Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_392.118.255ON67567535150.0
TPHA0B032608.255ON71471022510.0
YDR108W (TRS85)8.255ON69867721270.0
Suva_2.2688.255ON69567921190.0
ZYRO0C01826g8.255ON69968521160.0
Skud_4.3698.255ON69867721150.0
TDEL0F038208.255ON68767021120.0
Smik_4.3548.255ON69867521080.0
NCAS0B038808.255ON70669820730.0
NDAI0J014108.255ON71669620670.0
CAGL0B01705g8.255ON67267420530.0
KAFR0B055708.255ON66968119060.0
KLTH0G13860g8.255ON70872117470.0
Kwal_56.235838.255ON70072417240.0
SAKL0H17226g8.255ON71974716840.0
KNAG0H032708.255ON64869915340.0
TBLA0E043808.255ON88963914480.0
Ecym_43168.255ON62366912611e-165
KLLA0F18953g8.255ON64769112101e-157
AGR096C8.255ON62367311881e-154
Kpol_1002.466.223ON539130820.26
KAFR0B043305.86ON28957723.4
SAKL0F15444g7.512ON964198733.9
SAKL0F01584g3.535ON47753715.2
NCAS0D039806.247ON145546725.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_392.11
         (675 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}...  1358   0.0  
TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {O...   871   0.0  
YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subun...   823   0.0  
Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W ...   820   0.0  
ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {...   819   0.0  
Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W ...   819   0.0  
TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.2...   818   0.0  
Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W ...   816   0.0  
NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {O...   803   0.0  
NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {...   800   0.0  
CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly...   795   0.0  
KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa] ...   738   0.0  
KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]...   677   0.0  
Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108...   668   0.0  
SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]...   653   0.0  
KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {O...   595   0.0  
TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON} Anc_8...   562   0.0  
Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}...   490   e-165
KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} simi...   470   e-157
AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON} S...   462   e-154
Kpol_1002.46 s1002 (135310..136929) [1620 bp, 539 aa] {ON} (1353...    36   0.26 
KAFR0B04330 Chr2 complement(897247..898116) [870 bp, 289 aa] {ON...    32   3.4  
SAKL0F15444g Chr6 (1243590..1246484) [2895 bp, 964 aa] {ON} simi...    33   3.9  
SAKL0F01584g Chr6 complement(131250..132683) [1434 bp, 477 aa] {...    32   5.2  
NCAS0D03980 Chr4 complement(743879..748246) [4368 bp, 1455 aa] {...    32   5.4  

>Kpol_392.11 s392 complement(30871..32898) [2028 bp, 675 aa] {ON}
           complement(30871..32898) [2028 nt, 676 aa]
          Length = 675

 Score = 1358 bits (3515), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 658/675 (97%), Positives = 658/675 (97%)

Query: 1   MASLQFSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNI 60
           MASLQFSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNI
Sbjct: 1   MASLQFSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNI 60

Query: 61  DSLYLLMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYS 120
           DSLYLLMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYS
Sbjct: 61  DSLYLLMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYS 120

Query: 121 RSRSNSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTND 180
           RSRSNSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTND
Sbjct: 121 RSRSNSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTND 180

Query: 181 ETDHKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKF 240
           ETDHKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKF
Sbjct: 181 ETDHKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKF 240

Query: 241 KNQNNAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWN 300
           KNQNNAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWN
Sbjct: 241 KNQNNAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWN 300

Query: 301 KSHSEDVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQR 360
           KSHSEDVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQR
Sbjct: 301 KSHSEDVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQR 360

Query: 361 KISFWEETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLL 420
           KISFWEETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLL
Sbjct: 361 KISFWEETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLL 420

Query: 421 RKLADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKN 480
           RKLADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKN
Sbjct: 421 RKLADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKN 480

Query: 481 DVNPLIERSLDTYEQCSILAQNSLENDELLSEPVRSYETRCMLLTSELFLSLNDTWTSTP 540
           DVNPLIERSLDTYEQCSILAQNSLENDELLSEPVRSYETRCMLLTSELFLSLNDTWTSTP
Sbjct: 481 DVNPLIERSLDTYEQCSILAQNSLENDELLSEPVRSYETRCMLLTSELFLSLNDTWTSTP 540

Query: 541 YALSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHRVETVTKIENNEGGQQLQT 600
           YALSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHRVETVTKIENNEGGQQLQT
Sbjct: 541 YALSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHRVETVTKIENNEGGQQLQT 600

Query: 601 DDIVSKGXXXXXXXXXXXXXXXXXWAEQKQWRQVSWCLRDVEYIYDDLSFSKRPELIYQK 660
           DDIVSKG                 WAEQKQWRQVSWCLRDVEYIYDDLSFSKRPELIYQK
Sbjct: 601 DDIVSKGLARKRKAAFFRLLAAKKWAEQKQWRQVSWCLRDVEYIYDDLSFSKRPELIYQK 660

Query: 661 LKDELNEERQGNKKQ 675
           LKDELNEERQGNKKQ
Sbjct: 661 LKDELNEERQGNKKQ 675

>TPHA0B03260 Chr2 complement(749568..751712) [2145 bp, 714 aa] {ON}
           Anc_8.255 YDR108W
          Length = 714

 Score =  871 bits (2251), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 435/710 (61%), Positives = 522/710 (73%), Gaps = 46/710 (6%)

Query: 4   LQFSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSL 63
           + F+YENYMNL++HLD+V+E VPQDISKRIVSNAIAPVITV +T ELD H+ + Y IDS 
Sbjct: 1   MTFTYENYMNLIFHLDKVHENVPQDISKRIVSNAIAPVITVTATVELDSHISEEYGIDSF 60

Query: 64  YLLMRYFGGCISDRDQANEYVKKANVENT--AQEGVNDQIIEEQR--------------- 106
           Y L+RYFGGCISDRDQ+NEY+KK   E    A   VN   IEE +               
Sbjct: 61  YTLLRYFGGCISDRDQSNEYIKKTEDEQKSHALNKVNLTTIEETKVKLNEDEKMEEELQS 120

Query: 107 -------------NSNTLE--------LPKSERYSR--SRSNSLFQRDSTQSHYIRFTKP 143
                        N+N L+        LPKS + +R  SRSNSLFQRDSTQS +IRFT+P
Sbjct: 121 DQNVINPTNDPTVNNNYLDVDTKTDNLLPKSSQTTRNRSRSNSLFQRDSTQSQFIRFTRP 180

Query: 144 IEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETDHKALKMSLFHRFFSSAISST 203
           IEDL+ S  + DMLFDYH+LE++L  CL +++K T D+ DHK L+ SL+HRFFSSAISST
Sbjct: 181 IEDLLYSGGTGDMLFDYHTLEIFLGSCLKMVEKYTTDDIDHKTLQKSLYHRFFSSAISST 240

Query: 204 TYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKNQNNAVEEFPPFMSTNDILLVF 263
             LSPYESFNHP++SL+A+DI+KGQNYE ARDLLI FKNQN  +  FP FMSTNDIL VF
Sbjct: 241 NCLSPYESFNHPIVSLIAIDITKGQNYELARDLLIAFKNQNTTINNFPIFMSTNDILPVF 300

Query: 264 LLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSHSEDVQVELHQPAMSSLDEML 323
           +LCY+G S E+ E   ++ KK+KKQLFAE + +PLW+K +S+D+ V+LHQPAMSSLDEML
Sbjct: 301 VLCYNGSSAEESEKSTELSKKIKKQLFAECIRMPLWDKRYSDDITVKLHQPAMSSLDEML 360

Query: 324 YFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRKISFWEETILQPRKSLFHGNKLF 383
           Y F+     +LPL LIN IYD +E L  DLMIPFMQRKI+FWEETILQP+KSLF G KLF
Sbjct: 361 YVFQTSKTDKLPLTLINLIYDQLEILTNDLMIPFMQRKITFWEETILQPKKSLFQGTKLF 420

Query: 384 RKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLLRKLADWSMMISDFKTAYSTYETL 443
           RKFM R S     Q N  +KD++GNEYF S+S  FLLRKLADWSMMISDFKTAY+T+E+L
Sbjct: 421 RKFMGRPSMTNGRQENIPIKDNQGNEYFASTSNVFLLRKLADWSMMISDFKTAYTTFESL 480

Query: 444 ISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKNDVNPLIERSLDTYEQCSILAQNS 503
           + D+E +PKYLASCLEWCA+ ILMGAQNIVT KMIKNDVNPLIERSLD Y  C++L  + 
Sbjct: 481 LEDIEMYPKYLASCLEWCAVCILMGAQNIVTTKMIKNDVNPLIERSLDVYGNCALLLNSI 540

Query: 504 LENDELL-SEPVRSYETRCMLLTSELFLSLNDTWTSTPYALSNLETILAECKLGICSQIM 562
            E++E   +EPVRSYETRCML+TSELFLSL+DTWTSTPYALSNLETIL+ECKLG CSQIM
Sbjct: 541 AESEESPDTEPVRSYETRCMLITSELFLSLSDTWTSTPYALSNLETILSECKLGACSQIM 600

Query: 563 IWERLSDCYNMRTDPRIRHRVET--VTKIENNEGGQQLQTDD---IVSKGXXXXXXXXXX 617
           IWERLSDCYN+RTDPR++H++ +   T   +    ++++  D   IV KG          
Sbjct: 601 IWERLSDCYNLRTDPRVKHKLRSNISTSSVSEVSEEEIKKQDVSSIVLKGLTRQRKASFF 660

Query: 618 XXXXXXXWAEQKQWRQVSWCLRDVEYIYDDLSFSKRPELIYQKLKDELNE 667
                  WAEQ QWRQVSWCL D+  +Y D  F KR  LIYQKLK  L E
Sbjct: 661 RLLAAKKWAEQHQWRQVSWCLNDISEMYQDTVFGKRESLIYQKLKRNLLE 710

>YDR108W Chr4 (671269..673365) [2097 bp, 698 aa] {ON}  TRS85Subunit
           of TRAPPIII (transport protein particle), a multimeric
           guanine nucleotide-exchange factor for Ypt1p, required
           for membrane expansion during autophagy and the CVT
           pathway; directs Ypt1p to the PAS; late post-replication
           meiotic role
          Length = 698

 Score =  823 bits (2127), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/677 (60%), Positives = 514/677 (75%), Gaps = 21/677 (3%)

Query: 6   FSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSLYL 65
           FSYE+YMNL++HLD   E VP +I+KRI+SNAIAPVITV ST   D+H+Q++Y +DSLY+
Sbjct: 3   FSYEHYMNLLFHLDNSKETVPPEIAKRIISNAIAPVITVTSTPLFDKHIQETYKVDSLYM 62

Query: 66  LMRYFGGCISDRDQANEYVKKANVENTAQE--GVNDQIIEEQRNSNTLELPK-SERYSRS 122
           L+R+FGGC+SDRDQANE    A V     E    +D      +N N LE+P  S++ SRS
Sbjct: 63  LLRFFGGCVSDRDQANE----AKVGQHEHEVCDASDSTDSIPKNKN-LEVPNLSKKGSRS 117

Query: 123 RSNSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDET 182
           RSNSLFQRDSTQS YIRFT+P+ DLI +RD++DMLF+YHSLEV+L+  L L+  NT++  
Sbjct: 118 RSNSLFQRDSTQSQYIRFTRPLGDLIETRDANDMLFNYHSLEVFLDNYLKLVAANTDEMV 177

Query: 183 DHKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKN 242
            H  LK S++H FFS AISST  LSPYE+FNHP++SL+ALDIS G+ YEDARDLL+ FKN
Sbjct: 178 PHNLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKN 237

Query: 243 QNNAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKS 302
            N+  E FP FM+TN++L VFLLCY+ DS+E+ E CQ + KKLKKQLF ES++L LW  S
Sbjct: 238 LNHNTENFPIFMNTNEMLPVFLLCYNDDSQEEFEKCQALAKKLKKQLFVESILLALWKDS 297

Query: 303 --HSEDVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQR 360
             + E+  ++LHQP MSSL+E+L+F + P+   L L LIN+IYD+++ LV DLMIPFM+R
Sbjct: 298 FIYDENSVIQLHQPVMSSLEEILFFLQAPTQTTLSLALINSIYDMLDYLVYDLMIPFMKR 357

Query: 361 KISFWEETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLL 420
           K+SFWEETILQPRKSLF+G K F+KFMN++     +Q+N++ +DS+GNEYF SSS EFL+
Sbjct: 358 KVSFWEETILQPRKSLFNGAKFFKKFMNKNPVNGNHQHNSLTRDSQGNEYFASSSSEFLM 417

Query: 421 RKLADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKN 480
           RKLADWSMM+SDFKTAYSTYE+L+ DL+A PKYLASC+EWCA+S+LMGAQ+IVT KMIKN
Sbjct: 418 RKLADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKN 477

Query: 481 DVNPLIERSLDTYEQCS-ILAQNSLENDEL-LSEPVRSYETRCMLLTSELFLSLNDTWTS 538
           D+NPLIER+L TYE CS I      E++ L ++EPVRSYETRCM+L SELFLSL++TWTS
Sbjct: 478 DINPLIERALATYENCSRIQRGKGKESNSLDVTEPVRSYETRCMILASELFLSLSNTWTS 537

Query: 539 TPYALSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHRVETVTK----IENNEG 594
           TPYA+  LETIL ECKLG CSQIM+WERLSDCYN+R DPRI+HRV  + K     E+  G
Sbjct: 538 TPYAIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRIKHRVGAMKKDAKDTEDLRG 597

Query: 595 GQQLQTD-----DIVSKGXXXXXXXXXXXXXXXXXWAEQKQWRQVSWCLRDVEYIYDDLS 649
             +  TD     DI+S+G                 WAEQKQWRQVSWCL+D+E  Y ++ 
Sbjct: 598 EHKYSTDHFTDEDILSEGLTRRRKAAFFRLIAAKKWAEQKQWRQVSWCLKDIESTYSEIK 657

Query: 650 FSKRPELIYQKLKDELN 666
           F     LI  KLK++LN
Sbjct: 658 FLHGNGLILSKLKNQLN 674

>Suva_2.268 Chr2 (465716..467803) [2088 bp, 695 aa] {ON} YDR108W
           (REAL)
          Length = 695

 Score =  820 bits (2119), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/679 (59%), Positives = 515/679 (75%), Gaps = 24/679 (3%)

Query: 6   FSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSLYL 65
           FSYE+YMNL++HLD   E VP +I+KRIVSNAIAPVITV ST   D+H+Q++Y++DSLY+
Sbjct: 3   FSYEHYMNLLFHLDHSRETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYSVDSLYM 62

Query: 66  LMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKS-ERYSRSRS 124
           L+R+FGGC+SDRDQANE   + + +N +        IE    +  L +P + +R SRSRS
Sbjct: 63  LLRFFGGCVSDRDQANEGKFEQDEQNASPS------IESSSKNQNLGVPSALKRGSRSRS 116

Query: 125 NSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETDH 184
           NSLFQRDSTQS Y+RFT+P+ DLI +RD++DMLF+YHSLEV+L+  L L+  NT+++  H
Sbjct: 117 NSLFQRDSTQSQYVRFTRPLGDLIETRDTNDMLFNYHSLEVFLDNYLKLVAGNTDEKVPH 176

Query: 185 KALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKNQN 244
             LK S++H FFS AISST  LSPYE+FNHP++SL+ALDIS G+ YEDARDLL+ FKN N
Sbjct: 177 DLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISYGEVYEDARDLLVNFKNLN 236

Query: 245 NAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSHS 304
           +  E FP FM+TN++L VFLLCY+ +S+E+ E CQ + KKLKKQLF ES++LPLW  S  
Sbjct: 237 HNTESFPIFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESILLPLWKDSFV 296

Query: 305 --EDVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRKI 362
             E+  ++LHQP MSSL+E+L+F   P+  +L L LIN+IYD+++ LV DLMIPFM+RKI
Sbjct: 297 DVENSNIQLHQPVMSSLEEILFFLRAPTQTKLSLPLINSIYDMLDYLVYDLMIPFMKRKI 356

Query: 363 SFWEETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLLRK 422
           SFWEETILQPRKSLF+G K F+KFMN++     +Q+N++ KD++GNEYF SSS EFL+RK
Sbjct: 357 SFWEETILQPRKSLFNGAKFFKKFMNKAPVNGNHQHNSLTKDNQGNEYFASSSSEFLMRK 416

Query: 423 LADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKNDV 482
           LADWSMM+SDFKTAYSTYE+L+ DL+A PKYLASC+EWCA+S+LMGAQ+IVT KMIKND+
Sbjct: 417 LADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDI 476

Query: 483 NPLIERSLDTYEQCSILAQNSLENDELLS----EPVRSYETRCMLLTSELFLSLNDTWTS 538
           NPLIER+L TYE CS + + +  + EL S    EPVRSYETRCM+L SELFLSL+DTWTS
Sbjct: 477 NPLIERALATYENCSRMQRRN--SKELTSSGVLEPVRSYETRCMILASELFLSLSDTWTS 534

Query: 539 TPYALSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHRV----ETVTKIENNEG 594
           TPYA+  LETIL ECKLG CSQIM+WERLSDCYN+R DPR++H+V    ++V   E+   
Sbjct: 535 TPYAIQYLETILDECKLGPCSQIMVWERLSDCYNLRVDPRVKHKVGGMKKSVKNTEDLRN 594

Query: 595 GQQLQTD-----DIVSKGXXXXXXXXXXXXXXXXXWAEQKQWRQVSWCLRDVEYIYDDLS 649
             +  TD     DI+S+G                 WAEQKQWRQVSWCL+D+E  Y D+ 
Sbjct: 595 DDEYDTDHFTEEDILSEGLTRRRKAAFFRLMAAKKWAEQKQWRQVSWCLKDIENTYSDID 654

Query: 650 FSKRPELIYQKLKDELNEE 668
           F     LI   LK++LN +
Sbjct: 655 FLHGNGLILSNLKNQLNSK 673

>ZYRO0C01826g Chr3 complement(143874..145973) [2100 bp, 699 aa] {ON}
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 699

 Score =  819 bits (2116), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/685 (58%), Positives = 508/685 (74%), Gaps = 25/685 (3%)

Query: 4   LQFSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSL 63
           ++ SYENYMNL++HLD   E VP DI++RIVSNA++PVITV ST ELD+H++D+Y++DSL
Sbjct: 1   MKLSYENYMNLLFHLDHGQETVPPDIARRIVSNAVSPVITVSSTPELDRHIRDTYHLDSL 60

Query: 64  YLLMRYFGGCISDRDQANEYV---KKANVENTAQEGVN-DQIIEEQRNSNTLELPKSERY 119
           Y+ +R+FG C+SDRDQANEY     K   E  A+     D +IE  R S +L++P +   
Sbjct: 61  YMFLRFFGDCVSDRDQANEYQPLRSKEEPELVAEPPSKADNLIENSRKS-SLKVPSTSSD 119

Query: 120 S--------------RSRSNSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEV 165
           +              R RSNSLFQRD TQS Y+RFT+PI+DLI S DS+DMLFDYHSLEV
Sbjct: 120 TKNTTTSTSGTTGGTRKRSNSLFQRDQTQSQYVRFTRPIDDLIESSDSNDMLFDYHSLEV 179

Query: 166 YLEKCLSLIDKNTNDETDHKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDIS 225
           +LE  L L+++ T+D T  + LK SL+H+FFS AISSTTYLSPYE+FNHP++SL+A+DIS
Sbjct: 180 FLENTLRLVEEYTDDNTPFELLKKSLYHKFFSLAISSTTYLSPYETFNHPVVSLIAIDIS 239

Query: 226 KGQNYEDARDLLIKFKNQNNAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKL 285
            GQ YE+ARDLLIKFKN N+ VE FP FMST DIL VFLLCY+ +SE+++  CQ +  +L
Sbjct: 240 AGQGYEEARDLLIKFKNLNHTVENFPIFMSTGDILPVFLLCYNDESEDEQNACQQLANQL 299

Query: 286 KKQLFAESLMLPLWNKSHSEDVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDL 345
           KKQLF ESL+LPLW +S+S+  +VELHQP MSSL+EMLYF + P+   LPL LIN  Y++
Sbjct: 300 KKQLFVESLLLPLWKRSYSDHGEVELHQPIMSSLEEMLYFLQSPTPTRLPLQLINVTYNI 359

Query: 346 MEKLVVDLMIPFMQRKISFWEETILQPRKSLFHGNKLFRKFMNRSSSQTAN-QYNNIVKD 404
           +EKLV DLM+PFM+RKISFWEETILQPRKSLFHG   F+K M+++S+ + N Q  ++ KD
Sbjct: 360 LEKLVKDLMVPFMKRKISFWEETILQPRKSLFHGANFFKKLMSKNSNGSNNHQPISLGKD 419

Query: 405 SRGNEYFTSSSPEFLLRKLADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAIS 464
             GNEYF +SS EFL+RKLADWSMM+SDFKTAYSTYE+L+ DLE  PKYLASC EWCA+S
Sbjct: 420 KNGNEYFVASSTEFLMRKLADWSMMLSDFKTAYSTYESLVHDLENFPKYLASCFEWCAVS 479

Query: 465 ILMGAQNIVTAKMIKNDVNPLIERSLDTYEQCSILAQNSLENDELLSEPVRSYETRCMLL 524
           +LMGAQNIVT KMIKND++PLI+R+L+TYE C   A +     E L  PVRSYETRCM L
Sbjct: 480 VLMGAQNIVTVKMIKNDIDPLIQRALETYENC---AADEDSTGEELYVPVRSYETRCMFL 536

Query: 525 TSELFLSLNDTWTSTPYALSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHR-- 582
            SELFLSL+DTWTSTPYAL++LETIL EC+LG CS+IMIWERLSDCY  R DPRIRH+  
Sbjct: 537 ASELFLSLSDTWTSTPYALNSLETILTECRLGPCSEIMIWERLSDCYYQRIDPRIRHKTS 596

Query: 583 VETVTKIENNEGGQQLQTDDIVSKGXXXXXXXXXXXXXXXXXWAEQKQWRQVSWCLRDVE 642
            +    + +     +   ++IV++G                 W EQKQW+Q  WCL+++E
Sbjct: 597 AQGAKAMTDELAPDEESNEEIVTRGLTRKRKAAFFRLIAANKWVEQKQWKQAFWCLKEIE 656

Query: 643 YIYDDLSFSKRPELIYQKLKDELNE 667
             Y  L F  R +LI  +LK ++NE
Sbjct: 657 EAYAGLDFVNREDLILARLKRQMNE 681

>Skud_4.369 Chr4 (642869..644965) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  819 bits (2115), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/677 (59%), Positives = 518/677 (76%), Gaps = 21/677 (3%)

Query: 6   FSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSLYL 65
           FSYE+YMNL++HLD   E VP +I+KRIVSNAIAPVITV ST   D+H+Q++YN+DSLY+
Sbjct: 3   FSYEHYMNLLFHLDNSEEIVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQETYNVDSLYM 62

Query: 66  LMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKS-ERYSRSRS 124
           L+R+FGGC+SDRDQANE     N    +   V+ + + + +N   L +P + ++ SRSRS
Sbjct: 63  LLRFFGGCVSDRDQANEGKVGPNEHEVSDTSVSMESLSKNQN---LGVPNALKKGSRSRS 119

Query: 125 NSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETDH 184
           NSLFQRDSTQS YIRFT+P+ DLI +RD++DMLF+YHSLEVYL+  L L+ +NTN+   H
Sbjct: 120 NSLFQRDSTQSQYIRFTRPLGDLIETRDTNDMLFNYHSLEVYLDNYLKLVTENTNETAPH 179

Query: 185 KALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKNQN 244
             LK S++H FFS AISST  LSPYE+FNHP++SL+ALDIS G+ YEDARDLL+ FKN N
Sbjct: 180 DLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLN 239

Query: 245 NAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSH- 303
           +  E FP FM+TN++L VFL+CY+ +S+E+ E CQ + KKLKKQLF ES+ LPLW +S  
Sbjct: 240 HNTENFPIFMNTNEMLPVFLICYNDESQEEFEKCQALAKKLKKQLFVESIFLPLWKESFI 299

Query: 304 -SEDVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRKI 362
             E+  ++LHQP MSSL+E+L+F + P+   L L LIN+IYD+++ LV DLMIPFM+RK+
Sbjct: 300 DDENSSIKLHQPVMSSLEEILFFLQAPTQTTLSLPLINSIYDILDYLVYDLMIPFMKRKV 359

Query: 363 SFWEETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLLRK 422
           SFWEETILQPRKSLF+G K F+KFMN++ +  ++Q+N++ +D +GNEYF+SSS EFL+RK
Sbjct: 360 SFWEETILQPRKSLFNGAKFFKKFMNKNPANGSHQHNSLTRDRQGNEYFSSSSSEFLMRK 419

Query: 423 LADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKNDV 482
           LADWSMM+SDFKTAYSTYE+L+ DL+A PKYLASC+EWCA+S+LMGAQ+IVT KMIKND+
Sbjct: 420 LADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQSIVTVKMIKNDI 479

Query: 483 NPLIERSLDTYEQCSILAQNSLENDEL----LSEPVRSYETRCMLLTSELFLSLNDTWTS 538
           NPLIER+L TYE+CS + ++  +  EL    ++EPVRSYETRCM+L SELFLSL+DTWTS
Sbjct: 480 NPLIERALATYEKCSQIQRH--KGKELSSSSVTEPVRSYETRCMILASELFLSLSDTWTS 537

Query: 539 TPYALSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHRVETVTK----IENNEG 594
           TPYA+  LETIL ECKLG CSQIMIWERLSDCYN+R DPRI+HRV  + K     E+   
Sbjct: 538 TPYAIQYLETILDECKLGPCSQIMIWERLSDCYNLRVDPRIKHRVGVMKKSFKETEDLRN 597

Query: 595 GQQLQTD-----DIVSKGXXXXXXXXXXXXXXXXXWAEQKQWRQVSWCLRDVEYIYDDLS 649
           G +  TD     DI+S+G                 WAEQK WRQVSWCL+D+E  Y ++ 
Sbjct: 598 GDEHYTDHFIEEDILSEGLTRRRKAAFFRLIAAKKWAEQKHWRQVSWCLKDIESTYSEIK 657

Query: 650 FSKRPELIYQKLKDELN 666
           F    + I  KLK +LN
Sbjct: 658 FLHCNDSILSKLKSQLN 674

>TDEL0F03820 Chr6 (699240..701303) [2064 bp, 687 aa] {ON} Anc_8.255
           YDR108W
          Length = 687

 Score =  818 bits (2112), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/670 (59%), Positives = 502/670 (74%), Gaps = 18/670 (2%)

Query: 4   LQFSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSL 63
           ++ SYENYMNL+ HLD  ++ VP DI+KRIVSNAI+PVI V ST ELD+H+Q+++++DSL
Sbjct: 2   VKLSYENYMNLLLHLDHGDDRVPADIAKRIVSNAISPVICVTSTPELDRHIQETHHLDSL 61

Query: 64  YLLMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYSRSR 123
           Y+L+R+FG C+ DRDQA+E        +      +D+   E+ +S+TL +      SR R
Sbjct: 62  YMLLRFFGDCVGDRDQAHE------CTSAGSPSGDDR--AEKSSSSTLAVASGP--SRKR 111

Query: 124 SNSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETD 183
           SNSLFQRD+TQS YIRFT+P+ DL+ S D++DMLFDYH+LE +LE  L LI+K+TND+T 
Sbjct: 112 SNSLFQRDATQSQYIRFTRPLRDLVESADTNDMLFDYHTLESFLENILLLIEKSTNDKTP 171

Query: 184 HKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKNQ 243
           HK LK SL+HRFFS AISST YLSPYE+FNHP++SL+ALDI  GQ YE+ARDLL KFKN 
Sbjct: 172 HKLLKKSLYHRFFSLAISSTAYLSPYETFNHPVVSLIALDIPIGQGYEEARDLLTKFKNL 231

Query: 244 NNAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSH 303
           N+  + FP F++TND+L VFLLCY+GDSEEQ EICQ + KKLKKQLF E ++LPLW  ++
Sbjct: 232 NHTTKNFPVFLNTNDVLPVFLLCYNGDSEEQYEICQSLTKKLKKQLFVEGILLPLWKDNY 291

Query: 304 SEDVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRKIS 363
               QV LHQP M+SLDE+LYF   PS  EL L LIN+IYD++E L+  LMIPFMQRKIS
Sbjct: 292 KTATQVILHQPIMTSLDEVLYFLREPSRIELSLELINSIYDVLEILINGLMIPFMQRKIS 351

Query: 364 FWEETILQPRKSLFHGNKLFRKFMNRSSSQT-ANQYNNIVKDSRGNEYFTSSSPEFLLRK 422
           FWEETILQPR+SLFHG+K  ++FM++++S T  +Q  +I KD+ G EYF SSS EFL+RK
Sbjct: 352 FWEETILQPRRSLFHGSKFLKRFMSKTTSGTNIHQQASIAKDANGKEYFVSSSAEFLMRK 411

Query: 423 LADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKNDV 482
           LADWSMM+SD+KTAYSTY++L  DLE +PKYLASCLEWC++S+LMGAQNIVTAKM+K D+
Sbjct: 412 LADWSMMLSDYKTAYSTYDSLSHDLEHYPKYLASCLEWCSVSVLMGAQNIVTAKMLKTDI 471

Query: 483 NPLIERSLDTYEQCSIL-AQNSLENDELLSEPVRSYETRCMLLTSELFLSLNDTWTSTPY 541
           +PLI+R+++TYE C++   Q S         PVRSYETRCM L SELFLSL+DTWTSTPY
Sbjct: 472 DPLIQRAVETYENCALYDTQLSGSKKSNSMAPVRSYETRCMFLASELFLSLSDTWTSTPY 531

Query: 542 ALSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHRVETVT-----KIENNEGGQ 596
           AL NLETILAEC+LG CSQIMIWERLS+CY  R D RIRH+V         K+EN +  +
Sbjct: 532 ALRNLETILAECRLGPCSQIMIWERLSNCYQQRIDHRIRHKVNDGAMSNEEKVENEDDSE 591

Query: 597 QLQTD-DIVSKGXXXXXXXXXXXXXXXXXWAEQKQWRQVSWCLRDVEYIYDDLSFSKRPE 655
           +  T  DIV++G                 WAEQKQWRQ SWCL+D E  Y  + F  R +
Sbjct: 592 KEHTHADIVTRGLTRMRKAAFFQLIAANKWAEQKQWRQASWCLKDTEDAYAGIEFVNRKD 651

Query: 656 LIYQKLKDEL 665
           L   KLK+ L
Sbjct: 652 LALAKLKETL 661

>Smik_4.354 Chr4 (632598..634694) [2097 bp, 698 aa] {ON} YDR108W
           (REAL)
          Length = 698

 Score =  816 bits (2108), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/675 (59%), Positives = 509/675 (75%), Gaps = 17/675 (2%)

Query: 6   FSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSLYL 65
           FSYE+YMNL++HLD   E VP +I+KRIVSNAIAPVITV ST   D+H+Q++Y +DSLY+
Sbjct: 3   FSYEHYMNLLFHLDNSKETVPPEIAKRIVSNAIAPVITVTSTPLFDKHIQEAYKVDSLYM 62

Query: 66  LMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPK-SERYSRSRS 124
           L+R+FGGC+SDRDQANE VK    E+  Q G  +  +E    S  LE+P   ++ SRSRS
Sbjct: 63  LLRFFGGCVSDRDQANE-VKVGQDEH--QVGDTNASMESFSKSKNLEVPNLPKKGSRSRS 119

Query: 125 NSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETDH 184
           NSLFQRDSTQS YIRFT+P++DLI +RD++DMLF+YHSLEV+L+  L L+  NT++   H
Sbjct: 120 NSLFQRDSTQSQYIRFTRPLDDLIETRDTNDMLFNYHSLEVFLDNYLKLVADNTDEMVPH 179

Query: 185 KALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKNQN 244
             LK S++H FFS AISST  LSPYE+FNHP++SL+ALDIS G+ YEDARDLL+ FKN N
Sbjct: 180 DLLKKSIYHSFFSLAISSTNNLSPYETFNHPILSLIALDISNGEVYEDARDLLVNFKNLN 239

Query: 245 NAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSHS 304
           +  E FP FM+TN++L VFLLCY+ +S+E+ E CQ + KKLKKQLF ES++L LW  S  
Sbjct: 240 HNTENFPLFMNTNEMLPVFLLCYNDESQEEFEKCQALAKKLKKQLFVESVLLSLWKDSFI 299

Query: 305 E--DVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRKI 362
           E  +  ++LHQP MSSL+E+L+F + P+   L L LIN+IYD+++ LV DLMIPFM+RK+
Sbjct: 300 EANNSAIQLHQPVMSSLEEILFFLQAPTQTSLSLPLINSIYDMLDYLVYDLMIPFMKRKV 359

Query: 363 SFWEETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLLRK 422
           SFWEETILQPRKSLF+G K F+KFMN++ S   + +N++  D++GNEYF SSS EFL+RK
Sbjct: 360 SFWEETILQPRKSLFNGAKFFKKFMNKNPSNGNHHHNSLTSDNQGNEYFASSSSEFLMRK 419

Query: 423 LADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKNDV 482
           LADWSMM+SDFKTAYSTYE+L+ DL+A PKYLASC+EWCA+S+LMGAQ IVT KMIKND+
Sbjct: 420 LADWSMMLSDFKTAYSTYESLMDDLDAFPKYLASCIEWCAVSLLMGAQRIVTVKMIKNDI 479

Query: 483 NPLIERSLDTYEQCSILAQNSLENDELLS--EPVRSYETRCMLLTSELFLSLNDTWTSTP 540
           NPLIE++L TYE CS + ++  E     +  EPVRSYETRCM+L SELFLSL+D WTSTP
Sbjct: 480 NPLIEKALATYENCSKIQRSKSEKSSSSNTVEPVRSYETRCMILASELFLSLSDKWTSTP 539

Query: 541 YALSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHRVETVTK----IENNEGGQ 596
           YA+  LETIL ECKLG C QIMIWERLSDCY++R DPRI+HRV  + K     E+  GG 
Sbjct: 540 YAIQYLETILDECKLGPCCQIMIWERLSDCYSLRVDPRIKHRVGAMKKGIRDTEDLRGGD 599

Query: 597 QLQT-----DDIVSKGXXXXXXXXXXXXXXXXXWAEQKQWRQVSWCLRDVEYIYDDLSFS 651
              T     DDI+S+G                 WAEQKQWRQVSWCL+D+E IY D+ F 
Sbjct: 600 GNSTDHFTDDDILSEGLTRKRKAAFFRLIAARKWAEQKQWRQVSWCLKDIESIYSDIKFL 659

Query: 652 KRPELIYQKLKDELN 666
               LI  KL ++LN
Sbjct: 660 NGDGLILSKLHNQLN 674

>NCAS0B03880 Chr2 complement(691369..693489) [2121 bp, 706 aa] {ON}
           Anc_8.255 YDR108W
          Length = 706

 Score =  803 bits (2073), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/698 (56%), Positives = 502/698 (71%), Gaps = 55/698 (7%)

Query: 4   LQFSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSL 63
           + FSYE+YMNL++HLD   E VP +I+KRIVSNAI+PVI V STSELD H+ ++YNIDSL
Sbjct: 1   MNFSYEHYMNLLFHLDYGKETVPSEIAKRIVSNAISPVIAVTSTSELDHHILETYNIDSL 60

Query: 64  YLLMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLE----LPKSERY 119
           Y+L+R+F GC+SDRDQANE      +E + ++ ++        N+ TL     LPK    
Sbjct: 61  YMLLRFFSGCVSDRDQANE------LEKSQKDKIS------SNNTLTLPTTSPLPKVRTR 108

Query: 120 SRSRSNSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTN 179
            RSRSNSLFQRDSTQS YIRFTKP+ D+I +++++DMLFDYHSLE+YL+  L LI KNT+
Sbjct: 109 GRSRSNSLFQRDSTQSQYIRFTKPLGDVIATKNANDMLFDYHSLEIYLQNYLDLIQKNTD 168

Query: 180 DETDHKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIK 239
           D T ++ LK S++H FFS AISSTT LSPYE FNHP++SL+A+DIS GQNY+D RDLL+ 
Sbjct: 169 DNTPYELLKKSIYHSFFSLAISSTTILSPYECFNHPVVSLIAVDISLGQNYDDVRDLLVD 228

Query: 240 FKNQNNAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLW 299
           FKN N++   FP FM+TND+L V LLCYD    EQ E CQ + KK+KKQLF E + LPLW
Sbjct: 229 FKNLNSSTHNFPIFMNTNDMLPVVLLCYDDQFIEQFETCQALTKKIKKQLFVECISLPLW 288

Query: 300 NKSHSEDVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQ 359
             S+  D QV LHQP MSSL+EM+YF  +P    LP  LI +IY++++ LV +LMIPFM+
Sbjct: 289 KDSYPSDPQVHLHQPVMSSLEEMIYFLNQPKEVTLPYELIQSIYNILDSLVYNLMIPFMK 348

Query: 360 RKISFWEETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFL 419
           RKI+FW+ETILQPRKSLFHG K  +KFM +++    +Q N + KD++GNEYFTS+S EFL
Sbjct: 349 RKIAFWDETILQPRKSLFHGAKFLKKFMTKTA--LTHQENLLTKDAQGNEYFTSASSEFL 406

Query: 420 LRKLADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIK 479
           +RKLADWSMM+SDFKTAY+TYE+L  DLE+ PKY ASCLEWCA+S+LMGAQNIVT KM+K
Sbjct: 407 MRKLADWSMMLSDFKTAYATYESLTHDLESFPKYSASCLEWCAVSLLMGAQNIVTVKMLK 466

Query: 480 NDVNPLIERSLDTYEQCS-ILAQNSLEN-DELLSEPVRSYETRCMLLTSELFLSLNDTWT 537
           ND+NPLIE++L TYE C+ +L +    N DEL+  PVRSYETRCM+L SELFLSL+DTWT
Sbjct: 467 NDINPLIEKALSTYENCATVLPETDKRNTDELIVVPVRSYETRCMILASELFLSLSDTWT 526

Query: 538 STPYALSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHRV-------------- 583
           STPYA+S LETIL ECKLG CSQIMIWERLSDCY +R DPRI+H+               
Sbjct: 527 STPYAISYLETILVECKLGACSQIMIWERLSDCYELRVDPRIKHKAAGTIANTSSPKKSS 586

Query: 584 ----------------ETVTKIENNEGGQQLQTDDIVSKGXXXXXXXXXXXXXXXXXWAE 627
                           E V+   NN+  Q     DIVSKG                 WAE
Sbjct: 587 ESDMQGHVMTPSPLTKEDVSNDANNDTDQ-----DIVSKGFTRKRKAAFFRLMAAKKWAE 641

Query: 628 QKQWRQVSWCLRDVEYIYDDLSFSKRPELIYQKLKDEL 665
           QK+WRQVSWCL+ ++  Y  +  + R +LI +K++++L
Sbjct: 642 QKRWRQVSWCLQSIDDTYSKIGLADRDDLILKKIQNKL 679

>NDAI0J01410 Chr10 complement(323873..326023) [2151 bp, 716 aa] {ON}
           Anc_8.255 YDR108W
          Length = 716

 Score =  800 bits (2067), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/696 (57%), Positives = 506/696 (72%), Gaps = 31/696 (4%)

Query: 6   FSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSLYL 65
           FSYE+YMNL++HLD   E VP +I+KRIVSNAIAPVITV ST +LD H+Q++YNIDSLY+
Sbjct: 3   FSYEHYMNLLFHLDHAKESVPPEIAKRIVSNAIAPVITVTSTPQLDNHIQETYNIDSLYM 62

Query: 66  LMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYSRSRSN 125
           L+RYFGGC+SDRDQANE V K  ++ T     ++ +      S   + P   R  RSRSN
Sbjct: 63  LLRYFGGCVSDRDQANELVGKQELDVTHPTNPSNPVSSLIVPSGQQQPPLKARRGRSRSN 122

Query: 126 SLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETDHK 185
           SLFQRDSTQS YIRFTKPI+D++  + S+DMLFDYHSLE+YLE+ L LI  NTN+ T ++
Sbjct: 123 SLFQRDSTQSQYIRFTKPIDDIVAIKSSNDMLFDYHSLEIYLEQYLQLIATNTNNSTPYE 182

Query: 186 ALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKNQNN 245
            LK S++H FFS AISSTT LSPYE+FNHP++SL+A+DIS GQ Y+D RDLL++FKN N 
Sbjct: 183 LLKNSIYHNFFSLAISSTTQLSPYETFNHPIVSLIAVDISMGQTYDDIRDLLVEFKNLNT 242

Query: 246 AVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSHSE 305
               FP FM+TND+L +FLLCYD + +EQ EICQ + K+LKKQLF ESL+LPLWN+ +  
Sbjct: 243 TTPNFPIFMNTNDMLPIFLLCYDANYQEQFEICQSLTKRLKKQLFVESLILPLWNEQYEI 302

Query: 306 DVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRKISFW 365
           D++V+LHQP MSSL+EM+YF + P   +L ++LIN+IY++++ L+ DLM+PFM+RK+ FW
Sbjct: 303 DIKVDLHQPIMSSLEEMIYFLQTPFSAKLSISLINSIYNILDSLIYDLMLPFMKRKLLFW 362

Query: 366 EETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLLRKLAD 425
           EETILQPR+SLFHG K  +KFM ++++    Q N + KDS GNEYF  SS E L+RKLAD
Sbjct: 363 EETILQPRRSLFHGAKFLKKFMTKNNN--GPQENILTKDSEGNEYFAFSSTELLMRKLAD 420

Query: 426 WSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKNDVNPL 485
           WSMMISDFKTAYSTYE+L  DL+  PKYLASCLEWCA S+LMGAQ+IVT KMIKND+NPL
Sbjct: 421 WSMMISDFKTAYSTYESLSRDLDTFPKYLASCLEWCATSLLMGAQSIVTVKMIKNDINPL 480

Query: 486 IERSLDTYEQCSILAQNSLEND---ELLSEPVRSYETRCMLLTSELFLSLNDTWTSTPYA 542
           IER+L TYE C+I       N    E   EP+RSYETRCM+L SELFLSL+DTWTSTPYA
Sbjct: 481 IERALQTYENCAITLIQDTTNKVFAEQSVEPLRSYETRCMILLSELFLSLSDTWTSTPYA 540

Query: 543 LSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHRV---------------ETVT 587
           ++ LETIL ECKLG CSQI IWERLSDCY +R DPRIR+++               + V 
Sbjct: 541 ITYLETILTECKLGPCSQIQIWERLSDCYKLRIDPRIRYKINDTATTTTTVTTTTADKVV 600

Query: 588 KIENNEGGQQLQTD-----------DIVSKGXXXXXXXXXXXXXXXXXWAEQKQWRQVSW 636
              + +  + +Q +           +I+SKG                 WAEQKQWRQV+W
Sbjct: 601 ATPSTDKPKTIQWESDLESKLGSGKNILSKGFTRRRKSAFFRLIAAKKWAEQKQWRQVAW 660

Query: 637 CLRDVEYIYDDLSFSKRPELIYQKLKDELNEERQGN 672
           CL+D+E IYD     KR +LI  KL++ L+E   G+
Sbjct: 661 CLKDMESIYDATDLGKRDDLIVAKLRNLLDENIGGD 696

>CAGL0B01705g Chr2 (157245..159263) [2019 bp, 672 aa] {ON} highly
           similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108w GSG1
          Length = 672

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/674 (56%), Positives = 502/674 (74%), Gaps = 15/674 (2%)

Query: 6   FSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSLYL 65
           FSYE+YMNL+YHLD  NE VP DI+KR+VSNA+APVITV ST  LD+H++++Y IDSLY+
Sbjct: 3   FSYEHYMNLIYHLDDANETVPSDIAKRVVSNAMAPVITVTSTVLLDRHIEETYGIDSLYM 62

Query: 66  LMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYSRSRSN 125
           L+R+FGGC+SDRDQANE     +     +EGV +    E+  +N L +P+  R  RS SN
Sbjct: 63  LLRFFGGCVSDRDQANEVKLGTDGLKVTEEGVEN----EKDGTNGLTVPRQTRV-RSNSN 117

Query: 126 SLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETDHK 185
           SL+QRD+TQS Y+RFTKP+ DLIN++D++DMLFDYHSLEVYL++ LS++DK  +    H 
Sbjct: 118 SLYQRDATQSQYVRFTKPLADLINTQDANDMLFDYHSLEVYLQEYLSVVDKKFSPHIPHH 177

Query: 186 ALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKNQNN 245
            LK S++H FF+ AISST+ LSP+E FNHP++SL+A+DI++ ++YE A + L +FK+ NN
Sbjct: 178 LLKTSIYHSFFALAISSTSKLSPFECFNHPIVSLLAIDITRNEDYETAAEQLKEFKSMNN 237

Query: 246 AVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSHSE 305
            +  FP F++TNDIL VFLLCY+ D+E + E CQ +  KLKKQLF ES++LPLW+   ++
Sbjct: 238 NIPSFPSFINTNDILPVFLLCYNKDNETEFEECQTLAGKLKKQLFVESIILPLWSTEFTD 297

Query: 306 DVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRKISFW 365
           ++ V LHQP MSS++E+++F + P  H+LPL L+N IYD ++ +V DLM PFM+RK++FW
Sbjct: 298 NLVVSLHQPVMSSIEEIMFFLQNPVDHKLPLKLVNCIYDQIDMIVYDLMKPFMKRKMTFW 357

Query: 366 EETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLLRKLAD 425
           EETIL PRKSLFHG K F+KFMN+ S+Q  +Q N+++K++ G+ Y +S+SPEFL+RKLAD
Sbjct: 358 EETILTPRKSLFHGAKFFKKFMNK-STQALSQPNSLLKENHGSNYLSSTSPEFLMRKLAD 416

Query: 426 WSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKNDVNPL 485
           WSMM+SDFKTAY+TYE+L  D E  PKYLASC EWCA+S+LMGAQNIVTAKM+KN++NP 
Sbjct: 417 WSMMVSDFKTAYTTYESLCQDFERMPKYLASCSEWCAVSLLMGAQNIVTAKMLKNEINPA 476

Query: 486 IERSLDTYEQCSIL--AQNSLENDELLSEPVRSYETRCMLLTSELFLSLNDTWTSTPYAL 543
           IER+L  YE C+    A     + + LS PVRSYETRCM L SELFLSL+DTWTSTP+A+
Sbjct: 477 IERALGAYELCATESNAHRKFGDSDDLSAPVRSYETRCMFLASELFLSLSDTWTSTPFAI 536

Query: 544 SNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHRV---ETVTKIENN----EGGQ 596
           + LETIL ECKLG  S+IMIWERLSDCY MR DPRI+HR+   E + K E N    +   
Sbjct: 537 AYLETILNECKLGPLSEIMIWERLSDCYGMRIDPRIKHRIGNLELLQKKEENMDDPKNAD 596

Query: 597 QLQTDDIVSKGXXXXXXXXXXXXXXXXXWAEQKQWRQVSWCLRDVEYIYDDLSFSKRPEL 656
              T+DI+SKG                 W EQKQWR++SWCL D+E  Y DL    +  L
Sbjct: 597 VFTTEDILSKGLTRNRKAALFKLIAARKWCEQKQWRELSWCLDDLESTYSDLKCFNKENL 656

Query: 657 IYQKLKDELNEERQ 670
           +Y +L++EL   RQ
Sbjct: 657 LYTRLRNELIAARQ 670

>KAFR0B05570 Chr2 complement(1140432..1142441) [2010 bp, 669 aa]
           {ON} Anc_8.255 YDR108W
          Length = 669

 Score =  738 bits (1906), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/681 (54%), Positives = 491/681 (72%), Gaps = 38/681 (5%)

Query: 4   LQFSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSL 63
           + FSYE+YMNL++HL+  +E +P +I++RIVS+AIAPVITV ST ELD+H+QD+Y+IDSL
Sbjct: 2   INFSYEHYMNLLFHLECSDENIPSEIARRIVSHAIAPVITVTSTPELDKHIQDTYSIDSL 61

Query: 64  YLLMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYSRSR 123
           Y+L+R+FGGC+SDRDQA+E   KAN  +++      +                   +RSR
Sbjct: 62  YMLLRFFGGCVSDRDQASE--SKANAPHSSSSLTTTKTTR----------------ARSR 103

Query: 124 SNSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETD 183
           SNSLFQRDSTQS YIRFT+P+ DL+   D +DMLFD+HSLE YL + L L++K T D T 
Sbjct: 104 SNSLFQRDSTQSQYIRFTRPLPDLVERHDKNDMLFDHHSLESYLRQYLELVEKFTFDSTS 163

Query: 184 HKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKNQ 243
           H+ LK SL+H FFS AISSTT LSP+ESFNHP++SL+ALDI+  Q+YEDA+ LLIKFKN 
Sbjct: 164 HQLLKKSLYHNFFSLAISSTTTLSPFESFNHPIMSLIALDITNSQSYEDAKGLLIKFKNL 223

Query: 244 NNAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSH 303
           +N +++FP +++T D+L VFLLCY+ DS E+ + C+++  K+KKQLF ES+ LPLW  S+
Sbjct: 224 HNTIDKFPIYINTYDMLPVFLLCYNADSPEEVQQCEELSVKIKKQLFVESISLPLWKNSY 283

Query: 304 SEDVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRKIS 363
             +  ++LHQP MSSLDEM+YF +    + LP+ L NT YD++EKLV  L+IPFMQRKI+
Sbjct: 284 QTEPFIKLHQPVMSSLDEMIYFLQSDEQNTLPIELTNTTYDMLEKLVYALLIPFMQRKIA 343

Query: 364 FWEETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLLRKL 423
           FWEET+LQP+KS+FHG+K  +K M+R+S+ +  Q N + KD  GNEYF SSSPE LLRKL
Sbjct: 344 FWEETVLQPKKSIFHGSKFLKKLMSRASTSSHQQQNILTKDHDGNEYFASSSPELLLRKL 403

Query: 424 ADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKNDVN 483
           ADWS+M+SDFKT Y+TYE L  DLE  PKYLASCLEW A+S+LMGAQNIVT KM+KND++
Sbjct: 404 ADWSIMLSDFKTGYATYEILSHDLELFPKYLASCLEWEAVSLLMGAQNIVTVKMMKNDIS 463

Query: 484 PLIERSLDTYEQCSILAQNSLENDELLS-------EPVRSYETRCMLLTSELFLSLNDTW 536
           PLI+R+LD Y+ C+  A   L N ++         EPV SYETRC++L+SELFLSL+DTW
Sbjct: 464 PLIDRALDAYDACA--ANTHLSNKKIGPTNESTSLEPVLSYETRCLILSSELFLSLSDTW 521

Query: 537 TSTPYALSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHRVETVTKIENNE--- 593
           TSTPYA++ LE+IL E +LG CS+IMIWERLSDCY++R DPRI+ +VE V K +N E   
Sbjct: 522 TSTPYAINYLESILEESRLGPCSRIMIWERLSDCYDLRVDPRIKSKVEQVQKQDNLEEPA 581

Query: 594 --------GGQQLQTDDIVSKGXXXXXXXXXXXXXXXXXWAEQKQWRQVSWCLRDVEYIY 645
                       L   +IVS+G                 WAEQ QW+QV WCL ++  IY
Sbjct: 582 DNEHRILNSQDDLNPSNIVSQGLTRKRKAAFFRLLAAKMWAEQGQWKQVKWCLDNITDIY 641

Query: 646 DDLSFSKRPELIYQKLKDELN 666
             +    R +LI  +L++E N
Sbjct: 642 SRVGLVNRDDLILTRLREEYN 662

>KLTH0G13860g Chr7 complement(1201656..1203782) [2127 bp, 708 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 708

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 346/721 (47%), Positives = 471/721 (65%), Gaps = 85/721 (11%)

Query: 4   LQFSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSL 63
           +  S+  YMNL +HLD   EPVP +IS++IVS+A++PV+TV ST+ LD+H+Q+SY +DSL
Sbjct: 1   MPLSFGKYMNLAFHLDSALEPVPTEISRKIVSSAVSPVVTVTSTAALDEHIQESYGVDSL 60

Query: 64  YLLMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYSRSR 123
           Y+L+RYFG C+SDRDQA     +A  E   + G N       RN             R+R
Sbjct: 61  YMLLRYFGDCVSDRDQA-----EAGPELGTESGKN-------RN-------------RAR 95

Query: 124 SNSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETD 183
           SNSLFQR +  SHY+RFT+P+ DLI+ R+S D+LFDYHSLEV+LEK LSL++ NT  +T 
Sbjct: 96  SNSLFQRQA--SHYLRFTRPLTDLIDVRESRDLLFDYHSLEVFLEKYLSLVEANTTSDTP 153

Query: 184 HKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKNQ 243
           H  L+ S++H+FF++AISST +LSPYESFNHP+ SL+ALDISK Q YE+ARDLLI FKN 
Sbjct: 154 HTLLQHSIYHKFFTTAISSTAHLSPYESFNHPVASLLALDISKDQGYEEARDLLIAFKNM 213

Query: 244 NNAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSH 303
           +N    FP F++ NDIL VFLLCY+ DS EQ E+CQ + K +KKQLF ESL+LP W ++ 
Sbjct: 214 HNTTPHFPAFINVNDILPVFLLCYEEDSREQFELCQSLSKTIKKQLFVESLLLPCWGQNI 273

Query: 304 SEDVQVE--LHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRK 361
           +        LHQP MSSL+E +Y   + S   LPL+LIN IYD +  L+ +LMIPFM+RK
Sbjct: 274 NAGASPSRILHQPIMSSLEETMYSMMKESTITLPLSLINYIYDRLTNLIDELMIPFMKRK 333

Query: 362 ISFWEETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLLR 421
           ISFW+E+ILQPRKS+F  +K FRK ++++ +      ++     +G  YF ++S EF+LR
Sbjct: 334 ISFWDESILQPRKSIFPNSKFFRKLISKTPAPPPAS-DSATHSQQGVAYFAATSNEFILR 392

Query: 422 KLADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKND 481
           KLADWS M+SDFK AYSTYE L  D E  P+YLASCLEWCA+S+LMGAQ+IVT KMIKND
Sbjct: 393 KLADWSFMLSDFKNAYSTYELLSKDFEQRPEYLASCLEWCALSVLMGAQSIVTVKMIKND 452

Query: 482 VNPLIERSLDTYE-------------QCSILAQNSLENDELLSEP--------------- 513
           ++PLI R+L +YE             + S LA+ + ++ +  + P               
Sbjct: 453 IDPLINRALKSYELSARKAKEKNAQLKSSALAKKAEKDSKSATLPSTVSDEHSGQELDEG 512

Query: 514 --------VRSYETRCMLLTSELFLSLNDTWTSTPYALSNLETILAECKLGICSQIMIWE 565
                    +SYETRCMLL +ELFLSL+DTWT+TPYA+  LETIL EC LG  S+I++WE
Sbjct: 513 VSSAPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDECTLGSLSEIVLWE 572

Query: 566 RLSDCYNMRTDPRIRHRVETV--------TKIENNEGG-----------QQLQTDDIVSK 606
           RL+ CY +R DPR++ ++ ++         + E +EG             ++  + + S 
Sbjct: 573 RLAYCYALRVDPRVKGKLPSLDGQSGQNEKRGEESEGSDESDDETQKYDHKISQNCMASL 632

Query: 607 GXXXXXXXXXXXXXXXXXWAEQKQWRQVSWCLRDVEYIYDDLSFSKRPELIYQKLKDELN 666
           G                 W E KQWRQ  W L+D+E +Y +L F+ R +LI +KL+ +++
Sbjct: 633 GLARRRKSTLFRLIATKKWTESKQWRQAYWGLKDIEVVYSELDFANRDDLILEKLRKKIH 692

Query: 667 E 667
           E
Sbjct: 693 E 693

>Kwal_56.23583 s56 (607721..609823) [2103 bp, 700 aa] {ON} YDR108W
           (GSG1) - involved in meiosis [contig 176] FULL
          Length = 700

 Score =  668 bits (1724), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/724 (47%), Positives = 468/724 (64%), Gaps = 89/724 (12%)

Query: 4   LQFSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSL 63
           +  SYE YMNLV HLD  +EPVP +IS++IVSNA++PV+TV S++ LD+H+Q+SY +DSL
Sbjct: 1   MPLSYERYMNLVSHLDSASEPVPSEISRKIVSNAVSPVVTVTSSAALDKHIQESYGLDSL 60

Query: 64  YLLMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYSRSR 123
           Y+L+RYFG CISDRDQA+         +  + GV                P   R +RSR
Sbjct: 61  YMLLRYFGDCISDRDQAD---------SEQESGVE---------------PNKSR-ARSR 95

Query: 124 SNSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETD 183
           S SLFQR ++Q  ++RFT+P+ D+I +R++ D+LFDYHSLEV+L+K L L+D  T+ +T 
Sbjct: 96  SGSLFQRQASQ--FLRFTRPLSDIIGTRETRDLLFDYHSLEVFLQKYLELVDVKTSPDTP 153

Query: 184 HKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKNQ 243
           H  L+ S++H+FF++AISST +LSPYE FNHP+ SL+ALDIS+ + YEDARDLL+ FKN 
Sbjct: 154 HTLLQHSIYHKFFTTAISSTAHLSPYECFNHPVCSLLALDISQNEGYEDARDLLVTFKNM 213

Query: 244 NNAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLW--NK 301
           +N    FP F++ NDIL VFLLCY+  S EQ E CQ + K +KKQLF ESL+LP W  N 
Sbjct: 214 HNKTPHFPSFINVNDILPVFLLCYEEGSREQFETCQSLAKMMKKQLFVESLLLPCWSVNF 273

Query: 302 SHSEDVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRK 361
           +  +     LHQP MSSL+E ++   + S  +LPL  I  IYD + KLV +LMIPFM+RK
Sbjct: 274 TAKDTPTRVLHQPIMSSLEETMFSMLKDSAFDLPLPFIEHIYDRLTKLVDELMIPFMKRK 333

Query: 362 ISFWEETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLLR 421
           ISFWEE+ILQPR+S+F  +K FRK ++++ + + N  ++     +G  YF ++S E LLR
Sbjct: 334 ISFWEESILQPRRSIFPNSKFFRKLISKAPTPSTNN-DSATHSEQGLAYFAATSNELLLR 392

Query: 422 KLADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKND 481
           KLADWS M+SDFKTAYSTYE L  D E HP+YLA CLEWCA+S+LMGAQ+IVT KMIKND
Sbjct: 393 KLADWSFMLSDFKTAYSTYELLSKDFEQHPEYLAPCLEWCALSVLMGAQSIVTVKMIKND 452

Query: 482 VNPLIERSLDTYEQCSI-------LAQNSLEND--------------------------E 508
           ++PLI R+L +YE C+        L ++ L+N                           E
Sbjct: 453 IDPLITRALKSYELCASKAKERNGLLKSKLQNRDHDKSLNGFETISNSHDDRVSGTTDFE 512

Query: 509 LLSEP---VRSYETRCMLLTSELFLSLNDTWTSTPYALSNLETILAECKLGICSQIMIWE 565
           + S P    +SYETRCMLL +ELFLSL+DTWT+TPYA+  LETIL +C +G  S+I+IWE
Sbjct: 513 ISSTPSQSAQSYETRCMLLAAELFLSLSDTWTATPYAIKYLETILDQCTVGALSEIVIWE 572

Query: 566 RLSDCYNMRTDPRIRHRVETVTKIENNEGGQQLQTDD----------------------I 603
           RL+ CY +R DPR++ R+ T ++I++++  ++L  +                       I
Sbjct: 573 RLAYCYALRVDPRVKSRL-TASEIQSSDQNEKLDEESEGSDNDSGDESQVCQHKMSQSCI 631

Query: 604 VSKGXXXXXXXXXXXXXXXXXWAEQKQWRQVSWCLRDVEYIYDDLSFSKRPELIYQKLKD 663
            S G                 W E KQWRQ  W  +D+E +Y  L F+ R +LI +KL+ 
Sbjct: 632 ASSGLTRKRKATLFRLIATKKWTESKQWRQACWSFQDLEVMYSHLVFANREDLILKKLEK 691

Query: 664 ELNE 667
            + +
Sbjct: 692 RIAQ 695

>SAKL0H17226g Chr8 complement(1526848..1529007) [2160 bp, 719 aa]
           {ON} similar to uniprot|P46944 Saccharomyces cerevisiae
           YDR108W GSG1 Subunit of TRAPP (transport protein
           particle) a multi-subunit complex involved in targeting
           and/or fusion of ER-to-Golgi transport vesicles with
           their acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 719

 Score =  653 bits (1684), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 355/747 (47%), Positives = 466/747 (62%), Gaps = 119/747 (15%)

Query: 4   LQFSYENYMNLVYHLDRVNEPVP--QDISKRIVSNAIAPVITVMSTSELDQHVQDSYNID 61
           +  SYENYMNL+YH+D   E V    +++K+IVSNA++PV+ V STS LD H+Q++Y + 
Sbjct: 1   MTLSYENYMNLLYHIDHSGESVTVNSEVAKKIVSNAVSPVVAVTSTSLLDSHLQEAYGLH 60

Query: 62  SLYLLMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYSR 121
           S+Y+L+R+FG C++DRDQ NE         T  +G                        R
Sbjct: 61  SMYMLLRFFGDCVTDRDQENE-------TETNFKG------------------------R 89

Query: 122 SRSNSLFQRDSTQSHYIRFTKPIEDLINSRDS-HDMLFDYHSLEVYLEKCLSLIDKNTND 180
            RSNSLFQR+S  S ++RFT+P+ DL++ R S H MLFDYHSLE++L+K L L+D   + 
Sbjct: 90  PRSNSLFQRES--STFVRFTRPLIDLVDVRVSDHGMLFDYHSLELFLDKYLRLVDHRVSA 147

Query: 181 ETDHKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKF 240
            T H+ LK S++H+FF++AISST YLSPYESFNHP++SL+ALDIS+G  YE+ARDLLI+F
Sbjct: 148 NTPHRLLKHSIYHKFFTAAISSTAYLSPYESFNHPVMSLLALDISRGDTYENARDLLIRF 207

Query: 241 KNQNNAVEE---FPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLP 297
           KN N+A +    FP F++ NDIL VFLLCY+  S EQ E CQ + K LKKQLF ES++LP
Sbjct: 208 KNMNSATKSAASFPTFININDILPVFLLCYNDSSHEQFEACQSLAKMLKKQLFVESILLP 267

Query: 298 LWNKSHSEDVQVE---LHQPAMSSLDEMLYFF--ERP--------------SVHELPLNL 338
           LW  S   D +     LH P MSSL+EMLYF   E P              S  ELPL L
Sbjct: 268 LWRDSEDYDAEEPRRILHPPIMSSLEEMLYFLDLEAPGKDNISYTGSSNPISSFELPLAL 327

Query: 339 INTIYDLMEKLVVDLMIPFMQRKISFWEETILQPRKSLFHGNKLFRKFMNRSSSQTANQY 398
           + TIYD +  L+ +LMIPFM+RKISFWEETILQPRKS+F   K  R+F+++S+  T    
Sbjct: 328 VETIYDRLNLLITELMIPFMKRKISFWEETILQPRKSIFLNAKFLRRFVSKSAPATPAAP 387

Query: 399 NNIVKDS---RGNEYFTSSSPEFLLRKLADWSMMISDFKTAYSTYETLISDLEAHPKYLA 455
            N   D    R N +F +SS EFLLRKLADWS M+SD++TAY+TY+TL  DLE H +YLA
Sbjct: 388 INSKSDGAVQRSN-FFPASSNEFLLRKLADWSFMLSDYRTAYATYDTLSKDLEHHLEYLA 446

Query: 456 SCLEWCAISILMGAQNIVTAKMIKNDVNPLIERSLDTYEQCS--ILAQNSLENDELL-SE 512
            CLEWCA+S+LMGAQ+IVT KMIKND++PLI +SL  YE+C+  + + +  E D  + S+
Sbjct: 447 PCLEWCAVSVLMGAQSIVTVKMIKNDIDPLISKSLQCYEKCASKLTSPHVAEADSPVDSK 506

Query: 513 PVRSYETRCMLLTSELFLSLNDTWTSTPYALSNLETILAECKLGICSQIMIWERLSDCYN 572
           P +SYETRCMLL++ELFLSL+DTWT+TPYA+  LETIL  C LG  SQ+++WE+L+ CY 
Sbjct: 507 PAQSYETRCMLLSAELFLSLSDTWTATPYAIKYLETILQNCPLGPKSQVLLWEKLAYCYE 566

Query: 573 MRTDPRIRH-----------RVETVTKI----------------ENNEGGQQLQTD---- 601
           +R DPR+ H           R E ++K                 +N  G Q+ Q+D    
Sbjct: 567 LRVDPRVSHIHAKQRHLQYEREEVISKSNERAPQHHSESHFSTEKNQTGNQEEQSDTDSK 626

Query: 602 -----------------------DIVSKGXXXXXXXXXXXXXXXXXWAEQKQWRQVSWCL 638
                                  DI   G                 W EQKQW+Q SW L
Sbjct: 627 DEALSNREKEHADFVNPNKLPYKDIALLGLTRRRKAAFFRLIAANKWCEQKQWKQASWLL 686

Query: 639 RDVEYIYDDLSFSKRPELIYQKLKDEL 665
           RDV+ +Y  L FS R  LI ++L  E+
Sbjct: 687 RDVDTVYSGLVFSYRKGLILERLVGEI 713

>KNAG0H03270 Chr8 complement(609643..611589) [1947 bp, 648 aa] {ON}
           Anc_8.255 YDR108W
          Length = 648

 Score =  595 bits (1534), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/699 (44%), Positives = 430/699 (61%), Gaps = 93/699 (13%)

Query: 4   LQFSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSL 63
           + FSYE+YMNL+ HL+  +E VP DI++RIVS+A+APVITV S+  LD H+ +SY + S 
Sbjct: 1   MAFSYEHYMNLLSHLECASETVPPDIARRIVSHAVAPVITVTSSLALDDHIMESYKVQSA 60

Query: 64  YLLMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYSRSR 123
           YLL R FGGCISDRDQ  E+                          TL+   +   +R R
Sbjct: 61  YLLFRLFGGCISDRDQLMEHY-------------------------TLDDSSTGGRTRKR 95

Query: 124 SNSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETD 183
           SNSLFQRD+TQS +IRF +P+ DL+ S      LFD  SLE YL   LS I K T  + +
Sbjct: 96  SNSLFQRDATQSQFIRFAQPLPDLLRSYTEQQGLFDNDSLEWYLTHYLSWIQKLTATDPE 155

Query: 184 ----------------------HKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVA 221
                                 HK L+ +++H FF+ A+SSTT +SP+E+FN P+++L+A
Sbjct: 156 KVEQLPDELTPSSPPQRGKPLPHKLLRNAVYHNFFALAVSSTTRISPFETFNVPVMNLIA 215

Query: 222 LDISKGQNYEDARDLLIKFKNQNNAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDV 281
           +D+S+GQ+YE  RDL+  FKN N  +E+FP F++ NDIL + +LCYD   E Q   C+ +
Sbjct: 216 IDVSRGQDYEVVRDLVTTFKNLNKFLEDFPVFINVNDILPMIVLCYDAADETQLATCEQL 275

Query: 282 VKKLKKQLFAESLMLPLWNKSHSEDVQVELHQPAMSSLDEMLYFF-------------ER 328
            +K+KK LF +S+ L LW++   E   V LH+P MSSLDE++ F+             + 
Sbjct: 276 QRKIKKCLFVDSIPLALWDED-PESPLVPLHEPIMSSLDEIVKFYSSNSSAGGDEVGTDG 334

Query: 329 PSVHELPLNLINTIYDLMEKLVVDLMIPFMQRKISFWEETILQPRKSLFHG-NKLFRKFM 387
            S   LPLN+I  +Y  ++ LV +++IPFM RK  +WEE ILQPRKS+FHG N  F+KF+
Sbjct: 335 HSRAALPLNIITHMYQALDVLVDEMLIPFMHRKTKYWEENILQPRKSIFHGSNNFFKKFI 394

Query: 388 NRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLLRKLADWSMMISDFKTAYSTYETLISDL 447
            ++++Q         +D    ++F +SS E LLRKLADWS+M+SDFKTAY TY++L +DL
Sbjct: 395 GKTTTQ---------RDPSDTQFFPASSTECLLRKLADWSLMLSDFKTAYLTYDSLSNDL 445

Query: 448 EAHPKYLASCLEWCAISILMGAQNIVTAKMIKNDVNPLIERSLDTYEQCSILAQNSLEND 507
           +  P YLASCLEWCA+S+L+GAQNIVT KMIK ++ PLIER++ TY Q            
Sbjct: 446 QNSPNYLASCLEWCAVSLLLGAQNIVTVKMIKTEITPLIERAVATYRQ------------ 493

Query: 508 ELLSEPVRSYETRCMLLTSELFLSLNDTWTSTPYALSNLETILAEC-KLGICSQIMIWER 566
               +   SYETRCM+L++ELFL+L DTWTSTPYA+  LETIL +C +LG CSQ+MIWER
Sbjct: 494 ----QGRSSYETRCMILSAELFLALRDTWTSTPYAIRYLETILRDCPQLGACSQVMIWER 549

Query: 567 LSDCYNMRTDPRIRHRVETVTKIENNEGGQQLQTDDIVSKGXXXXXXXXXXXXXXXXXWA 626
           LSDCY  RTDPR+   + T     N   G     ++I+++G                 WA
Sbjct: 550 LSDCYQSRTDPRVASALST-----NTSPGSAQPGNEILAQGFTRKRKAAFFRLIAAKKWA 604

Query: 627 EQKQWRQVSWCLRDVEYIYDDLSFSKRPELIYQKLKDEL 665
           EQ QWRQV WCL D++ IY   +   +  L+  +L  E+
Sbjct: 605 EQGQWRQVQWCLHDIKDIYTASALYDKKGLLIDRLNTEV 643

>TBLA0E04380 Chr5 (1112393..1115062) [2670 bp, 889 aa] {ON}
           Anc_8.255 YDR108W
          Length = 889

 Score =  562 bits (1448), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 314/639 (49%), Positives = 415/639 (64%), Gaps = 97/639 (15%)

Query: 120 SRSRSNSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTN 179
           +R RSNSLFQRDSTQS YIRFTKPI DL+N+RD  D LFD+ SLE  L+  L +I+ NT 
Sbjct: 184 TRKRSNSLFQRDSTQSQYIRFTKPIPDLVNTRDPTDSLFDHQSLETLLKGYLKIIETNTT 243

Query: 180 DETDHKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIK 239
            +  H ALK SL+HRFFS  ++STT L P+ESF+HP++SL+++D++  QNY+ A+++LIK
Sbjct: 244 PDMPHNALKKSLYHRFFSMTVTSTTNLCPFESFDHPIVSLLSIDLTLNQNYDTAKEMLIK 303

Query: 240 FKNQNNAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLW 299
           FKN ++    FP +++ NDIL VFLLCYD  S EQ +I + +  K+KKQLF ES++LPLW
Sbjct: 304 FKNIHSKTPNFPVYLNINDILPVFLLCYDASSPEQLDIAKKISTKIKKQLFFESILLPLW 363

Query: 300 N-KSHSEDVQVELHQPAMSSLDEMLYFFER-------PSVHELPLNLINTIYDLMEKLVV 351
           N K ++ D  V+LH+P MSS+DE LYF ++        + ++LPL+L+  IY+++  L V
Sbjct: 364 NDKIYNNDKFVKLHEPMMSSVDETLYFLQQYLQKNSCVTDNKLPLSLVKYIYEMIANLSV 423

Query: 352 DLMIPFMQRKISFWEETILQPRKSLFHGNKLFRKFMNRS---------------SSQTAN 396
           +L+IPFMQRKI FW+ETILQPRKS+F  NKLF+ FMNR+               +S + +
Sbjct: 424 NLIIPFMQRKIRFWDETILQPRKSIFR-NKLFKSFMNRNSNVSSSTGTSSSEISNSISKH 482

Query: 397 QYNNIVKDSRGNEYFTSSSPEFLLRKLADWSMMISDFKTAYSTYETLISDLEAHPKYLAS 456
            ++ + KDS G+EYF++ S EF LRKLADWSMM+SDFKTAY+TYE+L  DLE   KY+AS
Sbjct: 483 HHSLLTKDSNGHEYFSALSTEFQLRKLADWSMMVSDFKTAYTTYESLSRDLENTSKYMAS 542

Query: 457 CLEWCAISILMGAQNIVTAKMIKNDVNPLIERSLDTYEQCSILAQNS------------- 503
           CLEW A+SILMGAQNIVTAKM+KNDV+PLIE +L++YE+      NS             
Sbjct: 543 CLEWWAVSILMGAQNIVTAKMLKNDVDPLIESALESYEKPLPPVPNSRLPSNNINSLNSR 602

Query: 504 -------------LENDELLSEPVRSYETRCMLLTSELFLSLNDTWTSTPYALSNLETIL 550
                        +EN+      +RSYE RCMLL SELFLSL+DTWTSTPYAL  LETIL
Sbjct: 603 SSISSATKAEVSLIENNHT----IRSYEIRCMLLLSELFLSLSDTWTSTPYALRYLETIL 658

Query: 551 AECKLGICSQIMIWERLSDCYNMRTDPRIRHRVETVTKIEN------------------- 591
           ++ KLG CSQ ++WERLS CY++R DPRI+ R  T+T I                     
Sbjct: 659 SDYKLGPCSQTILWERLSFCYDLRVDPRIK-RKPTITNINKGTKATGSEASHSSIKEVNE 717

Query: 592 ---NEGGQQ---------LQTD-----------DIVSKGXXXXXXXXXXXXXXXXXWAEQ 628
              N+G Q+         L  D           DI+S G                 W+EQ
Sbjct: 718 KYRNDGKQEKYSIDRKNSLIIDVNSNEEYDCGYDILSDGFTRKRKAAFFKLIAAKKWSEQ 777

Query: 629 KQWRQVSWCLRDVEYIYDDLSFSKRPELIYQKLKDELNE 667
           KQWRQ+ WCL+D+E +Y ++ FS R +LI  KLKD+LN+
Sbjct: 778 KQWRQLDWCLKDIENVYKEVGFSDRKDLILIKLKDQLNK 816

 Score =  134 bits (337), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 58/79 (73%), Positives = 71/79 (89%)

Query: 4  LQFSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSL 63
          + FSYENYMNL++HLDR NE +P DI+KRIV N+IAP+I+V +T ELD+HVQDSYNIDSL
Sbjct: 1  MPFSYENYMNLLFHLDRTNEEIPTDIAKRIVQNSIAPLISVTATPELDKHVQDSYNIDSL 60

Query: 64 YLLMRYFGGCISDRDQANE 82
          Y+L+RYFGGCISDRDQ +E
Sbjct: 61 YMLLRYFGGCISDRDQYHE 79

>Ecym_4316 Chr4 complement(683492..685363) [1872 bp, 623 aa] {ON}
           similar to Ashbya gossypii AGR096C
          Length = 623

 Score =  490 bits (1261), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 279/669 (41%), Positives = 415/669 (62%), Gaps = 66/669 (9%)

Query: 6   FSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSLYL 65
            SYE YMNL+++ D+ ++PVP++IS++++ NA++P I+V ST  L+QH+++ + I SLY 
Sbjct: 2   LSYEKYMNLLHYPDQWSQPVPREISRKVICNALSPCISVQSTDALNQHLEEVFKIGSLYK 61

Query: 66  LMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYSRSRSN 125
           L+RYFG  I DRDQ                 ++D+I  + + +N           R R N
Sbjct: 62  LLRYFGDYIQDRDQ-----------------LDDKISAKLQPNN----------RRQRQN 94

Query: 126 SLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETDHK 185
           SLFQR+S  S YIRF  P+ D+I+  D+H +  +++ LE  L + L  I+++T +++  +
Sbjct: 95  SLFQRNS--SRYIRFQTPLTDIISVGDNHQV--EFNDLEESLSEFLKDIEEHTVNDSPCE 150

Query: 186 ALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKNQNN 245
            LK S+FH+F +  +SSTT LSPY SFNHP+++L+ALDI++G+ YE AR+LL++FKN  N
Sbjct: 151 LLKHSIFHKFIT-MLSSTT-LSPYHSFNHPILALLALDITQGEEYELARELLMEFKNLPN 208

Query: 246 AVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSHSE 305
            + +FP F++TND+L VF+LC+D  S +Q E  Q ++K +KKQLF ES+ LP++  ++  
Sbjct: 209 TLSKFPAFINTNDVLPVFILCFDQSSPQQWETVQSLMKVIKKQLFVESVPLPIF--TNFR 266

Query: 306 DVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRKISFW 365
           D  + LH P  +SL E LY    P   +L   L+  IYD +  +V DLMIPFM RKISFW
Sbjct: 267 DRSIVLHPPITNSLQEQLYDSSHPVSLKLCPRLVKLIYDTINSMVEDLMIPFMNRKISFW 326

Query: 366 EETILQPRKSLFHGNKLFRKFMNRSS-SQTANQYNNIVKDSRGNEYFTSSSPEFLLRKLA 424
           +ETILQPRKS+FH NKL ++F+++SS S TA+        +  + +F +SS EFLLRKLA
Sbjct: 327 DETILQPRKSIFHSNKLLKRFISKSSGSPTASM------PTSPDGHFLASSNEFLLRKLA 380

Query: 425 DWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKNDVNP 484
           DW  M+SD+KTAYS YE LI D E +P Y++SC E+ A+S+LMGA +IVTAKMIKND++P
Sbjct: 381 DWCFMLSDYKTAYSIYEILIRDFENYPLYMSSCQEFSALSLLMGAHSIVTAKMIKNDIDP 440

Query: 485 LIERSLDTYEQCSILAQNSLENDELLSEPVRSYETRCMLLTSELFLSLNDTWTSTPYALS 544
           LI + LD Y   +I++ +               + RCM+  +ELFLSL+DTWTS P+A+ 
Sbjct: 441 LIMKYLD-YAVNNIISLD---------------QIRCMIYMTELFLSLSDTWTSAPFAIK 484

Query: 545 NLETILAE--CKLGICSQIMIWERLSDCYNMRTDPRIRHRVETVTKIENN------EGGQ 596
            LE IL +   KLG   + +IWER+S  Y +R DPRI    ++ +  +++          
Sbjct: 485 YLEVILQKENLKLGPVCRNLIWERISFAYRLRIDPRIHADDDSTSDCDHDLEEELYLNPH 544

Query: 597 QLQTDDIVSKGXXXXXXXXXXXXXXXXXWAEQKQWRQVSWCLRDVEYIYDDLSFSKRPEL 656
           +L    I ++G                 W +  Q RQ +W L+    +Y DL F+     
Sbjct: 545 KLHCGKIQNQGFTRYRKEAVFQLLAAKKWLQCGQTRQGAWSLKRCNRVYRDLPFANAEGT 604

Query: 657 IYQKLKDEL 665
           +  +L D +
Sbjct: 605 LLSRLADAV 613

>KLLA0F18953g Chr6 (1737522..1739465) [1944 bp, 647 aa] {ON} similar
           to uniprot|P46944 Saccharomyces cerevisiae YDR108W GSG1
           Subunit of TRAPP (transport protein particle) a
           multi-subunit complex involved in targeting and/or
           fusion of ER-to-Golgi transport vesicles with their
           acceptor compartment protein has late meiotic role
           following DNA replication
          Length = 647

 Score =  470 bits (1210), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 274/691 (39%), Positives = 399/691 (57%), Gaps = 72/691 (10%)

Query: 3   SLQFSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDS 62
           SLQFSYE YMNL+ + +  + P+P +ISK+++ N ++P I V S  ELD H++D YNIDS
Sbjct: 2   SLQFSYEKYMNLIQYPEHWSNPIPHEISKKVIYNTLSPCICVQSNLELDNHLKDMYNIDS 61

Query: 63  LYLLMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYSRS 122
           + +L RYFG  I DRDQ                           ++  L+ P S    R 
Sbjct: 62  ISMLFRYFGDYIQDRDQI-------------------------PSTTDLKDPGSVSSGRH 96

Query: 123 RSNSLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDE- 181
           RS+SLFQR +++   +RFT+ +EDLI S DS D +     ++ +L + L  ++   N+  
Sbjct: 97  RSDSLFQRQASEC--VRFTRSLEDLI-SIDSEDHILQSTDIDSFLSQYLQNLEPIMNENG 153

Query: 182 TDHKALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFK 241
           T  K LK S++HRFF +   S+  LS Y SF+HP+++L+ LDI+KGQ YE+AR++LI FK
Sbjct: 154 TPSKLLKHSIYHRFFITL--SSINLSRYHSFHHPVVALLPLDITKGQGYENAREILIHFK 211

Query: 242 NQNNAVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNK 301
           N NN +E FP F++ NDIL VF+LCYD +S EQ E  Q + K LKKQLF ES+ + L+  
Sbjct: 212 NLNNTLENFPEFININDILPVFVLCYDENSREQWESVQALTKSLKKQLFVESVSISLFT- 270

Query: 302 SHSEDVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRK 361
            H       LH P   SL E ++    P+   +P  L+  IYD +  +V ++MIPFM RK
Sbjct: 271 PHDNQKSTTLHSPITVSLHEQVFNMSHPTSINIPSRLLTHIYDTISFIVEEMMIPFMHRK 330

Query: 362 ISFWEETILQPRKSLFHGNKLFRKFMN-RSSSQTANQYNNIVKDSRGNEYFTSSSPEFLL 420
           + FW+ET+LQPRKS+F  NK FR+F++ +S+   A++ N+    + G+  F +SSPEFLL
Sbjct: 331 LVFWDETVLQPRKSIFQSNKFFRRFISPKSNHPIAHKVNDPQDPAEGDIMFPASSPEFLL 390

Query: 421 RKLADWSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKN 480
           RKLADWS M+SDFK AYS Y+ L  D E++P+YLA CLE+  IS+LMGAQNI+TAK IK 
Sbjct: 391 RKLADWSFMLSDFKKAYSIYDLLTKDFESYPQYLAPCLEYKTISLLMGAQNIITAKTIKT 450

Query: 481 DVNPLIERSLDTYEQCSILAQNSLENDELLSEPVRSYETRCMLLTSELFLSLNDTWTSTP 540
           +V+PL+ R+++ Y++           DE  S  V      C+L  S+L LSL+DTW S+P
Sbjct: 451 EVDPLMTRAIEQYKK----------QDEKHSLRV----IHCILTFSDLLLSLSDTWVSSP 496

Query: 541 YALSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRI----------RHRVETVTKIE 590
            A++ L  I     LG  + ++I ER++  Y +  D R+           ++ +     E
Sbjct: 497 LAVNYLTYIQKSHLLGPYATVIILERIAYAYEICIDLRVNDHFLPKPDEENKADESEAAE 556

Query: 591 NNEGGQQ-LQTDD--------------IVSKGXXXXXXXXXXXXXXXXXWAEQKQWRQVS 635
           N++ G+  L+ DD              + S+G                 W E  +  Q  
Sbjct: 557 NSKKGENGLEVDDMHEWRNENKLIQNNLRSEGLTRFRKYSLYQLVAAKKWVELHKRNQAK 616

Query: 636 WCLRDVEYIYDDLSFSKRPELIYQKLKDELN 666
           WC+      Y+ LS SKRP+ ++ +L  EL+
Sbjct: 617 WCIYHAAPAYEKLSLSKRPDGLFHRLSMELS 647

>AGR096C Chr7 complement(917898..919769) [1872 bp, 623 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR108W
           (GSG1)
          Length = 623

 Score =  462 bits (1188), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 261/673 (38%), Positives = 396/673 (58%), Gaps = 73/673 (10%)

Query: 6   FSYENYMNLVYHLDRVNEPVPQDISKRIVSNAIAPVITVMSTSELDQHVQDSYNIDSLYL 65
            SYE YMNLV++ +  ++PVP +IS+R++ NA++P ++V ST+ L+ H+ + ++  SLY+
Sbjct: 2   LSYETYMNLVHYPEHWSQPVPHEISRRVICNALSPCVSVQSTAALEAHLAEEFSEGSLYM 61

Query: 66  LMRYFGGCISDRDQANEYVKKANVENTAQEGVNDQIIEEQRNSNTLELPKSERYSRSRSN 125
           L+RYF           +YV++   E  +  G        QR                R  
Sbjct: 62  LLRYFA----------DYVRERGEEVGSVSG--------QR----------------RPG 87

Query: 126 SLFQRDSTQSHYIRFTKPIEDLINSRDSHDMLFDYHSLEVYLEKCLSLIDKNTNDETDHK 185
           S++QR +  S Y+RF +P+E++I + +   +  D+  LE  L + L  I+  T +E+  +
Sbjct: 88  SVYQRQT--SRYVRFQRPLEEVIETVEQQAV--DFEDLEEALGQHLRDIEARTTNESPSE 143

Query: 186 ALKMSLFHRFFSSAISSTTYLSPYESFNHPLISLVALDISKGQNYEDARDLLIKFKNQNN 245
            LK S+FH+F +  + S+T LSPY + NHP+++L+ALD+++G+ Y  AR+LL++FKN  +
Sbjct: 144 LLKHSIFHKFIT--MLSSTALSPYHTVNHPIMALLALDVTQGEEYTLARELLVQFKNLPS 201

Query: 246 AVEEFPPFMSTNDILLVFLLCYDGDSEEQKEICQDVVKKLKKQLFAESLMLPLWNKSHSE 305
              +FP +++TND+L VF+LC+D  S EQ E  Q + K +KKQLF ES+ LP++    S+
Sbjct: 202 KSSKFPSYINTNDVLPVFILCFDESSSEQWETVQALQKAIKKQLFVESVPLPIFTNYESD 261

Query: 306 DVQVELHQPAMSSLDEMLYFFERPSVHELPLNLINTIYDLMEKLVVDLMIPFMQRKISFW 365
            V   LH P  +SL E +Y    P +  L   L++ IY+ +  +V DLMIPFM RKISFW
Sbjct: 262 PVV--LHPPITNSLQEQVYDGSHPPLLRLCPQLVDVIYETINAMVEDLMIPFMNRKISFW 319

Query: 366 EETILQPRKSLFHGNKLFRKFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLLRKLAD 425
           +ETILQPRKS+FHGNK  ++FMN+++S  A   +     +  + YF +SS EFLLRKLAD
Sbjct: 320 DETILQPRKSIFHGNKFLKRFMNKTNSSAAGTLS-----TSSDGYFLASSNEFLLRKLAD 374

Query: 426 WSMMISDFKTAYSTYETLISDLEAHPKYLASCLEWCAISILMGAQNIVTAKMIKNDVNPL 485
           WS M+SD+KTAYS Y  L+ D E +P+YL+SC E+ A+S+LMGA +IVT KMIKND++PL
Sbjct: 375 WSFMLSDYKTAYSIYYILLRDFELYPQYLSSCQEFSALSLLMGAHSIVTTKMIKNDIDPL 434

Query: 486 IERSLDTYEQCSILAQNSLENDELLSEPVRSYETRCMLLTSELFLSLNDTWTSTPYALSN 545
           I + +D+    ++ + N L             + RC++  +ELFLSL+DTWTS P+A+  
Sbjct: 435 IMKYMDS----TVASLNYLG------------KFRCLVYMAELFLSLSDTWTSAPFAIKY 478

Query: 546 LETILA--ECKLGICSQIMIWERLSDCYNMRTDPRIR--------HRVETVTKIENNEGG 595
           LE IL   + KLG  S+ M+WER+S  Y +R DPRI         + +E  T+ +     
Sbjct: 479 LELILQNEQLKLGPLSRTMLWERISYAYQLRIDPRIHTDDEYLSDNFMELTTEDDFCMNP 538

Query: 596 QQLQTDDIVSKGXXXXXXXXXXXXXXXXXWAEQKQWRQVSWCLRDVEYIYDDLSFSKRPE 655
            +L    I S G                 W E    RQ +W L+    +Y +L F+    
Sbjct: 539 NKLHHWRIHSLGLTRHRKEAVFRLLAAKKWLEYGHIRQGAWSLKGCNKVYRNLGFANADG 598

Query: 656 LIYQKLKDELNEE 668
            +  +L D +  E
Sbjct: 599 TLLSRLVDMVVHE 611

>Kpol_1002.46 s1002 (135310..136929) [1620 bp, 539 aa] {ON}
           (135310..136929) [1620 nt, 540 aa]
          Length = 539

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 34/130 (26%), Positives = 57/130 (43%), Gaps = 20/130 (15%)

Query: 485 LIERSLDTYEQCSI--LAQN--SLENDELLSEPVRSYETRCMLLTSELFLSLNDTWTSTP 540
           +I+ S++ ++   I  LAQ   ++ ND   SEP   +E RC++ T+E            P
Sbjct: 335 IIDSSINPFKGSKIKALAQTLYAIANDS--SEP--GFEKRCIVFTNE--------KKDVP 382

Query: 541 YALSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRIRHRVETVTKIENNEG----GQ 596
           Y +  L+       +G+ S   + ERL   ++  T P+     +   KIEN +     G 
Sbjct: 383 YIVEKLKVTYGHDCIGLTSNDSVEERLEKIHDFITPPKPITMKKETPKIENEDSVEVEGS 442

Query: 597 QLQTDDIVSK 606
            +   D  SK
Sbjct: 443 NITIGDFSSK 452

>KAFR0B04330 Chr2 complement(897247..898116) [870 bp, 289 aa] {ON}
           Anc_5.86 YHR160C
          Length = 289

 Score = 32.3 bits (72), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 21/57 (36%), Positives = 30/57 (52%), Gaps = 3/57 (5%)

Query: 385 KFMNRSSSQTANQYNNIVKDSRGNEYFTSSSPEFLLRKLADWSMMISDFKTAYSTYE 441
           KF+   SSQ  NQ +NI  +S G E +    P+F   K+ D     S++K  Y+ YE
Sbjct: 70  KFLRTPSSQRPNQPSNIHGNSEGTESWL---PQFSSMKINDPLEFSSEYKNLYNNYE 123

>SAKL0F15444g Chr6 (1243590..1246484) [2895 bp, 964 aa] {ON} similar
           to uniprot|P08638 Saccharomyces cerevisiae YLR451W LEU3
           Zinc-finger transcription factor that regulates genes
           involved in branched chain amino acid biosynthesis and
           ammonia assimilation positively regulated by
           alpha-isopropylmalate an intermediate in leucine
           biosynthesis
          Length = 964

 Score = 32.7 bits (73), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 44/198 (22%), Positives = 75/198 (37%), Gaps = 31/198 (15%)

Query: 427 SMMISDFKTAYSTYETLISDLEAHPKY---LASCLEWCAISILMGAQNIVTAKMIKNDVN 483
           S +  +F T Y  +  ++ D+   P+    L+ CL W  + IL+G +  V A  +   ++
Sbjct: 211 SALFKEFSTKYHPFLPIV-DITKGPERIYSLSPCLFW--VIILIGLRRKVGAIELMTKLS 267

Query: 484 PLIERSLDTYEQCSILAQNSLENDELLSEPVRSYETRCMLL-------TSELF------- 529
            L++  L       I+     E+DE +      Y  +  LL       TS L        
Sbjct: 268 TLVKSVLAEITISPIIRYAPTESDEPVLNVASVYSVQAFLLYTFWPPLTSSLSADTSWNT 327

Query: 530 ----------LSLNDTWTSTPYALSNLETILAECKLGICSQIMIWERLSDCYNMRTDPRI 579
                     + LN    ST YA +N E I  + +  +C  I + + ++  +        
Sbjct: 328 IGCAMFQAIRVGLNSAQFSTEYANANSELISEQIRTWVCCNI-VSQTIASSFGFPVFVSF 386

Query: 580 RHRVETVTKIENNEGGQQ 597
            H V    KI +N   Q 
Sbjct: 387 DHTVINTCKISSNAADQH 404

>SAKL0F01584g Chr6 complement(131250..132683) [1434 bp, 477 aa] {ON}
           weakly similar to uniprot|P53079 Saccharomyces
           cerevisiae YGL223C COG1 Essential component of the
           conserved oligomeric Golgi complex (Cog1p through Cog8p)
           a cytosolic tethering complex that functions in protein
           trafficking to mediate fusion of transport vesicles to
           Golgi compartments
          Length = 477

 Score = 32.0 bits (71), Expect = 5.2,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 32/53 (60%), Gaps = 4/53 (7%)

Query: 400 NIVKDSRGNEYFTSSSPEFLLRKLADWSMMISDFKT---AYSTYETLISDLEA 449
           NI +DSR N  F +S    +L  +ADWS  +++F     + +T+++L+ + +A
Sbjct: 88  NIQRDSRSNSPFNTSKARLVL-AIADWSSAVTNFTKFSLSSATFDSLLLNFDA 139

>NCAS0D03980 Chr4 complement(743879..748246) [4368 bp, 1455 aa] {ON}
           Anc_6.247 YMR176W
          Length = 1455

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 17/46 (36%), Positives = 30/46 (65%), Gaps = 4/46 (8%)

Query: 156 MLFDYHSLE--VYLEKCLSLIDKNTNDETDHKALKMS--LFHRFFS 197
           ++FDY+ +   + L + LSL D NTN+  +   +K+S  LFH+++S
Sbjct: 791 IVFDYNGIRRTLSLTEFLSLADPNTNNTAEINGVKLSDVLFHKYYS 836

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.132    0.382 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 74,264,291
Number of extensions: 3366181
Number of successful extensions: 13033
Number of sequences better than 10.0: 89
Number of HSP's gapped: 13468
Number of HSP's successfully gapped: 95
Length of query: 675
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 559
Effective length of database: 40,180,143
Effective search space: 22460699937
Effective search space used: 22460699937
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)