDIKAILNKYVTEKKLVNATDERIILL 415

Query: 415 DDRLYDMCYTKKSTNPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRI 474
           DD L+ + Y K +++  R + RA + +   + +FTE++ +FK D  PL+  P++     +
Sbjct: 416 DDTLFSLAYKKSASDSTRKVLRAKMFDLILSTSFTEVFFIFK-DGKPLSSKPLKSKNRNV 474

Query: 475 KIVTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCXXXXXXXXXXXXXXXXXVQVQGP 534
            ++TEMKI RKIVTR+SNFE +G+D + L+ +LR+ C                 VQVQGP
Sbjct: 475 SVMTEMKIHRKIVTRISNFEIYGVDPEELSLELRKRCSGSSTVLEPSTLQSTTEVQVQGP 534

Query: 535 HSKIIIDHLNSLSIPTKWIDFENKLKPKK 563
           H    I+ LN   IP+K+IDF+NKL  KK
Sbjct: 535 HGNTAINILNEHGIPSKYIDFDNKLNKKK 563

>KLLA0F19294g Chr6 complement(1784664..1786376) [1713 bp, 570 aa]
           {ON} similar to uniprot|Q04600 Saccharomyces cerevisiae
           YDR117C RBF64 Hypothetical ORF
          Length = 570

 Score =  425 bits (1093), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 228/564 (40%), Positives = 331/564 (58%), Gaps = 11/564 (1%)

Query: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60
           MF K PHIK LSNLKNS+RKKL  + K Q    +YN PT+VIKQT+F      G IYTDE
Sbjct: 1   MFAKEPHIKPLSNLKNSDRKKLQSTIKRQINE-EYNLPTAVIKQTSFQVANVAGSIYTDE 59

Query: 61  EGSPLWFKEKHSELLFPTVYTCWE-DPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFD 119
              P+WFK K  + L+PT+++ W     LLPI+LTHD VI +HI  GA LM+ GT+PPF 
Sbjct: 60  SNKPIWFKTKFEDQLYPTIFSLWNLQMQLLPIILTHDFVIEKHILGGAQLMLPGTVPPFP 119

Query: 120 SRLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKM 179
           S +   +I GIA+  +P  + A+G+ ++D+   S VIG  G+AV V+HY  DG+  AFK+
Sbjct: 120 SNVKRGSIVGIASTKDPLLVKAIGIAEMDLCGISHVIGTKGIAVRVVHYLDDGLFKAFKL 179

Query: 180 KRDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSND-VSELAQEESALTVE 238
           + + P +V   +  ++ T  +       E+   E + +   SS   V+E+A E   +++E
Sbjct: 180 ELEPPAVVYNSE-PIETTAIETQTSKYGEQLDEESNHLERSSSQSPVNEIADELEEMSIE 238

Query: 239 DIDHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKFL 298
           D+DH + R++ Y++  D K+  PI +S+FISNH+M+NLP VD N+VNIKK+SWKK++K L
Sbjct: 239 DVDHMLMRAVKYSIKFDDKITLPIVASTFISNHVMKNLPDVDTNMVNIKKSSWKKATKLL 298

Query: 299 KHFEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRXXXXXXXXXXXXXXXRQESENMM 358
           K+ E EGF+KLKGK +  T++  NK  ++L   E Y+                Q ++N +
Sbjct: 299 KYLEDEGFLKLKGKNDSCTVISLNKNHKDLTNMEAYK-TLATIAKKSSGDTTNQSNKNKI 357

Query: 359 YSLV---FYSPKGSAKQFMT-LTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANL 414
            +      Y P  + ++F+T +T    +++YT  ELK  +  Y+    L+D +N  +   
Sbjct: 358 TAYSGENLYKPMSACQRFITGITADVPQSYYTQQELKKLLDLYVANNNLIDPENKSLVKY 417

Query: 415 DDRLYDMCYTKKSTNPPRHITRAAVIE-SFTTNNFTELYQLFKNDDTPLTKNPVRGSPPR 473
           DD LY M          + I R  ++  +F + NF   +Q++K +  PL K P +G  P 
Sbjct: 418 DDTLYQMSNRAPQNGGIQKIARGLIVSPTFLSKNFNTYHQIYKPNGEPLLKVPEKGPIPT 477

Query: 474 IKIVTEMKIGRKIVTRVSNFESFGIDADALAGDLRRLCXXXXXXXXXXXXXXXXXVQVQG 533
           ++IVTE KIGRK++TRV+NFE F ID++ LA  LR+ C                 VQVQG
Sbjct: 478 LEIVTEKKIGRKVITRVTNFEKFKIDSEELAAALRKKC-SGSTTIGESKSTKTAEVQVQG 536

Query: 534 PHSKIIIDHLNSLSIPTKWIDFEN 557
           PH  I+I  LN   IPTKWI FEN
Sbjct: 537 PHGSIVISILNDYGIPTKWISFEN 560

>AGR079W Chr7 (879417..881045) [1629 bp, 542 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR117C
          Length = 542

 Score =  393 bits (1009), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 204/563 (36%), Positives = 313/563 (55%), Gaps = 23/563 (4%)

Query: 1   MFKKTPHIKSLSNLKNSERKKLLQSCKAQTGSTDYNFPTSVIKQTNFNAQTSVGVIYTDE 60
           MFKK P++   SN KNSERK+L  S + Q     Y F ++ IK   F  Q++VG +YTD 
Sbjct: 1   MFKKEPNLNPTSNTKNSERKRLQASIREQYEYESYQFSSTEIKHGTFKTQSTVGTVYTDP 60

Query: 61  EGSPLWFKEKHSELLFPTVYTCWEDPTLLPIVLTHDIVINEHIFNGANLMISGTLPPFDS 120
              PLWF+ KH +   PTVY+CW+ P LLP+V TH+ V+   +  GA+LM+ GT+PPF S
Sbjct: 61  NNIPLWFRGKHDQTYIPTVYSCWDHPDLLPVVHTHEHVVESKLKGGADLMLPGTVPPFSS 120

Query: 121 RLVPATICGIATRNNPNTIVAVGVVQLDMPSYSSVIGKTGVAVNVLHYWGDGMSVAFKMK 180
                 + GIA+   P  + AVG+ ++D+   ++V   TGVAV VLH +GDG+   FK++
Sbjct: 121 GTRRGRVVGIASTRAPGVVKAVGICEMDLEGVTTVADTTGVAVRVLHTYGDGLCRVFKVQ 180

Query: 181 RDIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSNDVSELAQEESALTVEDI 240
           R+ P     K  S +A E +  P              P+ +  +   LA+E   LT+ED+
Sbjct: 181 REAPEASEAKGASPEAREPEAEP--------------PKTAPGE--GLAEELERLTMEDV 224

Query: 241 DHFITRSLYYTLTNDLKLAFPIPSSSFISNHIMRNLPPVDHNLVNIKKTSWKKSSKFLKH 300
           DH +TR++YYT+  D +L  P+ +S FI+ H+++NLPP+D + V +K++SW K++K LKH
Sbjct: 225 DHLLTRAVYYTIKADGRLQLPVTASKFIAEHVLKNLPPMDLSQVTVKRSSWGKAAKLLKH 284

Query: 301 FEKEGFIKLKGKGEDLTIVGSNKEKEELKKFEPYRXXXXXXXXXXXXXXXRQESENMMYS 360
           FE +G + LKGK E  T+V  N   E LK FEPYR                Q  E + + 
Sbjct: 285 FEAQGLLTLKGKPESFTVVSVNSAHEALKSFEPYRTVSDKASTGSKNSSTTQSLEIVYH- 343

Query: 361 LVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEYIKKKELVDKKNPKMANLDDRLYD 420
              Y P  +    +    +   +  +A ++++ + +Y+  ++ VD  +  M  LDD L  
Sbjct: 344 ---YVPNRTLLPQLNGLGISGGDALSAKDIRDRLEQYVAARKCVDPYDKSMLRLDDTLAQ 400

Query: 421 MCYTKKSTNPPRHITRAAVIESFTTNNFTELYQLFKNDDTPLTKNPVRGSPPRIKIVTEM 480
           + +   + + PR + R   + +  + +F+E + + +  D PL+K P +G  P IK+  E 
Sbjct: 401 LLHKNVNADTPRSLPRPEALAALLSRSFSEYFVVMRG-DAPLSK-PQKGRAPPIKVTNER 458

Query: 481 KIGRKIVTRVSNFESFGIDADALAGDLRRLCXXXXXXXXXXXXXXXXXVQVQGPHSKIII 540
           KI +K+VT+VSNFE +G+D + LA +LR  C                 VQVQGPH   I+
Sbjct: 459 KIYKKVVTKVSNFEVYGVDPEELAAELRVRC-SGSTTITDVPNTKAVEVQVQGPHEATIV 517

Query: 541 DHLNSLSIPTKWIDFENKLKPKK 563
             LN   IP+K+I  + K++PKK
Sbjct: 518 SILNKHGIPSKYITLDCKVQPKK 540

>NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON}
           Anc_1.324 YJL057C
          Length = 628

 Score = 33.1 bits (74), Expect = 1.9,   Method: Compositional matrix adjust.
 Identities = 27/95 (28%), Positives = 47/95 (49%), Gaps = 4/95 (4%)

Query: 351 RQESENMMYSLVFYSPKGSAKQFMTLTELPYKNWYTAIELKNAVTEY-IKKKELVDK-KN 408
           R++     +S   YS  G    F+   ELP++   +  ELK  +  +   KKE+++K K 
Sbjct: 400 RKDYNEYTFSADLYS-LGMICYFIVFAELPFQTQLSISELKINIKNFQFNKKEMIEKHKR 458

Query: 409 PKMANLDDRLYDMCYTKKSTNPPRHITRAAVIESF 443
            K+  +D +++D+  +  S N  R   RA  +E F
Sbjct: 459 LKLKPIDLKIFDIMESLLSPNVARR-PRAKDVEKF 492

>YGL233W Chr7 (59122..61854) [2733 bp, 910 aa] {ON}  SEC15Essential
           113kDa subunit of the exocyst complex (Sec3p, Sec5p,
           Sec6p, Sec8p, Sec10p, Sec15p, Exo70p, and Exo84p), which
           mediates polarized targeting of vesicles to active sites
           of exocytosis; Sec15p associates with Sec4p and vesicles
          Length = 910

 Score = 33.5 bits (75), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%)

Query: 182 DIPTIVGGKDKSVDATENDQSPVIITEEEKTEDDSIPEISSNDVSELAQEESALTVEDID 241
           D PT+     KS++AT  +    I   + + +D + PEI     S + QE++AL +  I 
Sbjct: 806 DAPTLFENNIKSLEATFMELKQCIELLKTQGKDYNEPEIRLRKYSRIRQEDAALLLSKIQ 865

Query: 242 HFIT 245
           HF++
Sbjct: 866 HFVS 869

>Ecym_5456 Chr5 complement(936012..936950) [939 bp, 312 aa] {ON}
           similar to Ashbya gossypii AAR117C
          Length = 312

 Score = 32.0 bits (71), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 26/83 (31%), Positives = 41/83 (49%), Gaps = 7/83 (8%)

Query: 205 IITEEEKTEDDSIPEISSNDVSELAQEESALTVEDI----DHFITRSLYYTLTNDLKLAF 260
           I+TE++ TE   I E+ +ND  E  ++   +T+ +     D  +T SLY TL N L   F
Sbjct: 210 IVTEKQLTE--KIEELFTNDNVEYMKKNLHVTLANRASFGDQSVTDSLYGTLANGLHDGF 267

Query: 261 PIPSSSFISNHIMRNLPPVDHNL 283
           PI    F++  +   L     N+
Sbjct: 268 PI-IKDFLTGELNEGLSESKQNI 289

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.385 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,084,563
Number of extensions: 2832793
Number of successful extensions: 11170
Number of sequences better than 10.0: 61
Number of HSP's gapped: 11474
Number of HSP's successfully gapped: 61
Length of query: 566
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 451
Effective length of database: 40,294,809
Effective search space: 18172958859
Effective search space used: 18172958859
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)