Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_392.108.256ON1226122655190.0
Smik_12.1438.256ON1220123222370.0
TDEL0F038308.256ON1195122322230.0
NDAI0B023808.256ON1219122621960.0
ZYRO0C01804g8.256ON1209122321880.0
TPHA0B032508.256ON1215123221790.0
Suva_10.1688.256ON1220122421780.0
YLR084C (RAX2)8.256ON1220123021740.0
Skud_12.1528.256ON1220122321590.0
NCAS0B049808.256ON1204123221210.0
SAKL0H17204g8.256ON1211123421140.0
KAFR0B026908.256ON1210121921110.0
TBLA0E043908.256ON1278128318530.0
KNAG0G020008.256ON1202123817930.0
KLTH0G13838g8.256ON1214125315910.0
Kwal_56.235898.256ON1213123815670.0
CAGL0L12144g8.256ON1156118815440.0
KLLA0F18975g8.256ON1200124415430.0
Ecym_43158.256ON1212125515180.0
AGR095W8.256ON1201126415080.0
Smik_4.937.316ON283129781.2
TPHA0K013604.155ON47255745.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_392.10
         (1226 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON} (27006.....  2130   0.0  
Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] ...   866   0.0  
TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {...   860   0.0  
NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {...   850   0.0  
ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} simil...   847   0.0  
TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8....   843   0.0  
Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] ...   843   0.0  
YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}...   842   0.0  
Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] ...   836   0.0  
NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {...   821   0.0  
SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} sim...   818   0.0  
KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {...   817   0.0  
TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa]...   718   0.0  
KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {...   695   0.0  
KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} sim...   617   0.0  
Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] ...   608   0.0  
CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 a...   599   0.0  
KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa...   598   0.0  
Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar ...   589   0.0  
AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic h...   585   0.0  
Smik_4.93 Chr4 complement(178595..179446) [852 bp, 283 aa] {ON} ...    35   1.2  
TPHA0K01360 Chr11 complement(283543..284961) [1419 bp, 472 aa] {...    33   5.4  

>Kpol_392.10 s392 (27006..30686) [3681 bp, 1226 aa] {ON}
            (27006..30686) [3681 nt, 1227 aa]
          Length = 1226

 Score = 2130 bits (5519), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1093/1226 (89%), Positives = 1093/1226 (89%)

Query: 1    MLATIVRLISLGIIGVSQASQLTNVKDSLGINTVNIPQINFGNTNNEIQILSNIEGLTFY 60
            MLATIVRLISLGIIGVSQASQLTNVKDSLGINTVNIPQINFGNTNNEIQILSNIEGLTFY
Sbjct: 1    MLATIVRLISLGIIGVSQASQLTNVKDSLGINTVNIPQINFGNTNNEIQILSNIEGLTFY 60

Query: 61   QYQGQQNFTGSIDTNSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTL 120
            QYQGQQNFTGSIDTNSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTL
Sbjct: 61   QYQGQQNFTGSIDTNSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTL 120

Query: 121  GGFQLENQLLYNLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISW 180
            GGFQLENQLLYNLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISW
Sbjct: 121  GGFQLENQLLYNLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISW 180

Query: 181  NKVTKNVDMLPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVXXXXXXXXXXXX 240
            NKVTKNVDMLPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLV            
Sbjct: 181  NKVTKNVDMLPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVSNITTYTQQNST 240

Query: 241  XXXXXXXXXXXXXQISLKYASWASLGDLKSSTQFICPNGQNEAWSSAGTTGEITCNLAFE 300
                         QISLKYASWASLGDLKSSTQFICPNGQNEAWSSAGTTGEITCNLAFE
Sbjct: 241  SSSSTETNLELEQQISLKYASWASLGDLKSSTQFICPNGQNEAWSSAGTTGEITCNLAFE 300

Query: 301  ASLSKIRIFNSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQ 360
            ASLSKIRIFNSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQ
Sbjct: 301  ASLSKIRIFNSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQ 360

Query: 361  XXXXXXXXXXXXXXFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGF 420
                          FINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGF
Sbjct: 361  ASSENATTSASTSAFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGF 420

Query: 421  QLYQNSYSIFANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPGDDPSPL 480
            QLYQNSYSIFANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPGDDPSPL
Sbjct: 421  QLYQNSYSIFANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPGDDPSPL 480

Query: 481  VNFYPSINRIGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMK 540
            VNFYPSINRIGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMK
Sbjct: 481  VNFYPSINRIGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMK 540

Query: 541  YDQLFEGFLDYAPKVTLEYYSGINDENSPXXXXXXXXXXXPINIELDETIGNVTSSTEEL 600
            YDQLFEGFLDYAPKVTLEYYSGINDENSP           PINIELDETIGNVTSSTEEL
Sbjct: 541  YDQLFEGFLDYAPKVTLEYYSGINDENSPVVVVADNVDLVPINIELDETIGNVTSSTEEL 600

Query: 601  KVPLNGMFQYQLXXXXXXXXXXXLKVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLGGSI 660
            KVPLNGMFQYQL           LKVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLGGSI
Sbjct: 601  KVPLNGMFQYQLSNFTSSNNNSTLKVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLGGSI 660

Query: 661  AGVYALSLSNYTNIRSTRIXXXXXXXXXXXXXXXXXXLFGNFNISNRIVSSLSYNGTFDS 720
            AGVYALSLSNYTNIRSTRI                  LFGNFNISNRIVSSLSYNGTFDS
Sbjct: 661  AGVYALSLSNYTNIRSTRIVETGGEVTGTGAYAGGVVLFGNFNISNRIVSSLSYNGTFDS 720

Query: 721  FGNVNSNIATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTL 780
            FGNVNSNIATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTL
Sbjct: 721  FGNVNSNIATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTL 780

Query: 781  FSGLITRNEFPNLNNSAVLTGNGTAQSLQLRNGIQPYLGVYLNDSLTAYLYDSSSNSNIL 840
            FSGLITRNEFPNLNNSAVLTGNGTAQSLQLRNGIQPYLGVYLNDSLTAYLYDSSSNSNIL
Sbjct: 781  FSGLITRNEFPNLNNSAVLTGNGTAQSLQLRNGIQPYLGVYLNDSLTAYLYDSSSNSNIL 840

Query: 841  FSNGLQGNWNLPRSVSSAYYSDNETMFVGSSLSNGDSGAELFVLNFTTMDLLYNETFDVN 900
            FSNGLQGNWNLPRSVSSAYYSDNETMFVGSSLSNGDSGAELFVLNFTTMDLLYNETFDVN
Sbjct: 841  FSNGLQGNWNLPRSVSSAYYSDNETMFVGSSLSNGDSGAELFVLNFTTMDLLYNETFDVN 900

Query: 901  SSINSIVSFGRNSSLLVGGDFTAPXXXXXXXXXXXXXXXQWSSFSNKFDGTITGLEFAND 960
            SSINSIVSFGRNSSLLVGGDFTAP               QWSSFSNKFDGTITGLEFAND
Sbjct: 901  SSINSIVSFGRNSSLLVGGDFTAPNTNCSNLCLLNLGNNQWSSFSNKFDGTITGLEFAND 960

Query: 961  SRLLISGSYRFENQSGISLGYIDLNNQEFKSLLSDSQKVNSFNYNNGTIVAWDSSTIYSY 1020
            SRLLISGSYRFENQSGISLGYIDLNNQEFKSLLSDSQKVNSFNYNNGTIVAWDSSTIYSY
Sbjct: 961  SRLLISGSYRFENQSGISLGYIDLNNQEFKSLLSDSQKVNSFNYNNGTIVAWDSSTIYSY 1020

Query: 1021 RGDSWSNHQIPNTNSSTSIKNVQIVSKXXXXXXXXXXXXXXXDELILVFGELYSEDYGFV 1080
            RGDSWSNHQIPNTNSSTSIKNVQIVSK               DELILVFGELYSEDYGFV
Sbjct: 1021 RGDSWSNHQIPNTNSSTSIKNVQIVSKLNNSLSTNNTSNNLNDELILVFGELYSEDYGFV 1080

Query: 1081 QAMFYDFQNWIPYYITQPYSSLNTSKNSLFMNKDISLLYESQVVLQNPNXXXXXXXXXXX 1140
            QAMFYDFQNWIPYYITQPYSSLNTSKNSLFMNKDISLLYESQVVLQNPN           
Sbjct: 1081 QAMFYDFQNWIPYYITQPYSSLNTSKNSLFMNKDISLLYESQVVLQNPNSTISISSTSSS 1140

Query: 1141 XXXXXXXXXXXXXLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIFSDDKGE 1200
                         LKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIFSDDKGE
Sbjct: 1141 SATTRSSSTSSTSLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIFSDDKGE 1200

Query: 1201 YVRIKPRIDEHEMLDTVPPEKLMKFI 1226
            YVRIKPRIDEHEMLDTVPPEKLMKFI
Sbjct: 1201 YVRIKPRIDEHEMLDTVPPEKLMKFI 1226

>Smik_12.143 Chr12 complement(276428..280090) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  866 bits (2237), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/1232 (39%), Positives = 727/1232 (59%), Gaps = 24/1232 (1%)

Query: 5    IVRLISLGIIGVSQAS---QLTNVKDSLGINTVNIPQINFG-NTNNEIQILSNIEGLTFY 60
            + RL +L  + ++QAS   QL N+K  L I    +P +N   N +N +QIL  ++ ++FY
Sbjct: 3    VHRLWTLAFLFLAQASKASQLQNIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDAISFY 62

Query: 61   QYQGQQNFTGSIDTNSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTL 120
            +Y GQQNFT  I   +N+HGL+YYSN+T I+L + SD+T+ID+I P  +D+FILSGSGT+
Sbjct: 63   KYTGQQNFTKGISPGTNSHGLVYYSNNTYIQLEDASDDTRIDKITPFGDDSFILSGSGTI 122

Query: 121  GGFQLENQLLYNLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISW 180
                + NQ+LYNLS LS+ P+FN  L +++++LV+   VYFGGNFSY + +   +S + W
Sbjct: 123  NNISVGNQILYNLSTLSMAPIFNQSLGDVETVLVNDTSVYFGGNFSYNNGSMIGHSALVW 182

Query: 181  NKVTKNVDMLPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVXXXXXXXXXXXX 240
            + ++    +LPF GFG+NS VNSILKL++DN++F G F TLDD S+L+            
Sbjct: 183  DAMSDTAQLLPFGGFGENSNVNSILKLNDDNIVFAGKFYTLDDSSVLI---TSSNNGTNS 239

Query: 241  XXXXXXXXXXXXXQISLKYASWASLGDLK-SSTQFICPNGQNEAWSSAGTTGEITCNLAF 299
                         +ISL+YASW S G    +S   +CPN    AW    T+G + CNL +
Sbjct: 240  TFSLNATKLELGQRISLRYASWDSQGSTTLASNSLVCPNDNGNAWLYPATSGSLVCNLPY 299

Query: 300  EASLSKIRIFNSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNAL 359
            E S +KIR++NS     +IA F+I+T PS+ IMNLTYLDPL+ E+K CD FCPLYS   L
Sbjct: 300  EVSPTKIRLYNSQDAGSEIALFQILTNPSSSIMNLTYLDPLSGELKNCDEFCPLYSRATL 359

Query: 360  QXXXXXXXXXXXXXXFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSG 419
                           FI+GN T++ WS+D+Q+FAF N++PVT+L++IAL SYGD++GLSG
Sbjct: 360  LAASQNASSSMDMITFIDGNNTDVKWSSDFQDFAFANELPVTSLKLIALNSYGDSIGLSG 419

Query: 420  FQLYQNSYSIFANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPG-DDPS 478
             +LYQN++S +ANNSLNE  C +      SS LSNN WY GL  +SYIAT Y P  ++P 
Sbjct: 420  LELYQNTFSTYANNSLNEYGCSALVNDSSSSILSNNSWYNGLTGESYIATNYIPDQNEPI 479

Query: 479  PLVNFYPSINRIGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNE 538
            P V FYP+I   G+YT+N YTPGC  D TCS RGIVNVT+W+   N ++ T  IYQNN+ 
Sbjct: 480  PRVKFYPNIIHSGHYTINTYTPGCVQDNTCSSRGIVNVTVWNPQNNTMMKTYTIYQNNDN 539

Query: 539  MKYDQLFEGFLDYAPKVTLEYYSGINDENSPXXXXXXXXXXXPINIELDETIGNVTSSTE 598
            +KYDQ+F G+LD++P++ LEY SGI   N+             ++++    +  + +   
Sbjct: 540  LKYDQIFSGYLDFSPEIVLEYISGIYSSNTATVVVADRVNVITVSLDTFNALSEINNVKR 599

Query: 599  ELKVPLNGMFQYQLXXXXXXXXXXXLKVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLGG 658
            +   PLNG+FQYQ             KV NT+LNLFPV+ +  + SL    YN+ L++GG
Sbjct: 600  Q--TPLNGIFQYQ-KSNFTGTTSNKTKVGNTTLNLFPVNNYPKNASLLVEIYNDKLIVGG 656

Query: 659  SIAGVYALSLSNYTNIRSTRIXXXXXXXXXXXXXXXXXXLFGNFNISNRIVSSLSYNGTF 718
                +  + L+    I+S+                    ++G+   S+   + L +N +F
Sbjct: 657  VSNRISTIDLNENFEIKSSENRTIQGDVYGITKTGQGLLIYGDLRSSDNQSTVLLFNESF 716

Query: 719  DSFGNVNSNIATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGD 778
                N +  + + +N++  ++E+  F+N Y  N S+++ I N+++ SLS+W+AG+N  GD
Sbjct: 717  GKVPNYSKRVNSATNISIADNELFVFDNNYIINASSNAQISNSTSFSLSLWAAGNNGNGD 776

Query: 779  TLFSGLITRNEFPNLNNSAVLTGNGTAQSLQLRNGIQPYLGVYLNDSLTAYLYDSSSNSN 838
             LFSG ++  EF NLN SA        Q+L +  GI PY G YLN+S++AY Y++ + + 
Sbjct: 777  VLFSGTVSHMEFSNLNGSASFKNEDQVQALNIGRGIVPYFGAYLNESVSAYAYETDALNK 836

Query: 839  ILFSNGLQGNWNLPRSVSSAYYSDNETMFVGSSLSNGDSGAELFVLNFTTMDLLYNETFD 898
            I FSN +  +WN   +++   Y++N+TM V SS S+  S A+L + N   M  + NET  
Sbjct: 837  IYFSNKVNPSWNWSNTITRMLYANNQTMLVVSSESS--STADLTIFNLRNMTTIANETLG 894

Query: 899  VNSSINSIVSFGRNSSLLVGGDFTAPXXXXXXXXXXXXXXXQWSS-FSNKFDGTITGLEF 957
             N+ ++++V+F +NSS+LVGGDF                   WS+ F+N   G +T L  
Sbjct: 895  SNAKVSALVNFEKNSSILVGGDFQITKPNCSGLCLYNYETKSWSTFFNNTIFGEVTQLSL 954

Query: 958  ANDSRLLISGSYRFENQSGISLGYIDLNNQEFKSLLSDSQ-KVNSFNYNNGTIVAWDSST 1016
            AN S L+ISG +       I LG  +LNN     LLS S+ K+NSF   + ++VAW+ ++
Sbjct: 955  ANSSELIISGLFNTREHQSIRLGSFNLNNFTMVPLLSGSEGKLNSFVVTDNSLVAWNDTS 1014

Query: 1017 IYSYRGDSWSNHQIPNTNSSTSIKNVQIVSKXXXXXXXXXXXXXXXDE--LILVFGELYS 1074
            ++ Y    W+   +P+ +S   I +V  +S                 +  ++L+ G    
Sbjct: 1015 LFIYGNQKWNITSLPSDDS--LIGSVSTISTNTKSDTLNKRATNNAHDGSILLLNGNFTM 1072

Query: 1075 EDYGFVQAMFYDFQNWIPYYITQPYSSLNTSKNSLFMNKDISLLYESQVVLQNPNXXXXX 1134
              YG +Q++ +DFQ W PY+I++  +S N +  + F+N+D+S  + SQ+ L N N     
Sbjct: 1073 PQYGNLQSLLFDFQAWTPYFISEISNSSNYNP-TFFINRDVSTEFNSQITLPNLNITVTN 1131

Query: 1135 XXXXXXXXXXXXXXXXXXXLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIF 1194
                                     + KI RG+VVLIGLALA+GTV++LGI GV +AY+F
Sbjct: 1132 PQSTSSQSPSTSATSESKSKS---EKKKIDRGFVVLIGLALALGTVSVLGIVGVILAYVF 1188

Query: 1195 SDDKGEYVRIKPRIDEHEMLDTVPPEKLMKFI 1226
             D +G+Y  IKPRIDE+EMLDTVPPEKLMKF+
Sbjct: 1189 KDPEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>TDEL0F03830 Chr6 complement(701362..704949) [3588 bp, 1195 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1195

 Score =  860 bits (2223), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 496/1223 (40%), Positives = 717/1223 (58%), Gaps = 49/1223 (4%)

Query: 14   IGVSQASQLTNVKDSLGINTVNIPQINFGNTNNEIQILSNIEGLTFYQYQGQQNFTGSID 73
            + +S ASQL N+K+  GI  +  P+++F      +Q+      LTF QY+GQ+NFTG+I+
Sbjct: 12   VCLSLASQLENLKNKHGIVNIGTPRLDF--PGEALQLFGGFNALTFPQYEGQENFTGTIN 69

Query: 74   TNSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTLGGFQLENQLLYNL 133
             N+++ G++YYSNDT IKL+ GS ++ +++IVP   ++FIL GSG+L G++L  QLLYNL
Sbjct: 70   NNTDSRGIVYYSNDTFIKLINGSSDSYVEKIVPFGSESFILGGSGSLLGYELGRQLLYNL 129

Query: 134  SDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISWNKVTKNVDMLPFI 193
            SDLS+ P+F N L +++ IL D  + YFGGNFS+ + +   +S+ +WN  +    +LPF 
Sbjct: 130  SDLSLRPIFENSLTDVRVILEDYPVAYFGGNFSFDNGSTVGHSVATWNSSSNTTSLLPFG 189

Query: 194  GFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVXXXXXXXXXXXXXXXXXXXXXXXXX 253
            GFG+ S VNSI+KLD DN+LF G+F TLDD++LL+                         
Sbjct: 190  GFGEESIVNSIIKLDSDNILFTGEFYTLDDQTLLITNENTSKTNHSQSIEINEL------ 243

Query: 254  QISLKYASW-ASLGDLKSSTQFICPNGQNEAWSSAGTTGEITCNLAFEASLSKIRIFNSP 312
             + L+ A+W         S+ FICPN Q EAWS   T+G +  +L +E+   K+RI+NSP
Sbjct: 244  -LPLRAATWNTDSDSSFDSSAFICPNSQKEAWSVPSTSGSLEASLPYESYPKKVRIYNSP 302

Query: 313  YEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQXXXXXXXXXXXX 372
             E + ++ FRI+T PSNGIMNLTY+DPL+ E+  CDAFCPL   ++L+            
Sbjct: 303  EEHNAVSLFRIITKPSNGIMNLTYVDPLSGELLNCDAFCPLMLQDSLKAAVANGNTSQVV 362

Query: 373  XXFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGFQLYQNSYSIFAN 432
               ++ N T+I WS DYQ+FAFVN++ VT LQ +AL+SYGD VGLS FQLYQ++ + +AN
Sbjct: 363  R--LDNNLTDIQWSYDYQDFAFVNKIAVTDLQFLALSSYGDAVGLSSFQLYQDTLTTYAN 420

Query: 433  NSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPGDDPSPLVNFYPSINRIGN 492
            NSLNE  C+S N +  +S LS++ W QGL  QSY+   +  G +  P V FYP+IN  G 
Sbjct: 421  NSLNEVGCES-NDIASTSALSDSEWQQGLFGQSYLVADFRTGQETLPKVTFYPAINYAGQ 479

Query: 493  YTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLFEGFLDYA 552
            YT+N+YTPGC+ D TC+ R IVNVT+W      ++S+ L++QNN  MKYDQ++ G L+ A
Sbjct: 480  YTMNLYTPGCSSDQTCTSRSIVNVTMWSEVGGSILSSILLHQNNEAMKYDQVYSGHLETA 539

Query: 553  PKVTLEYYSGINDENSPXXXXXXXXXXXPINIELDETIGNVTSSTEELK------VPLNG 606
            P +TLEYYS I+  N             P N+ + + +  +  S + LK      +PLNG
Sbjct: 540  PVLTLEYYSPISPNN-------------PSNVVVADRLEVIVESVDILKNQTDETIPLNG 586

Query: 607  MFQYQLXXXXXXXXXXXLKVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLGGSIAGVYAL 666
            MFQYQL             + NT+LN + V  F  + SL+   YN TL +GGS++GV A+
Sbjct: 587  MFQYQLSNFTNSTDSKP-SIANTTLNSYTVQNFPKNASLFSSMYNNTLWVGGSVSGVAAV 645

Query: 667  SLSNYTNIRSTRIXXXXXXXXXXXXXXXXXXLFGNFNISNRIVSSLSYNGTFDSFGNVNS 726
             L    ++ ST                    LFG FN+S++ VS+L++NG F SFGN+ +
Sbjct: 646  ELDEDLHVSSTAKYATGGTVEGISSYSDGIILFGTFNLSSQPVSTLTFNGVFGSFGNLET 705

Query: 727  NIATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTLFSGLIT 786
             + T++N++F + E+L FNNEY FN S++SYI N+S   LS+WSAG N F DTLFSG +T
Sbjct: 706  TLRTYTNVSFQQDELLVFNNEYVFNLSSNSYISNSSTFGLSLWSAGRNQFDDTLFSGAVT 765

Query: 787  RNEFPNLNNSAVLTGNGTAQSLQLRNGIQPYLGVYLNDSLTAYLYDSSSNSNILFSNGLQ 846
            +N+FP L  SA +  N +     L+NG QPY   +LNDS+TAY Y   S S + F NG +
Sbjct: 766  KNQFPGLYGSASIYSNSSVAHFSLQNGAQPYAACHLNDSVTAYAYRYGSVSQLYFDNGKE 825

Query: 847  GNWNLPRSVSSAYYSDNETMF-VGSSLSNGDSGAELFVLNFTTMDLLYNETFDVNSSINS 905
            G W    +++S  YS N T+  +G+  S  +    LF  N T+ D+L N T   N +I+S
Sbjct: 826  GPWTWFGTINSMRYSKNSTILAIGTDGSTDEPILSLF--NLTSFDVLANTTISENGTISS 883

Query: 906  IVSFGRNSSLLVGGDFTAPXXXXXXXXXXXXXXXQWSSFS-NKFDGTITGLEFANDSRLL 964
            +V F RNSSLLVGGD+                  QW+ F+ N   G IT ++ +    LL
Sbjct: 884  MVFFDRNSSLLVGGDYHISDADCSGLCLYNYDQKQWTKFANNSITGNITEMQLSESYDLL 943

Query: 965  ISGSYRFENQSGISLGYIDLNNQEFKSLLSDSQ-KVNSFNYNNGTIVAWDSSTIYSYRGD 1023
            ISG+    N++ ++L   +++N E   L+ DS   + SF   +  I+ W+ +++  Y   
Sbjct: 944  ISGAMNVANKTSVNLLSFNMSNYEVNPLVWDSNGPIKSFIAEDNDIITWNETSLSGYSDG 1003

Query: 1024 SWSNHQIPNTNSSTSIKNVQIVSKXXXXXXXXXXXXXXXDELILVFGELYSEDYGFVQAM 1083
             W N +  N   S+ I  V +++                 + ILV G+ Y+E   + QA 
Sbjct: 1004 DWQNLEFDN---SSLISIVDVIAVKTEPALDKRQTFSSTFDAILVAGQNYAE---YPQAS 1057

Query: 1084 FYDFQNWIPYYITQPYSSLNTSKNSLFMNKDISLLYESQVVLQNPNXXXXXXXXXXXXXX 1143
             Y+FQ W+PYY+       + S+ + F N+D S LY+SQ +L +P               
Sbjct: 1058 IYNFQRWLPYYVANKADDEDPSRTTFFTNQDDSQLYDSQNLLSDPTRTTTSSSSSTTSSS 1117

Query: 1144 XXXXXXXXXXLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIFSDDKGEYVR 1203
                       K+G    KI+RG+VVLIGLALA+GTV I+GI GV +A +F+   G Y +
Sbjct: 1118 QTSPSKGSLVRKSG----KINRGFVVLIGLALALGTVVIIGITGVLLALVFNGHSG-YEQ 1172

Query: 1204 IKPRIDEHEMLDTVPPEKLMKFI 1226
            + PR DE EM+DTVPPEKL+KF+
Sbjct: 1173 VDPRADESEMIDTVPPEKLLKFL 1195

>NDAI0B02380 Chr2 complement(595444..599103) [3660 bp, 1219 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1219

 Score =  850 bits (2196), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 493/1226 (40%), Positives = 730/1226 (59%), Gaps = 26/1226 (2%)

Query: 11   LGIIGVSQASQLTNVKDSLGINTVNIPQINFGNTNNE-IQILSNIEGLTFYQYQGQQNFT 69
            L +I + QASQL+N+K+ L +  VNIP +N   +N++  Q+L +I+GL+FY+Y+GQQNFT
Sbjct: 10   LLLIHILQASQLSNIKNILNVTNVNIPTLNLTASNDDTFQLLGDIDGLSFYRYKGQQNFT 69

Query: 70   GSIDTNSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTLGGFQLENQL 129
              I   SN++GLIYYSN+TLI+L E S++T I +I P   D+FILSG+G+L G+ L NQL
Sbjct: 70   TGIIPGSNSNGLIYYSNNTLIQLEEPSNDTYIAKITPFGSDSFILSGTGSLSGYSLTNQL 129

Query: 130  LYNLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISWNKVTKNVDM 189
            LYNL+ LSI P+FN  ++ +K+IL+D  +VYFGGNF+  +     +S+I W+  + + + 
Sbjct: 130  LYNLTTLSIEPIFNTSIEEVKTILIDDSLVYFGGNFTVLNGTSNIHSLIMWDSTSSSTEF 189

Query: 190  LPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVXXXXXXXXXXXXXXXXXXXXX 249
            L F GFG+NS +NSI+KL++DN+LF G+F TLD+   L+                     
Sbjct: 190  LNFGGFGENSIINSIVKLNDDNILFAGEFYTLDEPDFLIQNTTSSQNNIFNSTTVDIGQL 249

Query: 250  XXXXQISLKYASWASLGDLKSSTQFICPNGQNEAWSSAGTTGEITCNLAFEASLSKIRIF 309
                 + L  ++W +      S  F+CP+   E+W  +GTTG +TC L FE + +KIRI+
Sbjct: 250  -----VPLSASTWDTGESTFDSDTFVCPDTTEESWIQSGTTGSLTCKLPFEVAPTKIRIY 304

Query: 310  NSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQXXXXXXXXX 369
            NSP E +Q++ FRI+T  + GIMNLTY+DP++ E+K+CDAFCPLYS   L          
Sbjct: 305  NSPNEDNQVSLFRILTNEAQGIMNLTYIDPISHELKHCDAFCPLYSKAILSQAYANTTSP 364

Query: 370  XXXXXFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGFQLYQNSYSI 429
                  +  N T+I W+ ++QEFAF+NQ+ V+++Q +AL SYG+NV LS FQLYQN+Y++
Sbjct: 365  SDTIHLLADNTTDIKWTQEFQEFAFINQISVSSVQFVALDSYGNNVALSSFQLYQNAYAV 424

Query: 430  FANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPGDDPSPLVNFYPSINR 489
            FAN++LNEP C+S  +   SS  +N+ W  GL  Q+YI+T YTP  DP P V+F P I  
Sbjct: 425  FANDTLNEPNCNSIESSSSSSLSAND-WEMGLTGQTYISTTYTPNQDPVPYVSFSPQIKY 483

Query: 490  IGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLFEGFL 549
             G Y++NIYTPGCT D TCS R IVNVT+WD+    +++T LIYQNN E+KYD+L+ G+L
Sbjct: 484  PGQYSINIYTPGCTQDDTCSSRAIVNVTVWDSDGTSILATELIYQNNKELKYDELYSGYL 543

Query: 550  DYAPKVTLEYYSGINDENSPXXXXXXXXXXXPINIELDETIGNVTSSTEELKVPLNGMFQ 609
              +P+VT+EY SG+   N+              ++E+     N T++TE +   LNG+ Q
Sbjct: 544  SSSPRVTIEYVSGLYASNTVATVVADRLNVLIDSLEVPGLTSNGTNNTEIMN--LNGLLQ 601

Query: 610  YQLXX-XXXXXXXXXLKVDNTSLNLFPVSRFSSSVSLYGVEYNE-TLLLGGSIAGVYALS 667
            YQ+            +K+ NTSLN   + +FS + S+Y   Y++ TLLLG S  G+  + 
Sbjct: 602  YQISNFSTSSSETTDVKITNTSLNQLSLEQFSKNTSMYADLYDDNTLLLGNSNGGIKVVK 661

Query: 668  LSNYTNIRSTRIXXXXXXXXXXXXXXXXXXLFGNFNISNRIVSSLSYNGTFDSFGNVNSN 727
            L+   +I S+                     +G +N+S++I   ++YNGTF+   N N N
Sbjct: 662  LNENMDIESSNEASLTGNTAGFSSYSGGILAYGEYNLSSKITYLVNYNGTFNEIPNFNKN 721

Query: 728  --IATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTLFSGLI 785
              I    NLT  ++E+L  +N+  +N S+SS I N+SAL LS+WS+GSN   DT+FSG I
Sbjct: 722  SSITNVVNLTIHDTELLVIDNQAIYNVSSSSTITNSSALQLSLWSSGSNLNRDTVFSGAI 781

Query: 786  TRNEFPNLNNSAVLTGNGTAQSL--QLRNGIQPYLGVYLNDSLTAYLYDSSSNSNILFSN 843
               ++ +LN S  +  N T  ++   + +    Y G++LNDSL+ Y   + S S +LFSN
Sbjct: 782  ALLDYTDLNGSIAIGNNFTVTNITNNVSSTNSLYTGLFLNDSLSIYASKTDSYSELLFSN 841

Query: 844  GLQGNWNLPRSVSSAYYSDNETMFVGSSLSNGDSGAELFVLNFTTMDLLYNETFDVNSSI 903
            G    W+    ++   YS ++TM   +S S+ +  +EL +LN TT + + NET +VNS I
Sbjct: 842  GYSAPWSFFEGINYMVYSSHQTMLAVAS-SDFNKNSELSILNLTTFETIANETLNVNSKI 900

Query: 904  NSIVSFGRNSSLLVGGDFTAPXXXXXXXXXXXXXXXQWSSFSNK-FDGTITGLEFANDSR 962
            N +++F  NS+L+VGG+FT                 +W +F+N   +GTI  +E  N ++
Sbjct: 901  NGLINFEHNSTLIVGGNFTILQSNCSGLCLYNYDSNEWLTFANHSINGTIAQMELINGTQ 960

Query: 963  LLISGSYRFENQSGISLGYIDLNNQEFKSL-LSDSQKVNSFNYNNGTIVAWDSSTIYSYR 1021
            LL+SG +  +N S ++L  +DL+     S+ + D+  + SF      I+ W+   + SY 
Sbjct: 961  LLLSGLFNAQNISSVNLAIMDLSTYAVSSIKMGDANILQSFATIGDKIITWNGIMLESYE 1020

Query: 1022 GDSWSNHQIPNTNSSTSIKNVQIVSKXXXXXXXXXXXXXXXDELILVFGELYSEDYGFVQ 1081
              +WS  Q  N NSST+I++++ +                  +  ++ G +Y  +YG +Q
Sbjct: 1021 NGAWSTIQ-SNFNSSTTIRSIEPIG---FGPTLQKRDGTGSADGFIINGNIYDTEYGTIQ 1076

Query: 1082 AMFYDFQNWIPYYITQPYSSLNTS-KNSLFMNKDISLLYESQVVLQNPNXXXXXXXXXXX 1140
            AM Y+F+ W PYYI    SS N+     +FMN+D S LY SQ VLQNPN           
Sbjct: 1077 AMIYNFKEWRPYYII---SSTNSQIAGQIFMNRDDSALYNSQSVLQNPNNATVTTPSSTS 1133

Query: 1141 XXXXXXXXXXXXXLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIFSDDKGE 1200
                          +      KI RG+VVLIGLALA+GTV++LGI G+ +AYIF D  G 
Sbjct: 1134 SGTPSATHSSQPHHQKQVGRKKIDRGFVVLIGLALALGTVSLLGIIGLVLAYIFKDGDGS 1193

Query: 1201 YVRIKPRIDEHEMLDTVPPEKLMKFI 1226
            +  + PR +E EML+TVPPEKLMKF+
Sbjct: 1194 HDALNPRTNEDEMLETVPPEKLMKFL 1219

>ZYRO0C01804g Chr3 (140029..143658) [3630 bp, 1209 aa] {ON} similar to
            uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1209

 Score =  847 bits (2188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 463/1223 (37%), Positives = 722/1223 (59%), Gaps = 34/1223 (2%)

Query: 13   IIGVSQASQLTNVKDSLGINTVNIPQINFGNTNNE-IQILSNIEGLTFYQYQGQQNFTGS 71
            ++ ++  SQL++++  L  + + +P+++  ++ N+ +++L + + LTFY+Y GQ+NFT  
Sbjct: 12   LLAITNGSQLSHLQQLLNASNIQVPKLDLTSSRNQALELLGDFQDLTFYKYTGQENFTSP 71

Query: 72   IDTNSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTLGGFQLENQLLY 131
            +++++++HGLIYYSNDT ++L  GS++T I QIVPL ED+FILSGSG + G+ L+ QL Y
Sbjct: 72   LNSSTDSHGLIYYSNDTFLQLANGSNDTDIKQIVPLGEDSFILSGSGHIDGYNLQRQLHY 131

Query: 132  NLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISWNKVTKNVDMLP 191
            NL+DLS  P+F   L  + SILVD+ +VYFGGNF++++ ++T +S++ WN    +  +LP
Sbjct: 132  NLTDLSFKPIFQEGLTEVNSILVDQPLVYFGGNFTFSNGSQTGHSVVLWNSEKNSTSLLP 191

Query: 192  FIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVXXXXXXXXXXXXXXXXXXXXXXX 251
            FIGFG+NSTVNSI++LD DN+LF G+F  LDD  LL                        
Sbjct: 192  FIGFGQNSTVNSIIRLDRDNILFAGNFYELDDVKLL---ENHILGSNNSSSKSNWTDVEL 248

Query: 252  XXQISLKYASWASLGDLKSSTQFICPNGQNEAWSSAGTTGEITCNLAFEASLSKIRIFNS 311
               I L+ A+W S      +  FICP+ + E+W  +GT+G + C+L  E +  KIRI+NS
Sbjct: 249  GLAIPLQNANWTSSSSQFDADDFICPDPERESWLQSGTSGSLACSLPQETTPYKIRIYNS 308

Query: 312  PYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQXXXXXXXXXXX 371
            P E ++++ FRI+  P+ GI+NL+Y+DP   E++YCDAFCPLY+   L+           
Sbjct: 309  PVEDNEVSLFRILAEPTKGILNLSYVDPEEGELRYCDAFCPLYNRQRLEEASSNSSSVEN 368

Query: 372  XXXFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGFQLYQNSYSIFA 431
               F + N T+I W  D+QEFAFVN VP+++++ +AL+SYG NVGLS +Q +Q+  SI+A
Sbjct: 369  MTTFSDNNTTDIKWGRDFQEFAFVNNVPISSVEFVALSSYGSNVGLSSWQFFQSRASIYA 428

Query: 432  NNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPGDDPSPLVNFYPSINRIG 491
            NNSLN+PAC    +   ++ +SNN W QGLN Q+Y++T Y       P V F+P I   G
Sbjct: 429  NNSLNQPACGKMQSY-SNATISNNDWRQGLNGQTYLSTSYVEDQGNIPRVTFHPQIQYPG 487

Query: 492  NYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLFEGFLDY 551
            NY++ +YTPGC GDGTC+ R IVNVTLWD  +N+ +S+ +IY+NNNE+KYD+L++G L  
Sbjct: 488  NYSIKLYTPGCLGDGTCNQRAIVNVTLWDGDSNEPLSSEVIYENNNELKYDELWDGHLKS 547

Query: 552  APKVTLEYYSGINDENSPXXXXXXXXXXXPINIELDETIGNVTSSTEELK-----VPLNG 606
            +PKVTLEY+S I   N             P ++ + + I     S +  +     + LNG
Sbjct: 548  SPKVTLEYHSPIYPNN-------------PTSVVVADYISLEAKSFDHFEKHKKDITLNG 594

Query: 607  MFQYQLXXXXXXXXXXXLKVDNTSLNLFPVSRFSSSVSLYGVEY-NETLLLGGSIAGVYA 665
            +FQYQ+             + NTSL++FP+S FS++ SL+   Y N+TLLL  S +    
Sbjct: 595  IFQYQISNFTKNITKE--SIGNTSLDVFPLSYFSNNSSLFASLYENDTLLLADSKSKAAE 652

Query: 666  LSLSNYTNIRSTRIXXXXXXXXXXXXXXXXXXLFGNFNISNRIVSSLSYNGTFDSFGNVN 725
            + L    ++ S++                   LFG++N S R   +LS+NG+F+S+  +N
Sbjct: 653  IKLDKNWSVDSSKSFNLASQVRGIGSYSDGLILFGDYNSSQRQPLALSFNGSFNSYDKIN 712

Query: 726  SNIATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTLFSGLI 785
             ++  F+N+    +E+L F+NE+F+N S+ SY+ NT+  SLS+WSAG N  GD +FSG +
Sbjct: 713  RSVERFTNIDLKGTELLVFDNEFFYNVSSQSYVSNTTRFSLSVWSAGQNTNGDLIFSGAV 772

Query: 786  TRNEFPNLNNSAVLTGNGTAQSLQLRNGIQPYLGVYLNDSLTAYLYDSSSNSNILFSNGL 845
            + N++ NL     L  NG+A S  +++ I PY+G YLND+LTAY Y   S+S I+FSNG 
Sbjct: 773  SDNDYENLQGPVSLFQNGSAVSSNIKDNINPYMGAYLNDTLTAYAYKDGSDSRIVFSNGD 832

Query: 846  QGNWNLPRSVSSAYYSDNETMFVGSSLSNGDSGAELFVLNFTTMDLLYNETFDVNSSINS 905
            +G W    S+ +  Y + + +    + S+  S  +L VLN TT ++L NET D  + +NS
Sbjct: 833  EGPWRWTNSIETMIYRNRDALLALGTSSS-PSLPQLSVLNLTTSEVLANETLDKGAEVNS 891

Query: 906  IVSFGRNSSLLVGGDFTAPXXXXXXXXXXXXXXXQWSSFSN-KFDGTITGLEFANDSRLL 964
            ++ FG+NS+LL+GG+F+                 +WS+F+N    G +T ++  N S LL
Sbjct: 892  MILFGKNSTLLIGGNFSFSDAHCNGLCLYNYKNKRWSTFANDSITGQVTQVQLRNSSELL 951

Query: 965  ISGSYRFENQSGISLGYIDLNNQEFKSLLSDSQ-KVNSFNYNNGTIVAWDSSTIYSYRGD 1023
            I+GS R    S ++L  +++  Q  K+LL   +  + SF  +   +V W+ +++ +Y   
Sbjct: 952  IAGSLRVNGTSDVNLVSVNITGQGMKTLLRGWEGPLRSFVVSEDRLVVWNDTSLMAYDNT 1011

Query: 1024 SWSNHQIPNTNSSTSIKNVQIVSKXXXXXXXXXXXXXXXDELILVFGELYSEDYGFVQAM 1083
            SW +    N+ S T ++++  VS                 + +LV+G   ++   + QA 
Sbjct: 1012 SWRHISTSNSTSFTKLQDIHQVSLEHSLEKRANSSSNSNLDGLLVYGNDKTQGDSY-QAS 1070

Query: 1084 FYDFQNWIPYYITQPYSSLNTSKNSLFMNKDISLLYESQVVLQNPNXXXXXXXXXXXXXX 1143
             YD+ +W P +I    S  + S  ++FMN+D+S  + S+ +L NP               
Sbjct: 1071 IYDYYSWTPLFIANSKSENSNSGPNIFMNQDVSDFFISEQMLPNPTNHTSSRSSSSSSSA 1130

Query: 1144 XXXXXXXXXXLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIFSDDKGEYVR 1203
                       K      K+ RGYVVLIGLALAIGTV ++G+FG+ +AY+F +D G Y  
Sbjct: 1131 VTSNSGD----KKHRASHKVDRGYVVLIGLALAIGTVVVIGVFGILIAYMFGEDIGGYEF 1186

Query: 1204 IKPRIDEHEMLDTVPPEKLMKFI 1226
            + P  +  +  +T PP K  KF+
Sbjct: 1187 LSPPAEGTKAAETAPPAKSSKFL 1209

>TPHA0B03250 Chr2 (745716..749363) [3648 bp, 1215 aa] {ON} Anc_8.256
            YLR084C
          Length = 1215

 Score =  843 bits (2179), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 486/1232 (39%), Positives = 716/1232 (58%), Gaps = 25/1232 (2%)

Query: 1    MLATIVRLISL-GIIGVSQASQLTNVKDSLGINTVNIPQINFGNTNNEIQILSNIEGLTF 59
            +++TIVRL+ L  +   + AS L+N+   L I    +P +NF NT+N IQ+L ++E L F
Sbjct: 3    IISTIVRLVVLFSLANNATASSLSNILKLLNIQEFELPNLNFNNTSNSIQLLGDVENLQF 62

Query: 60   YQYQGQQNFTGSIDTN-SNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSG 118
            Y Y+GQQNFT   ++  S+T+ LIYYS+D LI+L  GS++T I +I+P+ +D+F+LSGSG
Sbjct: 63   YHYEGQQNFTDDGNSGISSTNNLIYYSDDVLIQLEVGSNDTDIQKIIPVGDDSFVLSGSG 122

Query: 119  TLGGFQLENQLLYNLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSII 178
             L G+ L  QLLYNL+ LSI P+F+  L NI SILVD++IVYFGG F+Y + ++ ++S+I
Sbjct: 123  HLNGYALGRQLLYNLTTLSIKPIFDQDLGNITSILVDEEIVYFGGEFTYQTRSQNSSSVI 182

Query: 179  SWNKVTKNVDMLPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVXXXXXXXXXX 238
            SWN  +  V  LPF GFG +S VNSILKL++DN+LF G F TL + SLL           
Sbjct: 183  SWNMTSDEVIELPFQGFGSDSKVNSILKLNDDNILFVGMFDTLGNSSLLTYNTTSNFSNF 242

Query: 239  XXXXXXXXXXXXXXXQISLKYASWASLGDLKSSTQFICPNGQNEAWSSAGTTGEITCNLA 298
                           QISLKYA+W +         F+C  G +EAW   G +G +  N  
Sbjct: 243  TNSTENSSTIQLEQ-QISLKYATWDAGTAYFDQNNFVCEAGSSEAWIVEGRSGNLQLNFP 301

Query: 299  FEASLSKIRIFNSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNA 358
               S SKIRI+N+   +D ++ FRIVT+PSNGIMNLTY+DPLT ++KYCDAFCPL +S+ 
Sbjct: 302  NTVSPSKIRIYNANTAEDGVSLFRIVTSPSNGIMNLTYVDPLTGQLKYCDAFCPLLNSSG 361

Query: 359  LQXXXXXXXXXXXXXXFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLS 418
            L+              FIN N T++ WS  YQEFAF+N + V+AL +IA  SYG    LS
Sbjct: 362  LETASSNSTSETRQRVFINNNTTSVTWSESYQEFAFINNIDVSALTLIAQDSYGSKTALS 421

Query: 419  GFQLYQNSYSIFANNSLNEPACDSPNT-VIPSSYLSNNIWYQGLNSQSYIATKYTPGDDP 477
            G +L+Q+S++ +ANN+LN+P CD+ +T +  SS LS+N WY+GL+S SYIA  Y     P
Sbjct: 422  GIELFQDSHTAYANNTLNQPGCDTESTSLFSSSVLSDNGWYKGLDSDSYIAANYQSDSSP 481

Query: 478  SPLVNFYPSINRIGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNN 537
             P V FYP+I  +G++++ +YTPGC  DGTC  R IVNVT+ D     ++ST LIYQNNN
Sbjct: 482  LPTVQFYPNIQAVGDFSIKMYTPGCLADGTCESRSIVNVTVLDPTDGTVLSTQLIYQNNN 541

Query: 538  EMKYDQLFEGFLDYAPKVTLEYYSGINDENSPXXXXXXXXXXXPINIELDETIGNVTSST 597
            EMKYD++F G L  +P++TL +YS I  +              P  I +D+ +  + S+ 
Sbjct: 542  EMKYDEIFNGKLTVSPEITLTFYSTILPDLDSAIIVADRVDLTPTYINVDDIL--LDSNL 599

Query: 598  EELKVPLNGMFQYQLXXXXXXXXXXXLKVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLG 657
            +   + LNG+FQYQL            KV N S++   +S+F SSVSL G  +N ++ L 
Sbjct: 600  KSTSLKLNGLFQYQLSNFTSDTKT---KVGNNSIHQLALSQFPSSVSLIGNTFNNSIFLA 656

Query: 658  GSIAGVYALSLSNYTNIRSTRIXXXXXXXXXXXXXXXXXXLFGNFNISN-RIVSSLSYNG 716
            GS + +  L L++   +R+T +                   FG +NIS+  +V +LS+NG
Sbjct: 657  GSTSNIVQLQLNSDLELRNTVVVDNGGETTRIENYSQGLLFFGQYNISSTNVVDNLSFNG 716

Query: 717  TFDSFGNVNSNIATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDF 776
            TF SF  +  N+ TF+N T+  SE+L FNN+Y +N S+ SYI+N +  + S+ + G+N  
Sbjct: 717  TFSSFSQLGDNVTTFANFTYEGSELLFFNNDYLYNVSSESYIYNNTMFTASVLATGANSN 776

Query: 777  GDTLFSGLITRNEFPNLNNSAVLTGNGTAQSLQLRNGIQPYLGVYLNDSLTAYLYDSSSN 836
             DTL  G I R+E+ N N    L GN + +SL   + I PY  V+LND+   Y Y    N
Sbjct: 777  NDTLLLGNIVRSEYSNFNEPLKLYGNSSLESLTFSSSIVPYAAVFLNDTANLYAYKDGEN 836

Query: 837  SNILFSNGLQGNWNLPRSVSSAYYSDNETMFVGSSLSNGDSGAELFVLNFTTMDLLYNET 896
            S I++ N +  + +   +++   +S+N ++   ++++N  S + L + N +    L +E 
Sbjct: 837  SKIIYGNNMTTSLDFSGTLNKLSFSNNSSLLFANAITNNGSSS-LVISNISDGMSLASEN 895

Query: 897  FDVNSSINSIVSFGRNSSLLVGGDFTAPXXXXXXXXXXXXXXXQWSSFSNK-FDGTITGL 955
             +    I S++ F  N+++LV G+FT                 +WS+F+N    G+I  +
Sbjct: 896  LNNYGYITSMIDFNSNNTILVSGNFTLDDVDCHGICLYNYFTKKWSAFANSTIKGSIVEM 955

Query: 956  EFANDSRLLISGSYRFENQSGISLGYIDLNNQEFKSLLSDSQ-KVNSFNYNNGTIVAWDS 1014
            +  N  ++LISG +  +N S I+L  +D+       L  DS+ +++SF ++  +I  W +
Sbjct: 956  QLWNSDQILISGLFSAQNYSSITLASLDIKGYNISVLSDDSKIEISSFIHDGQSITVWSN 1015

Query: 1015 STIYSYRGDSWSNHQIPNTNSSTSIKNVQIVSKXXXXXXXXXXXXXXXDELILVFGELYS 1074
             TI  Y+ + W+    PNT +S  I++V+ VS                 +++  +GE  S
Sbjct: 1016 DTIMEYKSEKWNEISFPNT-TSKYIESVEAVS------IDLQNSTSNVSKILFAYGEFNS 1068

Query: 1075 EDYGFVQAMFYDFQNWIPYYITQPYSSLNTSKNSLFMNKDISLLYESQVVLQNPNXXXXX 1134
              YG + AM +   +W PY+    +        +LF N+D+S L+ S+  L  P      
Sbjct: 1069 TLYGRLNAMLFRAGDWKPYFSINNFQVNEDPAITLFENRDLSSLFNSKNSL--PANITSA 1126

Query: 1135 XXXXXXXXXXXXXXXXXXXLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIF 1194
                               ++     SKI RG+VVLI LALA+GTVA+LG+FGVT+AYIF
Sbjct: 1127 ETSSRSTVSSATATTVVNKIEGK--HSKIDRGFVVLIALALAVGTVALLGLFGVTIAYIF 1184

Query: 1195 SDDKGEYVRIKPRIDEHEMLDTVPPEKLMKFI 1226
             D++ +Y  IKPRID  EMLDTVPPEKLMKFI
Sbjct: 1185 RDEQ-KYESIKPRIDGQEMLDTVPPEKLMKFI 1215

>Suva_10.168 Chr10 complement(301631..305293) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  843 bits (2178), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/1224 (39%), Positives = 702/1224 (57%), Gaps = 21/1224 (1%)

Query: 8    LISLGIIGVSQASQLTNVKDSLGINTVNIPQINFGNTN-NEIQILSNIEGLTFYQYQGQQ 66
            L++LG    S+ASQL ++K  L I    +P +N    N N IQIL  ++ L+FY+Y GQQ
Sbjct: 13   LLTLG----SKASQLQSIKALLDIEDNVLPSLNISQDNDNAIQILGGVDALSFYEYTGQQ 68

Query: 67   NFTGSIDTNSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTLGGFQLE 126
            NFT  I + +N+ GL+YYSN+T I L E  ++T+ID+I P   D+FILSGSG++ G  L 
Sbjct: 69   NFTKEIGSETNSRGLVYYSNNTYILLEEADEDTRIDKITPFGADSFILSGSGSINGVPLG 128

Query: 127  NQLLYNLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISWNKVTKN 186
            NQ+LYNLS LS+  +F   L +++++LV+   VYFGGNFSY + + T +  + W+  +  
Sbjct: 129  NQVLYNLSTLSMARIFTQSLGSVEAVLVNDTSVYFGGNFSYNNGSMTGHGALVWDSTSNT 188

Query: 187  VDMLPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVXXXXXXXXXXXXXXXXXX 246
              +LPF GFG++S VNSI+KL++DN+LF G F TLDD S                     
Sbjct: 189  TQLLPFGGFGEDSNVNSIVKLNDDNILFAGKFYTLDDSS---ILTTSSTNTTNASSTLNA 245

Query: 247  XXXXXXXQISLKYASWASLGDLK-SSTQFICPNGQNEAWSSAGTTGEITCNLAFEASLSK 305
                   +I L+YASW S G     S+  +CP+   +AW   GT+G + C L +E + +K
Sbjct: 246  TTLELGQRIPLRYASWDSQGSTTFESSYLVCPDTSKDAWLYPGTSGSLVCTLPYEVAPTK 305

Query: 306  IRIFNSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQXXXXX 365
            IR++NSP   + I+ F+I+T PS  IMNLTYLDP++ E++ CD FCPLYS + L      
Sbjct: 306  IRLYNSPNSDNDISLFQILTNPSGSIMNLTYLDPISGELQSCDEFCPLYSRDTLLSASQN 365

Query: 366  XXXXXXXXXFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGFQLYQN 425
                     FI+ N T++ WS+D+Q+FAF N++ VT+L+  AL SYG+ VGLSG +LYQ+
Sbjct: 366  VSSSLDMISFIDNNNTDVKWSSDFQDFAFANELSVTSLKFTALNSYGNKVGLSGLELYQD 425

Query: 426  SYSIFANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPGD-DPSPLVNFY 484
            ++S +ANNSLNE  C +      SS LS+N WY GL  QSYIA  Y P    P+P V FY
Sbjct: 426  TFSTYANNSLNEYGCSALANDSSSSILSDNKWYDGLTGQSYIAIDYVPNQTKPTPTVTFY 485

Query: 485  PSINRIGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQL 544
            PSI   G+YT+N YTPGC  D TCS RGIVNVT+W+   N ++ T LIYQNNN +KYD++
Sbjct: 486  PSIIHPGHYTINTYTPGCVQDNTCSSRGIVNVTMWNPQNNTMMETYLIYQNNNNLKYDKI 545

Query: 545  FEGFLDYAPKVTLEYYSGINDENSPXXXXXXXXXXXPINIELDETIGNVTSSTEELKVPL 604
            + G+LD++P++ ++Y SGI   N+              +++   ++   TS       PL
Sbjct: 546  YSGYLDFSPEIVMKYVSGIYASNTATIMVADQVNIITDSLDSFSSLSETTSVKRH--TPL 603

Query: 605  NGMFQYQLXXXXXXXXXXXLKVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLGGSIAGVY 664
            NG+ QYQ             K+ NT+LNLF V  +  + S++   Y++ L+LGG    + 
Sbjct: 604  NGILQYQRSNFTATTSNGT-KIANTTLNLFSVDNYPKNSSMFADVYDKKLILGGKDNHIS 662

Query: 665  ALSLSNYTNIRSTRIXXXXXXXXXXXXXXXXXXLFGNFNISNRIVSSLSYNGTFDSFGNV 724
             +  ++   + S+                    +FG+   S+   + L +NG+F+S  N 
Sbjct: 663  VIDFNDNLEVTSSENKTIQGDVYGMTQTNQGLLIFGDVRSSDNKSTVLMFNGSFESVSNY 722

Query: 725  NSNIATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTLFSGL 784
            +  +    N+T   ++++ FNN+Y FN S++S I N+++ SLS+WSAG+ND  D LFSG 
Sbjct: 723  SKAVENAINITLANNDLIVFNNDYIFNASSNSQISNSTSFSLSLWSAGNNDNDDVLFSGA 782

Query: 785  ITRNEFPNLNNSAVLTGNGTAQSLQLRNGIQPYLGVYLNDSLTAYLYDSSSNSNILFSNG 844
            +++ +F +L+ SA      T ++L L  GI PYLG YLN+S  AY Y ++S S I FSN 
Sbjct: 783  VSQMQFSDLSGSARFLNESTVEALNLNKGIVPYLGAYLNESTIAYAYKTNSLSKIYFSNN 842

Query: 845  LQGNWNLPRSVSSAYYSDNETMFVGSSLSNGDSGAELFVLNFTTMDLLYNETFDVNSSIN 904
            +  +WN   +++   Y++N+T+ V  S S+  + AEL +LN      + NET   N+ IN
Sbjct: 843  VSPSWNWSNNITKMVYANNQTLLVIGSESS--TTAELSILNLRNFTTIANETLGSNAKIN 900

Query: 905  SIVSFGRNSSLLVGGDFTAPXXXXXXXXXXXXXXXQWSS-FSNKFDGTITGLEFANDSRL 963
            + V+F +NSSLLVGGDF                   WS+ F+N   G IT L F N+S L
Sbjct: 901  AFVNFEKNSSLLVGGDFQMSKPNCTGLCVYNYESKSWSTFFNNTIVGEITQLAFNNESEL 960

Query: 964  LISGSYRFENQSGISLGYIDLNNQEFKSLLSDS-QKVNSFNYNNGTIVAWDSSTIYSYRG 1022
            +ISG +  E Q  I LG  +L N     LL+ S  K+NSF     +IVAW+ +++  Y+ 
Sbjct: 961  IISGLFATEKQQSIRLGSFNLTNSTMVPLLTGSGGKLNSFTVTEESIVAWNDTSLLIYKD 1020

Query: 1023 DSWSNHQIPNTNSSTSIKNVQIVSKXXXXXXXXXXXXXXXDELILVFGELYSEDYGFVQA 1082
              W+   +P   SS S       +                  ++L+ G      YG +Q 
Sbjct: 1021 QKWNTTSLPGNGSSVSSVTTIDTNTDSYALRKRATTDAEKGSILLLNGNFSIPQYGNLQG 1080

Query: 1083 MFYDFQNWIPYYITQPYSSLNTSKNSLFMNKDISLLYESQVVLQNPNXXXXXXXXXXXXX 1142
            + +D QNW PY+ ++   + ++   ++F+N+D+S  + SQ+ L N N             
Sbjct: 1081 LLFDSQNWTPYFTSETLEA-SSYNPTIFINRDVSADFNSQIPLSNSNMTVTSPQSTSPLS 1139

Query: 1143 XXXXXXXXXXXLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIFSDDKGEYV 1202
                           + +  + RG+VVLIGLALA+GTV++LGI GV +AY+F D +G+Y 
Sbjct: 1140 PSSSASSEP---NKKSKKKNMDRGFVVLIGLALALGTVSVLGIVGVILAYVFKDPEGDYR 1196

Query: 1203 RIKPRIDEHEMLDTVPPEKLMKFI 1226
             IKPRIDE+EMLDTVPPEKLMKF+
Sbjct: 1197 PIKPRIDENEMLDTVPPEKLMKFV 1220

>YLR084C Chr12 complement(296589..300251) [3663 bp, 1220 aa] {ON}
            RAX2N-glycosylated protein involved in the maintenance of
            bud site selection during bipolar budding; localization
            requires Rax1p; RAX2 mRNA stability is regulated by Mpt5p
          Length = 1220

 Score =  842 bits (2174), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 482/1230 (39%), Positives = 715/1230 (58%), Gaps = 20/1230 (1%)

Query: 5    IVRLISLG---IIGVSQASQLTNVKDSLGINTVNIPQINFG-NTNNEIQILSNIEGLTFY 60
            + RL +L    ++ +S+ASQL N+K  L I    +P +N   N +N +QIL  ++ L+FY
Sbjct: 3    VHRLWTLAFPFLVEISKASQLENIKSLLDIEDNVLPNLNISQNNSNAVQILGGVDALSFY 62

Query: 61   QYQGQQNFTGSIDTNSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTL 120
            +Y GQQNFT  I   +++HGL+YYSN+T I+L + SD+T+ID+I P   D+FILSGSGT+
Sbjct: 63   EYTGQQNFTKEIGPETSSHGLVYYSNNTYIQLEDASDDTRIDKITPFGVDSFILSGSGTI 122

Query: 121  GGFQLENQLLYNLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISW 180
                + NQ+LYNLS LS+ P+FN  L  ++++L D   +YFGGNFSY + + T  S + W
Sbjct: 123  NNISVGNQILYNLSTLSMTPIFNQSLGAVQAVLADNSSIYFGGNFSYNNGSMTGYSALIW 182

Query: 181  NKVTKNVDMLPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVXXXXXXXXXXXX 240
            + ++    +LPF GFG+NS+VNSI+KL+ DN+LF G F TLDD S L+            
Sbjct: 183  DSISNTTQLLPFGGFGENSSVNSIVKLNNDNILFAGQFYTLDDPSALI---SSSNNGTNS 239

Query: 241  XXXXXXXXXXXXXQISLKYASWASLGDLK-SSTQFICPNGQNEAWSSAGTTGEITCNLAF 299
                         +I L+YASW S G    +S   +CPN   +AW    T+G + CNL +
Sbjct: 240  TSSLNATTLELGQRIPLRYASWDSQGSTTFASDSLVCPNTNEDAWLYPDTSGSLVCNLPY 299

Query: 300  EASLSKIRIFNSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNAL 359
            E S +KIR++NS     +I+ F+I+T PS+ IMNLTYLDPL+ E+K C  FCPLYS   L
Sbjct: 300  EVSPTKIRLYNSQRSDSEISVFQILTDPSSSIMNLTYLDPLSGELKNCGEFCPLYSRATL 359

Query: 360  QXXXXXXXXXXXXXXFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSG 419
                           FI+ NKT++ W++D+Q+FAFVN++PV++L+ +AL SYG +VGLSG
Sbjct: 360  LSASQNVSSSMDMITFIDNNKTDVKWTSDFQDFAFVNELPVSSLKFVALNSYGGSVGLSG 419

Query: 420  FQLYQNSYSIFANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPG-DDPS 478
             +LYQ+++S +AN+SLNE  C +      SS LS+N WY GL  +SYIA KY P  ++P 
Sbjct: 420  LELYQDTFSTYANDSLNEYGCSALTNDSSSSTLSSNDWYNGLTGESYIAAKYVPDQNEPI 479

Query: 479  PLVNFYPSINRIGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNE 538
            P V FYP+I   G+YT+N+YTPGC  D TCS RGIVNVT+W+   N ++ T LIYQNN+ 
Sbjct: 480  PRVKFYPNIIHPGHYTINMYTPGCLQDNTCSARGIVNVTMWNQQNNTIMKTYLIYQNNDN 539

Query: 539  MKYDQLFEGFLDYAPKVTLEYYSGINDENSPXXXXXXXXXXXPINIELDETIGNVTSSTE 598
            +KYDQ++ G+LD++P++ LEY SGI   N+             ++++   T+ +  SS  
Sbjct: 540  LKYDQIYSGYLDFSPEIVLEYVSGIYTTNTATVVVADQVNVITVSLDAFNTLSD--SSNA 597

Query: 599  ELKVPLNGMFQYQLXXXXXXXXXXXLKVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLGG 658
            + +  LNG+ QYQ             KV NT+LNLFPV  +  + SLY   Y+  L++GG
Sbjct: 598  KKETLLNGILQYQ-KSNFTSTRLNETKVGNTTLNLFPVKNYPKNSSLYADIYDNKLVIGG 656

Query: 659  SIAGVYALSLSNYTNIRSTRIXXXXXXXXXXXXXXXXXXLFGNFNISNRIVSSLSYNGTF 718
                +  + L++   + S++                   +FG+   SN   +   +NG+F
Sbjct: 657  VSNRISIVDLNDDFEVTSSKNQTIQGDVHGITKTNQGLLIFGDILSSNNQSAVFLFNGSF 716

Query: 719  DSFGNVNSNIATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGD 778
            ++  N +  + +  N++   ++ +  +N+Y  N S+++ I N+S+ SLS+W+AG+N  GD
Sbjct: 717  ENVFNQSRTVNSALNISLANNDFIVLDNDYVVNASSNALIRNSSSFSLSLWAAGNNGDGD 776

Query: 779  TLFSGLITRNEFPNLNNSAVLTGNGTAQSLQLRNGIQPYLGVYLNDSLTAYLYDSSSNSN 838
             LFSG ++  ++ NLN S         + L L  GI PYLG YLN+S TAY Y+  S + 
Sbjct: 777  VLFSGAVSHMQYGNLNGSVRFLNENEIEPLNLEGGIVPYLGAYLNESATAYAYEVDSLNK 836

Query: 839  ILFSNGLQGNWNLPRSVSSAYYSDNETMFVGSSLSNGDSGAELFVLNFTTMDLLYNETFD 898
            I FSN +  +WN    ++   Y+DN+T+   S+ S+  + AEL + +   + ++ NET  
Sbjct: 837  IYFSNEVYPSWNWSSGITQMLYADNQTLLAVSAGSS--TTAELSIFDLRNLTMIANETLG 894

Query: 899  VNSSINSIVSFGRNSSLLVGGDFTAPXXXXXXXXXXXXXXXQWSSF-SNKFDGTITGLEF 957
             N+ IN++V+F +N S+LVGGDF                   WS+F +N   G IT L F
Sbjct: 895  SNARINALVNFEKNCSMLVGGDFQMTEPNCTGLCLYNYESKTWSTFLNNTIFGEITQLSF 954

Query: 958  ANDSRLLISGSYRFENQSGISLGYIDLNNQEFKSLLSDSQ-KVNSFNYNNGTIVAWDSST 1016
             N S L+ISG +  +    I LG  +L N     LLS S+ K+NSF     +IVAW+ ++
Sbjct: 955  TNSSELIISGLFETKEYQSIRLGSFNLTNSTMIPLLSGSEGKLNSFTVTEDSIVAWNDTS 1014

Query: 1017 IYSYRGDSWSNHQIPNTNSSTSIKNVQIVSKXXXXXXXXXXXXXXXDELILVFGELYSED 1076
            ++ YR   W+   +P   SS S  +                       ++L+ G      
Sbjct: 1015 LFIYRNQEWNITSLPGNASSISSVSAIYTDIESNTLNKRGINNVNNGSILLLNGNFNISQ 1074

Query: 1077 YGFVQAMFYDFQNWIPYYITQPYSSLNTSKNSLFMNKDISLLYESQVVLQNPNXXXXXXX 1136
            YG++Q++ +DFQ W PY+I++  ++ N +   +F+N+D+S  + SQ  L N N       
Sbjct: 1075 YGYLQSLLFDFQKWTPYFISETTNTSNYNP-IIFINRDVSTEFNSQSPLANVNITVTSPQ 1133

Query: 1137 XXXXXXXXXXXXXXXXXLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIFSD 1196
                                   + KI RG+VVLIGLALA+GTV++LGI GV +AY+F D
Sbjct: 1134 STSSQPPSSSASSESKSKS---KKKKIGRGFVVLIGLALALGTVSVLGIAGVILAYVFKD 1190

Query: 1197 DKGEYVRIKPRIDEHEMLDTVPPEKLMKFI 1226
             +G+Y  IKPRIDE+EMLDTVPPEKLMKF+
Sbjct: 1191 PEGDYKPIKPRIDENEMLDTVPPEKLMKFV 1220

>Skud_12.152 Chr12 complement(279947..283609) [3663 bp, 1220 aa] {ON}
            YLR084C (REAL)
          Length = 1220

 Score =  836 bits (2159), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/1223 (38%), Positives = 716/1223 (58%), Gaps = 31/1223 (2%)

Query: 16   VSQASQLTNVKDSLGINTVNIPQINFGNTN-NEIQILSNIEGLTFYQYQGQQNFTGSIDT 74
             S+ASQL N+K  L I    +P +N    N N +QIL  ++ L+ Y+Y GQQNFT  I  
Sbjct: 17   ASKASQLQNIKSLLDIEDNVLPNLNISQDNSNAVQILGGVDALSLYEYTGQQNFTKEISP 76

Query: 75   NSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTLGGFQLENQLLYNLS 134
             +N+ GL+YYSN+T I++ + SD+T+ID+I P   D+FILSGSGT+    + NQ+LYNLS
Sbjct: 77   GTNSRGLVYYSNNTYIQVEDASDDTRIDKITPFGADSFILSGSGTINNMPIGNQILYNLS 136

Query: 135  DLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISWNKVTKNVDMLPFIG 194
             LS+ P+F+  L +++S+L++   VYFGGNFSY + + T +S + W+ ++    +LPF G
Sbjct: 137  TLSMAPIFDQPLGSVESVLINGTSVYFGGNFSYNNGSMTGHSALIWDSISNKTQLLPFGG 196

Query: 195  FGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVXXXXXXXXXXXXXXXXXXXXXXXXXQ 254
            FG+NS VNSI+KL++DN+LF G F TLDD S L+                         +
Sbjct: 197  FGENSNVNSIIKLNDDNILFAGKFYTLDDSSALI--TAGSNNTTNSTSLLNATKLELGQR 254

Query: 255  ISLKYASWASLGDLKSSTQF-----ICPNGQNEAWSSAGTTGEITCNLAFEASLSKIRIF 309
            I L+YA+W    D + ST F     +CPN   +AW    T+G + C L +E S +K+R++
Sbjct: 255  IPLRYATW----DFQGSTTFESNSLVCPNANEDAWVYPATSGTLVCKLPYEVSPTKVRLY 310

Query: 310  NSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQXXXXXXXXX 369
            NS     +I+ F+I+T PSN IMNLTYLDPL+ ++K CD FCPLYS   L          
Sbjct: 311  NSQDSDGEISVFQILTNPSNSIMNLTYLDPLSGKLKNCDEFCPLYSRATLLSASQNVSSP 370

Query: 370  XXXXXFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGFQLYQNSYSI 429
                 F++ N T++ WS+D+Q+FAF N++PVT L+  A+ SYG +VGLSG +LYQ+++S 
Sbjct: 371  MDMISFLDNNNTDVKWSSDFQDFAFANELPVTLLKFTAINSYGKSVGLSGLELYQDTFST 430

Query: 430  FANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPG-DDPSPLVNFYPSIN 488
            +ANNSLNE  C +      SS LS+N WY GL  +SYIAT+Y P  D+P+P VNFYP+I 
Sbjct: 431  YANNSLNEYGCSALANDSSSSTLSSNSWYNGLGGESYIATEYVPNQDEPTPRVNFYPNIV 490

Query: 489  RIGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLFEGF 548
              G+Y +N YTPGC  D TCS RGIVNVT+W+     ++ T  IYQNN+ +KYDQ++ G+
Sbjct: 491  HPGHYIINTYTPGCVQDHTCSSRGIVNVTMWNPQNKTMMKTYTIYQNNDNLKYDQIYSGY 550

Query: 549  LDYAPKVTLEYYSGINDENSPXXXXXXXXXXXPINIELDETIGNVTSSTEELKVPLNGMF 608
            LD++P++ LEY SGI+  N+             + ++   T+    ++ E   +PLNG+ 
Sbjct: 551  LDFSPEIILEYVSGIHTSNTATVVVADQVNVITVLLDAFSTLSESANTKE--YIPLNGVL 608

Query: 609  QYQLXXXXXXXXXXXLKVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLGGSIAGVYALSL 668
            QYQ             K+ NT+LN+F V  + ++ SL+     + L+LGG+   +  + L
Sbjct: 609  QYQ-KSNFTSTTSNETKIGNTTLNVFAVDNYPNNSSLFADTNGDRLILGGTNNHISIIGL 667

Query: 669  SNYTNIRSTRIXXXXXXXXXXXXXXXXXXLFGNFNISNRIVSSLSYNGTFDSFGNVNSNI 728
            ++   +  +                    +FG+   SN   S L +NG+F++  N +  +
Sbjct: 668  NDNLEVVLSEKQIIQGDVHGMTQTSQGLLIFGDLLSSNNQSSVLLFNGSFENVFNYSRTV 727

Query: 729  ATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTLFSGLITRN 788
             +  N++   ++++ F+N+Y  NTS+S+ I N+++ SLS+WSAGSN   D LFSG ++R 
Sbjct: 728  NSAINISLANNDLIVFDNDYIVNTSSSAQILNSTSFSLSLWSAGSNGNDDVLFSGAVSRM 787

Query: 789  EFPNLNNSAVLTGNGTAQSLQLRNGIQPYLGVYLNDSLTAYLYDSSSNSNILFSNGLQGN 848
            +F  LN SA        Q+L L N + PYL  YLN+S TAY Y+++  + I FSN +  +
Sbjct: 788  QFGGLNGSARFLSEDKVQALNLDNAVVPYLAAYLNESTTAYAYETNLLNKIYFSNNVDPS 847

Query: 849  WNLPRSVSSAYYSDNETMF-VGSSLSNGDSGAELFVLNFTTMDLLYNETFDVNSSINSIV 907
            WN   S++   Y++N+++  VGS  S   + AEL + N     ++ NET   N+ IN++V
Sbjct: 848  WNWSTSITRMLYANNQSLLTVGSESS---TTAELSIFNLKNFTMIANETMGSNAKINALV 904

Query: 908  SFGRNSSLLVGGDFTAPXXXXXXXXXXXXXXXQWSS-FSNKFDGTITGLEFANDSRLLIS 966
            +F +NSSLLVGG+F                   WS+ F+N F G IT L F+  S+L+IS
Sbjct: 905  NFEKNSSLLVGGNFQMSKPNCSGLCLYNYESKSWSTFFNNTFFGEITQLSFSAASQLVIS 964

Query: 967  GSYRFENQSGISLGYIDLNNQEFKSLLSDSQ-KVNSFNYNNGTIVAWDSSTIYSYRGDSW 1025
            G +  E    + L   +L N     LL+ ++ K+NSF     +IVAW+ +++  YR   W
Sbjct: 965  GLFDTEEYQSVRLASFNLTNSTMIPLLTGAEGKINSFVVTEESIVAWNDTSLLIYRDQEW 1024

Query: 1026 SNHQIPNTNSSTSIKNVQIVSKXXXXXXXXXXXXXXXDE--LILVFGELYSEDYGFVQAM 1083
            +   +P  +S  SI +V  ++                +   ++L+ G     DYG +Q +
Sbjct: 1025 NITSVPGNDS--SIGSVSTINTNAGPGTLNRRATNNAENGTILLLSGNFSIPDYGNLQGL 1082

Query: 1084 FYDFQNWIPYYITQPYSSLNTSKNSLFMNKDISLLYESQVVLQNPNXXXXXXXXXXXXXX 1143
             +DF+ W PY++++  ++ N +  ++F+N+D+S  + SQ+ L N N              
Sbjct: 1083 LFDFETWSPYFVSESSNTSNRNP-TIFINRDVSTEFNSQIPLSNLN---VTETGPQSASS 1138

Query: 1144 XXXXXXXXXXLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIFSDDKGEYVR 1203
                      LK  + + +I RG+VVLIGLALA+GTV++LGI GV +AY+F D +G+Y  
Sbjct: 1139 QFPSSSASSELKPKS-KKRIDRGFVVLIGLALALGTVSVLGIAGVILAYVFKDPEGDYKP 1197

Query: 1204 IKPRIDEHEMLDTVPPEKLMKFI 1226
            IKPRIDE+EMLDTVPPEKLMKF+
Sbjct: 1198 IKPRIDENEMLDTVPPEKLMKFV 1220

>NCAS0B04980 Chr2 complement(912114..915728) [3615 bp, 1204 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1204

 Score =  821 bits (2121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 507/1232 (41%), Positives = 736/1232 (59%), Gaps = 34/1232 (2%)

Query: 1    MLATIVRLISLGIIGVSQASQLTNVKDSLGINTVNIPQINFGNTNNEIQILSNIEGLTFY 60
            ML  I+ L +L +I    ASQL++++++L I  +NIP +N    +N  ++L  I+ L+FY
Sbjct: 1    MLIKIL-LGALLLIPQIYASQLSSLQENLNITHINIPNLNLTTDDNSFELLGGIDSLSFY 59

Query: 61   QYQGQQNFTGSIDTNSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTL 120
            +Y GQQNFT  I  NSN++GL YYSN+T I+L E S +++I++I+P   D+FILSG G+L
Sbjct: 60   RYTGQQNFTSGILPNSNSNGLTYYSNNTFIQLYEPSLDSRIERIIPFGSDSFILSGKGSL 119

Query: 121  GGFQLENQLLYNLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISW 180
            GG+ L NQLL+NLS  S+  +FN  L ++ SILVD  +V FGGNF+ ++N+   +S+  W
Sbjct: 120  GGYSLSNQLLFNLSSFSLKQIFNQTLDSVNSILVDGTVVCFGGNFTLSTNSLNGHSVALW 179

Query: 181  NKVTKNVDMLPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVXXXXXXXXXXXX 240
            N    +  +LPF+GFG+NS +NSI KL++DN+LF G F TLD+ +LL             
Sbjct: 180  NYTANSTSLLPFVGFGENSLINSITKLNDDNILFAGKFYTLDNSTLL---------NVVN 230

Query: 241  XXXXXXXXXXXXXQISLKYASWASLGDLKSSTQFICPNGQNEAWSSAGTTGEITCNLAFE 300
                          I L  A+W+S G       F+CP+   EAW   GT+G + CNL F+
Sbjct: 231  DTMRNISDINLGQLIPLSAATWSSTGSFFDEETFVCPDPTIEAWFQNGTSGTLNCNLPFD 290

Query: 301  ASLSKIRIFNSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQ 360
             + +KIRI+NSP   ++I+ FRI + PS  IMNLTY+DP+  ++K+CDAFCPLY+   L+
Sbjct: 291  VAPTKIRIYNSPDPDNEISLFRIFSDPSESIMNLTYIDPVLGQLKHCDAFCPLYTKQVLK 350

Query: 361  XXXXXXXXXXXXXXFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGF 420
                           +N N ++I WS D+QEFAFVNQ+  ++L+ +AL SYG NVGLS F
Sbjct: 351  SASENVTLSSEMIELLNDNTSDIRWSQDFQEFAFVNQLSASSLRFLALNSYGTNVGLSSF 410

Query: 421  QLYQNSYSIFANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPGDDPSPL 480
            Q+YQ++Y+IFANNSLNEP+C+S  +   SS LSNN W +G++ Q+Y+ T Y P     P 
Sbjct: 411  QIYQDAYAIFANNSLNEPSCNSLES-FSSSDLSNNTWTRGMDDQNYVKTTYIPHQGVLPE 469

Query: 481  VNFYPSINRIGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMK 540
            V F+P +   G Y++ +YTPGC  D TCS RGIVNVT+W+T  N ++STTLIYQNN+++K
Sbjct: 470  VTFHPDLKYSGQYSIELYTPGCQQDNTCSSRGIVNVTVWNTNNNSILSTTLIYQNNDQLK 529

Query: 541  YDQLFEGFLDYAPKVTLEYYSGINDENSPXXXXXXXXXXXPINIELDETIGNVTSSTEEL 600
            YD+L+ G+L+Y+PK+T+ Y+SGI    +              ++++   I N T+S E  
Sbjct: 530  YDELYSGYLNYSPKITVTYHSGIYSGTTAGTVVVDRLNIMINSLDILNEIHNSTNSLE-- 587

Query: 601  KVPLNGMFQYQLXXXXXXXXXXXL-KVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLGGS 659
               LNG+FQYQL           + +V NTS+N   ++ FSS+VSL    YN+TLL+G  
Sbjct: 588  ---LNGLFQYQLSNFSTSSKDSSIARVANTSINQLTLTGFSSNVSLSASLYNDTLLVGAG 644

Query: 660  IAGVYALSLSNYTNIRSTRIXXXXXXXXXXXXXXXXXXLFGNFNISNRIVSSLSYNGTFD 719
              G+    L+    I+S+                    ++G+FN S    + LS+NG+FD
Sbjct: 645  DDGLSIYELNKDLAIQSSSQQGIEGKITGLKSYSNGVLVYGDFNSSKESSNVLSFNGSFD 704

Query: 720  SFGNVNSNIATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGDT 779
            S GN+ S I  F+N+T  +SE+L F+N   FN S+SS I NTS+ SLS+WS+GSN  GDT
Sbjct: 705  SIGNITSPITNFANITIDDSELLVFDNNLIFNVSSSSQISNTSSFSLSLWSSGSNSNGDT 764

Query: 780  LFSGLITRNEFPNLNNSAVLTGNGTAQSLQLRNGIQPYLGVYLNDSLTAY-LYDSSSNSN 838
            LFSG +++ +F NL+ S  +  N +A S  LR+   PY  ++LNDS+T Y L + SS S 
Sbjct: 765  LFSGALSQVQFTNLSGSVSIANNLSATS--LRSIGSPYAAIFLNDSVTGYVLKNDSSTSE 822

Query: 839  ILFSNGLQGNWNLPRSVSSAYYSDNETMF-VGSSLS-NGDSGAELFVLNFTTMDLLYNET 896
            ++FS+G +  W     V S  Y  N++M  VGSS S NG    EL +LN  +  +L NET
Sbjct: 823  MIFSDGSKAPWRWTGYVDSMLYLTNQSMLAVGSSSSVNG----ELSILNLDSFKVLANET 878

Query: 897  FDVNSSINSIVSFGRNSSLLVGGDFTAPXXXXXXXXXXXXXXXQWSSFSN-KFDGTITGL 955
             + NSS+ ++V F RNSS+LVGG+F+                 QW +F N   +GTIT L
Sbjct: 879  LNQNSSVKTMVHFERNSSILVGGNFSISNTECFGLCLYNYTGNQWYTFLNGTINGTITKL 938

Query: 956  EFANDSRLLISGSYRFENQSGISLGYIDLNNQEFKSLLSD-SQKVNSFNYNNGTIVAWDS 1014
            +  NDS+L+I+G +  ++QS ++L  ++L + +   +     + V  F   +  I AW+ 
Sbjct: 939  QIFNDSQLIIAGVFDTKSQSSVNLALMNLTDNKLVLIRWGFKEPVKDFITIDDNIFAWNE 998

Query: 1015 STIYSYRGDSWSNHQIPNTNSSTSIKNVQIVSKXXXXXXXXXXXXXXXDELILVFGELYS 1074
            ++++ Y  +SW +  I N+NSST+I ++   +                + LI V G++Y 
Sbjct: 999  TSLFEYTSNSWVDIPISNSNSSTTIDSIGWTTTTDNNLKKRDNSETSNNVLI-VKGQIYD 1057

Query: 1075 EDYGFVQAMFYDFQNWIPYYITQPYSSLNTSKNSLFMNKDISLLYESQVVLQNPNXXXXX 1134
              YG +QAM Y+F+ WIPY       S       LF+++D+S L++SQ+ LQ  N     
Sbjct: 1058 NVYGHIQAMIYNFEEWIPYLSINSLVSSANQPAELFIDRDVSKLFDSQLALQVSNTTASI 1117

Query: 1135 XXXXXXXXXXXXXXXXXXXLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIF 1194
                                K      KI RG+VVLIGLALA+GT+ +LGI GV +AY F
Sbjct: 1118 TASSSTPTPTSSPKKKLHQSK-----KKIDRGFVVLIGLALALGTMTVLGIVGVILAYAF 1172

Query: 1195 SDDKGEYVRIKPRIDEHEMLDTVPPEKLMKFI 1226
             DD G+Y  I PR++E EML TVPPEKLM+FI
Sbjct: 1173 RDDDGDYDVITPRVNEDEMLKTVPPEKLMEFI 1204

>SAKL0H17204g Chr8 (1522944..1526579) [3636 bp, 1211 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1211

 Score =  818 bits (2114), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 500/1234 (40%), Positives = 708/1234 (57%), Gaps = 68/1234 (5%)

Query: 19   ASQLTNVKDSLGINTVNIPQINFGNT-NNEIQILSNIEGLTFYQYQGQQNFTGSIDTNSN 77
             SQL+++K+ L I  ++IPQI+  ++ N+E+ +L + E LTFY+Y GQ+NFTGSI     
Sbjct: 20   GSQLSSLKEKLNIQDLSIPQIDLSSSVNDEMALLGDFEDLTFYRYTGQENFTGSI--TET 77

Query: 78   THGLIYYSNDTLIKLLEGSDN---TKIDQIVPLDEDAFILSGSGTL-GGFQLENQLLYNL 133
               LIYYSN T IKL   SD      I+ I+P  +D+FILSG+GTL GG  LE QLLYNL
Sbjct: 78   EKDLIYYSNGTFIKLDSLSDENATADINHIIPFGDDSFILSGTGTLPGGHNLEQQLLYNL 137

Query: 134  SDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISWNKVTKNVDMLPFI 193
            S L    +FN  +  +  IL D +IVYFGG F YT  N T +S++ WN  T  + +LPF 
Sbjct: 138  SSLEYTAIFNQSISTVNDILADDEIVYFGGEFQYTLGNSTGHSVVLWNSTTNEIQLLPFK 197

Query: 194  GFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVXXXXXXXXXXXXXXXXXXXXXXXXX 253
            GFG +S VNSIL+LD DN++F G F+TLDD +LL                          
Sbjct: 198  GFGLDSVVNSILRLDNDNIVFAGKFNTLDDNTLL-------KQIRGSNSSKNATDIEFDQ 250

Query: 254  QISLKYASWASLGDLKSSTQFICPNGQNEAWSSAGT-TGEITCNLAFEASLSKIRIFNSP 312
             I LK+A W+S G L+ S+  ICP+  ++ W   GT TG+ T +L  +   SK+RI+N+ 
Sbjct: 251  LIPLKHAGWSSQGSLEHSS-LICPSDDSDGWFQEGTATGDFTVSLLTDLRPSKLRIYNAF 309

Query: 313  YEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQXXXXXXXXXXXX 372
                Q++ FRI+T+P+NGIMNLTYLDP T E+ YCDA+CPL S+  L+            
Sbjct: 310  DSDYQVSLFRIITSPANGIMNLTYLDPQTGELSYCDAWCPLLSTELLEQAEANVTISSDS 369

Query: 373  XXFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGFQLYQNSYSIFAN 432
              +I  N TNI W++ YQEFAFVN+V V +L  +AL SYG +VGL GF++YQN Y  FAN
Sbjct: 370  VAYIGNNNTNIKWTSAYQEFAFVNEVSVESLTFLALDSYGSSVGLDGFEMYQNGYPTFAN 429

Query: 433  NSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYT-PGDDPSPLVNFYPSINRIG 491
            ++LN+P CD+ N+   +   S   W QG    SYI + Y   GD PS  VNFYP+I   G
Sbjct: 430  DTLNQPNCDNINSYSHAVTSSKQQWTQGSMDSSYILSTYDGTGDLPS--VNFYPNITYAG 487

Query: 492  NYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLFEGFLDY 551
            +YT+N+ TPGCTGDG+CS RGIVNVT+WD   + ++ST LIYQNNN+ KYD L+ G+L+ 
Sbjct: 488  DYTLNMVTPGCTGDGSCSSRGIVNVTVWDQINDTVLSTKLIYQNNNDEKYDLLYSGYLES 547

Query: 552  APKVTLEYYSGINDENSPXXXXXXXXXXXPINIELDETIGNVTSSTEELKV---PLNGMF 608
            APK+TL++Y  IN ++S             +   +D  I ++  S   LK     LNG+F
Sbjct: 548  APKITLKFYESINTDSSTSIM---------VADRVDVIIDSIDQSKIGLKTINETLNGLF 598

Query: 609  QYQLXXXXXXXXXXXLKVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLGGSIAGVYALSL 668
            QYQ+           LK+ NT++N + +    S+  L+   YN TLL+ G+  G+  L L
Sbjct: 599  QYQI-SNFTTISNDSLKIGNTTINRYSIENVPSNSELFAGYYNNTLLVDGAFNGIAVLQL 657

Query: 669  SNYTNIRSTRIXXXXXXXXXXXXXXXXXXLFGNFNISNRIVSSLSYNGTFDSFGNVNSNI 728
            ++  NI S +                     G+FN+S++ +S+LSYNGTF SFGN+ +NI
Sbjct: 658  NDDLNIISEQRMGTGGPTEGINTYSNGLLFLGDFNLSSQQISTLSYNGTFSSFGNLRTNI 717

Query: 729  ATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTLFSGLITRN 788
              F+N+T  +SE+L FNN Y FN S++ YI NTS+ +LS+WSAGSN   D +  G +++ 
Sbjct: 718  TRFNNITIDDSELLVFNNRYIFNVSSNEYIRNTSSFALSLWSAGSNSKEDGILVGAVSQR 777

Query: 789  EFPNLNNSAVLTGNGTAQSLQLR--NGIQPYLGVYLNDSLTAYLYDSSSNS--NILFSNG 844
            ++  LN +  +    +  ++ L   +G + Y   Y+NDS TAY Y S ++S  ++L + G
Sbjct: 778  QYTELNGAVYINDANSISTIGLPSFDGKRVYTATYINDSSTAYAYSSKNDSTHHVLIARG 837

Query: 845  LQGNWNLPRSVSSA-----YYSDNETMFVGSSLSNGDS-GAELFVLNFTTMDLLYNETFD 898
             +   +LP S S A     Y  D+  + VG++   GD+ G  L + N +   ++  E   
Sbjct: 838  NRSE-DLPVSWSHAVNTMIYNKDDSLLAVGTNA--GDTNGTSLSLFNISNSKMIGEENLG 894

Query: 899  VNSSINSIVSFGRNSSLLVGGDFTAPXXXXXXXXXXX--XXXXQWSSF-SNKFDGTITGL 955
              SS+N+IV+F +NSSLLVGGDFT                   +WS+F +N   G IT L
Sbjct: 895  AKSSVNAIVAFNKNSSLLVGGDFTIDKDDTSCSGLCLYNYNASKWSNFYNNSISGNITDL 954

Query: 956  EFANDSRLLISGSYRFENQSGISLGYIDLNNQEFKSLLSDSQKVNS---FNYNNGTIVAW 1012
            +F N ++LLISG+   EN++GI+L  +++ + E   L   S  V S   F++    ++  
Sbjct: 955  QFFNGTQLLISGNLYTENETGINLAKLNMASNEVTILRHGSTMVQSFVTFDHTTDELITQ 1014

Query: 1013 DSSTIYSYRGDSWSNHQIPNTNSSTSIKNVQIVSKXXXXXXXXXXXXXXXDELILVFGEL 1072
              + I  Y    W N    + N S  +    I  K               +  +LV G+L
Sbjct: 1015 SDNEISYYTNGEWKNLTSEDFNDSLYMGAQLIPLK------QTSSKRDVSNRALLVNGDL 1068

Query: 1073 YSEDYGFVQAMFYDFQNWIPYYITQPYSSLNTSKNSLFMNKDISLLYESQVVLQNPNXXX 1132
                YG V AM YDF++W+PY+I    ++   S  ++FMNKD+S LY +Q +LQ  N   
Sbjct: 1069 KHSTYGSVSAMLYDFEDWMPYFIVDGENAGRAS--NIFMNKDLSSLYTTQTILQGSNTST 1126

Query: 1133 XXXXXXXXXXXXXXXXXXXXXLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAY 1192
                                  KN +   KI RG+VVLIGLALAIGTVA+LG  G  +AY
Sbjct: 1127 STTSSNMPSETSD---------KNESSSDKIDRGFVVLIGLALAIGTVAVLGGAGAIIAY 1177

Query: 1193 IFSDDKGEYVRIKPRIDEHEMLDTVPPEKLMKFI 1226
             F+ +KG+Y  +KPR+DE +M+DTVPPEKLMKF+
Sbjct: 1178 FFAGNKGQYEPLKPRVDEGDMIDTVPPEKLMKFV 1211

>KAFR0B02690 Chr2 complement(539470..543102) [3633 bp, 1210 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1210

 Score =  817 bits (2111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 491/1219 (40%), Positives = 735/1219 (60%), Gaps = 33/1219 (2%)

Query: 16   VSQASQLTNVKDSLGINTVNIPQINFGNTNNE-IQILSNIEGLTFYQYQGQQNFTGSIDT 74
            +S ASQL+ +++SLGI T   P + F + N+  +Q+L + + L+ Y Y GQQNF+  I  
Sbjct: 17   LSLASQLSQLENSLGIQTFAPPALIFSSNNDSSLQLLGSYDALSLYTYTGQQNFSYQITP 76

Query: 75   NSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTLGGFQLENQLLYNLS 134
            ++N++GL+YYSN+TLI+L +G D+T+I+ IVP+  D+FILSGSG+L  + LENQL YNLS
Sbjct: 77   DTNSNGLVYYSNNTLIQLNQGLDDTRINNIVPIGSDSFILSGSGSLNEYSLENQLFYNLS 136

Query: 135  DLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISWNKVTKNVDMLPFIG 194
             LS+ P+FN  L+ ++SILVD+D+VYFGGNF++++     +S+  WN  + +  +LPF+G
Sbjct: 137  SLSVYPIFNTTLEQVESILVDEDLVYFGGNFTFSNGTDDGHSVAVWNITSNSTGLLPFLG 196

Query: 195  FGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVXXXXXXXXXXXXXXXXXXXXXXXXXQ 254
            FG+NS++N+IL+L++DN+LF G+F TLDD SLL                           
Sbjct: 197  FGENSSINNILRLNDDNILFAGEFYTLDDASLLTSNTSNATTNIYDLELSPL-------- 248

Query: 255  ISLKYASWAS-LGDLKSSTQFICPNGQNEAWSSAGTTGEITCNLAFEASLSKIRIFNSPY 313
            + L  A+W+S + D  +S+ FIC N  ++AW  +GTTG + C+L ++++L+KIRI+NSP 
Sbjct: 249  LPLNEATWSSDVSDFDASS-FICVNPDSDAWFVSGTTGTLACSLPYDSALTKIRIYNSPD 307

Query: 314  EQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQXXXXXXXXXXXXX 373
             Q+QI+ FR+++ PS  IMN+TY+DP T  +++CD++CPL S + L              
Sbjct: 308  SQNQISEFRLISDPSGSIMNMTYIDPRTGNLEHCDSYCPLLSRDTLS-SASDAASVSEMA 366

Query: 374  XFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGFQLYQNSYSIFANN 433
              ++ N T I WS +YQEF FVN V  T LQ +AL SYG NV L+G+ LYQ+ Y++FANN
Sbjct: 367  RLLSDNATVIKWSAEYQEFGFVNVVSTTLLQFLALNSYGSNVALAGYSLYQDEYAVFANN 426

Query: 434  SLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPGDDPSPLVNFYPSINRIGNY 493
            SLN  +C S N+   SS LS+N W  G + Q+Y+ T YT GDDP P V F  ++   G+Y
Sbjct: 427  SLNGASCTSNNSDYTSSTLSDNDWVFGASGQTYVTTFYTEGDDPIPQVTFNANLPYSGDY 486

Query: 494  TVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLFEGFLDYAP 553
             +N+YTPGC+ DGTCS RG+VNVT++D + + ++ST  IYQNN  +KYD+LF G+L  + 
Sbjct: 487  VINLYTPGCSDDGTCSTRGLVNVTVYDESDDSILSTVEIYQNNEALKYDELFSGYLKNSV 546

Query: 554  KVTLEYYSGINDENSPXXXXXXXXXXXPINIELDETIGNVTSSTEELKVPLNGMFQYQLX 613
            ++ LEY SGI+ +++              ++++   +G ++SS     V LNG+FQYQL 
Sbjct: 547  RIVLEYVSGISSDSTGTTVVADRSNIYVTSLDI---LGQISSSKNGSTVALNGLFQYQLS 603

Query: 614  XXXXXXXXXXLKVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLGGSIAGVYALSLSNYTN 673
                       KV  T LN +P+  F+++ SL+   Y+  LL+GG+   VYAL  SN  N
Sbjct: 604  NFSSTFNSSSAKVGKTFLNQYPLDIFNTNSSLFASTYDNYLLVGGAEQSVYALESSNDLN 663

Query: 674  IRSTRIXXXXXXXXXXXXXXXXXXLFGNFNISNRIVSSLSYNGTFDSFGNV-NSNIATFS 732
              ++                    L+GNFN+S     +++YNG+F+ F    NS+I TF 
Sbjct: 664  FSTSDNSGVEGQFKNMQPFSEGIFLYGNFNLSGVTEGAVTYNGSFNPFTQYGNSSIDTFK 723

Query: 733  NLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTLFSGLITRNEFPN 792
            N+TFG SEIL FNN Y +N S+S+ + N+S+LSLS+WSAG+N  GD LF+G  ++  +  
Sbjct: 724  NVTFGNSEILVFNNAYLYNVSSSTLMSNSSSLSLSLWSAGANANGDLLFNGASSQMSYSF 783

Query: 793  LNNSAVLTGNGTAQSLQLRNGIQPYLGVYLNDSLTAYLYDSSSNSNILFSNGLQGNWNLP 852
             N S  +  N   Q L     I PYLG+Y+N S  AY Y    N+ + F+NG Q +W  P
Sbjct: 784  NNESINIGANNIVQGLNFNESIDPYLGLYMNTSHGAYFYQDDDNTRVYFTNGSQPSWQWP 843

Query: 853  RSVSSAYYSDNETMFVGSSLSNGDSGAELFVLNFTTMDLLYNETFDVNSSINS-IVSFGR 911
              V +A YSDN+++ +  + S+ +S + L VLN TT D++ NE+     S  S IV+F  
Sbjct: 844  NDVVAAIYSDNQSLLIAGTSSSLESSSFLTVLNTTTYDVIANESLSSQQSQISGIVNFAS 903

Query: 912  NSSLLVGGDFTAPXXXXXXXXXXXXXXXQWSSFSNK-FDGTITGLEFANDSRLLISGSYR 970
            N++ ++GG+F+ P                WSSF++   +GT+  ++  N+S L++SG + 
Sbjct: 904  NATAIIGGNFSMPNVNCFGLCLFNYGNSTWSSFADASINGTVDHMQLFNESELIVSGLFS 963

Query: 971  FENQSGISLGYIDLNNQEFKSLLS-DSQKVNSFNYNNGTIVAWDSSTIYSYRGDSWSNHQ 1029
             +N S I++  ++L N +  +L S +S    SF   +  IVAW+++ +  Y  + W+  +
Sbjct: 964  TKNISSITMASLNLKNNKITALKSGESNTFKSFTVADQKIVAWNNTALSIYEDNVWTVER 1023

Query: 1030 IPNTNSSTSIKNVQIVSKXXXXXXXXXXXXXXXDELILVFGELYSEDYGFVQAMFYDFQN 1089
            I N NSS+ + N+  V+                 + ILV G+LY   YG +QAM YDF +
Sbjct: 1024 ISNINSSSVVDNLNYVT----LASALSKRDTSSSDAILVSGQLYDNSYGHIQAMVYDFSS 1079

Query: 1090 WIPYYI--TQPYSSLNTSKNSLFMNKDISLLYESQVVLQNPNXXXXXXXXXXXXXXXXXX 1147
            W+PY +  ++  SS+N      F+++D+S    +QV L                      
Sbjct: 1080 WVPYLLINSESDSSINA-----FIDRDMSSFTNTQVALL---TNSGTVSNSSSSTTSPGA 1131

Query: 1148 XXXXXXLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIFSDDKGEYVRIKPR 1207
                  + N   + KI RG+VVL+GLALA+GTVA+LGI GV MAY+F DD G Y  I PR
Sbjct: 1132 SASATSIPNKTHKRKIDRGFVVLLGLALALGTVAVLGIAGVIMAYVFRDDNGAYEPINPR 1191

Query: 1208 IDEHEMLDTVPPEKLMKFI 1226
            IDE+EM++TVPPEKLMK+I
Sbjct: 1192 IDENEMIETVPPEKLMKYI 1210

>TBLA0E04390 Chr5 complement(1115294..1119130) [3837 bp, 1278 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1278

 Score =  718 bits (1853), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/1283 (36%), Positives = 683/1283 (53%), Gaps = 68/1283 (5%)

Query: 2    LATIVRLISLGIIGVSQ-ASQLTNVKDSLGINTVNIPQINFGN-TNNEIQILSN--IEGL 57
            + TI+ ++ L +   S  A+QL ++KD L I  +  PQ N  + TN  +Q+L++   + L
Sbjct: 5    IRTILGILLLSVAPSSVVANQLNHLKDILEIENIPAPQFNLQDSTNQSLQLLTSNGFDTL 64

Query: 58   TFYQYQGQQNFTGSIDTNSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGS 117
             F  Y GQQNFT  I ++S  H LIYYSNDT I+LL+   +T+I  I+P  +DAFILSG+
Sbjct: 65   NFVHYNGQQNFTQPIISSSQNH-LIYYSNDTYIRLLDIPYSTRIQHIIPYGQDAFILSGT 123

Query: 118  GTLGGFQLENQLLYNLSDLSIIPLFNNQL-QNIKSILVDKD--IVYFGGNFSYT-SNNKT 173
            G+L GF+L NQL+YNL+DLS+ P+F N+L   +++I  D D  +VYFGGNFSY   ++  
Sbjct: 124  GSLNGFELSNQLVYNLTDLSLTPIFENKLVPEVRTIFKDPDTNLVYFGGNFSYLLPDSNI 183

Query: 174  ANSIISWNKVTKNVDMLPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVXXXXX 233
            +N +I W+  + +     F GFG NS +N+ILKL+ ++LLF G F TLDD S+L      
Sbjct: 184  SNGLIIWDSSSNDTISYEFGGFGSNSVINNILKLNSNDLLFSGQFYTLDDPSILHIPYNI 243

Query: 234  X--XXXXXXXXXXXXXXXXXXXQISLKYASW--ASLGDLKSSTQFICPNGQNEAWSSAGT 289
                                  +I L +  +  A   D  +  Q ICP  + EAW+S   
Sbjct: 244  TFPNNTSSLLSQQNVSTFELNQRIPLTFGKFSTADTNDYINKNQLICPTSEIEAWASDSK 303

Query: 290  TGEITCNLAFEASLSKIRIFNSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDA 349
             G +   L F    SKIRIFNSP   D++A+FRI     N IM+L YLDPL  ++KYC  
Sbjct: 304  AGSLQITLPFSIRPSKIRIFNSPDPDDEVATFRINPGNQNSIMSLAYLDPLDGQLKYCSE 363

Query: 350  FCPLYSSNALQXXXXXXXXXXXXXXFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALT 409
            FCPLY+ N L+               ++ N T+I WST YQEFAFVNQ  +T L+  AL+
Sbjct: 364  FCPLYNRNQLKLFNSNDNLKSHVITLLDNNTTDIKWSTTYQEFAFVNQFDLTTLEFQALS 423

Query: 410  SYGDNVGLSGFQLYQNSYSIFANNSLNEPACDSPNT-------------VIPSSY--LSN 454
            SYG  VGLSG  L+Q+  ++FAN S N+P+C+                 V+ SSY  LS+
Sbjct: 424  SYGSRVGLSGLSLFQSDIAVFANESYNKPSCNDQTAYDNEDLIKAALPRVMGSSYSILSD 483

Query: 455  NIWYQGLNSQSYIATKYTPGDDPSPLVNFYPSINRIGNYTVNIYTPGCTGDGTCSFRGIV 514
            N WY  L +  Y+A  Y       P V FYP++   GNYTV++ TPGCT D +C  RGIV
Sbjct: 484  NDWYTPLPNSDYLACTYLSSSKLIPTVTFYPNLLYAGNYTVDMITPGCTADNSCDSRGIV 543

Query: 515  NVTLWDTATNDLISTTLIYQNNNEMKYDQLFEGFLDYAPKVTLEYYSGINDENSPXXXXX 574
            NVT+W+   + ++ T+LIYQ N   K+DQ+F G+LD   K+T+ +YSG+           
Sbjct: 544  NVTMWNQTDSSILQTSLIYQTNENYKFDQIFNGYLDPLVKITMSFYSGVYSNTG-----N 598

Query: 575  XXXXXXPINIELDETIGNVTSSTEELK---VPLNGMFQYQLXXXXXXXXXXXLKVDNTSL 631
                   IN+ ++      T+S+ E+    V LNG+FQY                 N+++
Sbjct: 599  FTIVADRINLIINSLDFVTTTSSNEIDIYNVTLNGLFQYP---EYNSVNNLNENYTNSTI 655

Query: 632  NLFPVSRFSSSVSLYGVEYN-ETLLLGGSIAGVYALSL-SNYTNIRSTRIXXXXXXXXXX 689
            N +  S + ++VSL    Y+ +TLL+GGSI  +    +  N  NI               
Sbjct: 656  NQYAYSNYPANVSLIAAAYDKDTLLVGGSINKLQEFQIEKNGQNISLQNTFKDLNSVTGI 715

Query: 690  XXXXXXXXLFGNFNISNRIVSSLSY-NGTFDSFGNVNSNIATFSNLTFGES-EILAFNNE 747
                     +G+   S+    ++++ N  F + GN    I +FSN++   S EIL+FNN+
Sbjct: 716  VPYSDGLIAYGDIMDSSGSYKAITFTNNKFGTLGNFTDEIQSFSNISLTTSWEILSFNNK 775

Query: 748  YFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTLFSGLITRNEFPNLNNSAVLTGNGTAQS 807
            YF+N S      NTS   LS+WSAG N   D +FSGL++ NE  NL     +  N   + 
Sbjct: 776  YFYNQSNMEDFKNTSTFELSLWSAGKNAQNDLIFSGLVSENENVNLTGVVSINANEQIKE 835

Query: 808  LQLRNGIQPYLGVYLNDSLT--AYLYDSSSNSNILFSNGLQGNWNLPRSVSSAYYSDNET 865
            L L N I PY  V+LNDS T  AY+  ++  + ++ SNG Q +W+    +SS  +  NE+
Sbjct: 836  LNLGNNIYPYSAVFLNDSSTIYAYMEPNTRLNRLIHSNGEQISWSWKNKISSMAFFPNES 895

Query: 866  MFVGSSLSNGDSGAELFVLNFTTMDLLYNETFDVNSSINSIVSFGRNSSLLVGGDFTAPX 925
            +    ++S+ D      +LN T+  ++ NET + NS I+S++ F +NSS+LVGG+FT   
Sbjct: 896  LLSVGTISDKDVFPSFSILNLTSNKVIANETLNKNSQISSLLYFTKNSSVLVGGNFTFSD 955

Query: 926  XXXXXXXXXXXXXXQWSSF-SNKFDGTITGLEFANDSRLLISGSYRFENQSGISLGYIDL 984
                           WS+F +N  +GT++ LE  N+S +LISG+      + I L  ++L
Sbjct: 956  YQCSGLCLFNYETKNWSTFMNNTLEGTVSKLELKNNSNILISGTLSTNKSANIDLALLNL 1015

Query: 985  NNQEFKSLLSDSQKVNSFNYNNGTIVAWDSSTIYSYRGDSWSNHQIPNTNSSTSIKNVQI 1044
            N      LL ++  + SF +    I AW+SST++ Y  ++WS   +PN   S  + ++ I
Sbjct: 1016 NTYNVSILLQNT-NLTSFEFTGNQIAAWNSSTLFQYNNEAWSQILLPNGTESLKLDSISI 1074

Query: 1045 VSKXXXXXXXXXXXXXXXDELILVF-GELYSEDYGFVQAMFYDFQNWIPYYITQPYSSLN 1103
                              D  I+V  G+ YS+  G VQA++Y    WIPY+     ++++
Sbjct: 1075 FDITNKNSSSILEKRALRDTNIMVATGQFYSKGLGTVQALYYTSDTWIPYFYGNLTNNMD 1134

Query: 1104 TSKN-SLFMNKDISLLYESQVVLQNPNXXXXXXXXXXXXXXXXXXXXXXXXL-------- 1154
            TS + ++F NKDIS    S  VL+N N                                 
Sbjct: 1135 TSNSINIFPNKDISSKIISDFVLKNWNFNLSDVGNSTNTTNSTNTTSTTNLTSPSNTTSP 1194

Query: 1155 -----------KNGNIESKIHRGYVVLIGLALAIGTVAILGIFGVTMAYIFSDDKGEYVR 1203
                       K  N + KI RG+VVLIGLAL++ TVA+LGIFG+ +++IF D +G+Y  
Sbjct: 1195 QPSSSIIPIIGKQQNKKHKIQRGFVVLIGLALSLATVALLGIFGILLSFIFRDSRGDYES 1254

Query: 1204 IKPRIDEHEMLDTVPPEKLMKFI 1226
            +KPR  EHEM D VPPEKLM F+
Sbjct: 1255 LKPRTTEHEMFDAVPPEKLMPFV 1277

>KNAG0G02000 Chr7 complement(443631..447239) [3609 bp, 1202 aa] {ON}
            Anc_8.256 YLR084C
          Length = 1202

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 440/1238 (35%), Positives = 682/1238 (55%), Gaps = 81/1238 (6%)

Query: 14   IGVSQASQLTNVKDSLGINTVNIPQINFGNTNNEIQILSNIEGLTFYQYQGQQNFTGSID 73
            + +++AS L NV+  L    V +P  + GN NN+ QIL +I G++FY+Y GQQNFT   +
Sbjct: 13   VAITRASNLENVRRILNATEVTVPTFDVGNKNNQFQILDDINGISFYEYLGQQNFTTDAN 72

Query: 74   TNSNTHGLIYYSNDTLIKLLEG-SDNTKIDQIVPLDEDAFILSGSGTLGGFQLENQLLYN 132
              ++   LIYYSN+T + L +  +   +I  I+PL +D+FILSG G +    L +QL++N
Sbjct: 73   V-TDVQRLIYYSNETFMSLSDSIAAEAQIQGIIPLGDDSFILSGQGMINNVSLASQLVFN 131

Query: 133  LSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISWNKVTKNVDMLPF 192
            ++DLSI  +F+  L++I+ + VD  +VYF GNF++  NN T    I W+   +++++LPF
Sbjct: 132  MTDLSITKIFDTPLRSIEGVTVDGPLVYFMGNFTF--NNNTG--AIMWDSRDRSINLLPF 187

Query: 193  IGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVXXXXXXXXXXXXXXXXXXXXXXXX 252
             GFG  + +NSILKL++DN+LF G FST+ + SLL+                        
Sbjct: 188  HGFGPYANINSILKLNDDNILFAGHFSTVWNSSLLLQSNVSEESVRNTTSLLLNP----- 242

Query: 253  XQISLKYASWASLGDLKSSTQFICPNGQNEAWSSAGTTGEITCNLAFEASLSKIRIFNSP 312
              + L+Y+ W + G+L SS Q ICP+   ++WS + TTG+ TC L F+ + SKIRI+NSP
Sbjct: 243  -SVPLQYSQWKTNGELDSS-QLICPDPSKDSWSVSATTGDFTCELPFQITPSKIRIYNSP 300

Query: 313  YEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQXXXXXXXXXXXX 372
             +  Q++ FR +T P+  IMNLTYLDPL+  +  CDAFCPLYS   LQ            
Sbjct: 301  DKDSQVSLFRFLTYPAGSIMNLTYLDPLSGNMTSCDAFCPLYSKTVLQSQWDNTAEANTV 360

Query: 373  XXFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGFQLYQNSYSIFAN 432
               IN N TNI W+ +YQEFA V+ V  T+L+  AL SYG+N+GL+GFQ+YQ S+S F N
Sbjct: 361  A-IINNNSTNIQWTPNYQEFALVSPVAATSLEFNALASYGNNLGLAGFQIYQASFSAFGN 419

Query: 433  NSLNEPAC-----DSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPGDDPSPLVNFYPSI 487
            NS N P C     DS NT   SS   NN    G     Y+   YTP ++P P V +   I
Sbjct: 420  NSFNTPNCNNNDKDSNNTFTSSSLSPNNWTSVG----EYLTVGYTPNENPVPKVTYKIDI 475

Query: 488  NRIGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLFEG 547
               G Y++N++TPGC+ D TCS RGIVN TL+DT TN +++T+LIYQNN+E+KYD L+ G
Sbjct: 476  QHSGEYSINVFTPGCSADNTCSTRGIVNYTLFDTVTNKMLATSLIYQNNDEIKYDTLYSG 535

Query: 548  FLDYAPKVTLEYYSGINDENSPXXXXXXXXXXXPINIELDETIGNVTSSTEELKVPLNGM 607
             L+ + ++T+ YYSG+   N+             I+++L          TE  K+ LNG+
Sbjct: 536  QLNSSCEITMTYYSGLYASNTVTTIVADRVDLNIISMDLSH-------RTEVSKLALNGL 588

Query: 608  FQYQLXXXXXXXXXXXLKVDNTSLNLFPVSRFSSSVSLYGVEY-NETLLLGGSIAGVYAL 666
            FQYQ+           +K+ NTSLN F ++ F  SVSL      N ++LL G+   ++++
Sbjct: 589  FQYQI--SNFTNDSIPMKIANTSLNQFALNNFEPSVSLRAFPLSNSSILLSGTEGNMFSI 646

Query: 667  SLSNYTNIR-STRIXXXXXXXXXXXXXXXXXXLFGNFNISNRIVSSLSYNGTFDSFGNVN 725
            +L+   +++ STR+                  L G  N+S    +  + N T D  G++ 
Sbjct: 647  NLNTDLSVQNSTRLISTENFTTFQPYSNGLVMLDGQGNVSLFKDNFKNLNTTMD--GSLA 704

Query: 726  SNIATFSNLTFGESEILAFNNEYFFN-TSTSSYIFNTSALSLSIWSAGSNDFGDTLFSGL 784
            +++A   N+T    E+L FNN Y +N TS      N+S  +L++ SAG+N   DT+F G 
Sbjct: 705  TDVA---NITLNGDELLVFNNGYIYNVTSQQQTRSNSSIFNLTVSSAGANSINDTIFLGK 761

Query: 785  ITRNEFPNLNNSAVLTG--NGTAQSLQLRNGIQPYLGVYLNDSLTAYLYDSSSNSNILFS 842
            + + ++   N SA +    N   + + L +   P  G++LND  T Y Y  S+ S +  +
Sbjct: 762  VVQWQYAIANQSAQVNADFNDGIEQMSLPSNTVPSRGIFLNDDSTGYFYKESNKSKLYIT 821

Query: 843  N-----GLQGNWNLPRSVSSAYYSDNETMFVGSSLSNGDSGAELFVLNFTTMDLLYNETF 897
            N     GL+  +  P +V    Y  N+T+ +    ++    + L + N T+ D++  E  
Sbjct: 822  NSNSTSGLEW-YGEPETV---VYDKNDTLLMVGYYNDNTFSSTLSLTNLTSFDVIKEENL 877

Query: 898  DVNSSINSIVSFGRNSSLLVGGDFTAPXXXXXXXXXXXXXXXQWSSFS-NKFDGTITGLE 956
            +V SSI+S++ F +N +LLV GDF                  QW S + N   G++  L+
Sbjct: 878  NVGSSISSLLYFAKNDTLLVAGDFEPSNGNCSDLCLYNYKSGQWDSLANNSVSGSVAALQ 937

Query: 957  FANDSRLLISGSYRFENQSGISLGYIDLNNQEFKSLLSDSQK---VNSFNYNNGTIVAWD 1013
               +  +L+ G+      + +++ +++L+N    SL+        ++S   +N  IVAW+
Sbjct: 938  LYQNDTILVLGNLTLPQANDVNMAFVNLSNNHVGSLIMKKDAPVNLHSMIVSNSRIVAWN 997

Query: 1014 SSTIYSYRGDSWSNHQIPNTNSS-TSIKNVQIVSKXXXXXXXXXXXXXXXDELILVFGEL 1072
             + ++S+ G+SW+   +P T+SS TSI +VQ +S                D+ +L+ GE 
Sbjct: 998  DTVLFSFDGNSWTRVSVPGTDSSATSISSVQFIS------------MEGTDDALLLLGEF 1045

Query: 1073 YSEDYGFVQAMFYDFQNWIPY--YITQPYSSLNTSKNSLFMNKDISLLYESQVVLQNPNX 1130
               ++G ++++ Y+F++WIPY  Y+  P          LFMN+DISL   +Q+ L N + 
Sbjct: 1046 RHSEFGDIKSIVYNFRDWIPYLLYVDGPRQ----GTGHLFMNRDISLHNIAQIPLLN-ST 1100

Query: 1131 XXXXXXXXXXXXXXXXXXXXXXXLKNGNIESK-----IHRGYVVLIGLALAIGTVAILGI 1185
                                    K     SK     + RG+VVLIGLALA+ TV+++G+
Sbjct: 1101 RVLTNQSFASSTSSSVSSTSTTLPKVSTTHSKPGRRIVDRGFVVLIGLALALATVSVMGV 1160

Query: 1186 FGVTMAYIFSDDKGE-YVRIKPRIDEHEMLDTVPPEKL 1222
             GV +AYIF D+ G+ Y  + PR+DE+ M++T+PPEKL
Sbjct: 1161 AGVLLAYIFRDNVGDSYQTLNPRMDENAMVNTLPPEKL 1198

>KLTH0G13838g Chr7 (1197919..1201563) [3645 bp, 1214 aa] {ON} similar
            to uniprot|Q12465 Saccharomyces cerevisiae YLR084C RAX2
            N-glycosylated protein involved in the maintenance of bud
            site selection during bipolar budding localization
            requires Rax1p
          Length = 1214

 Score =  617 bits (1591), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/1253 (34%), Positives = 646/1253 (51%), Gaps = 66/1253 (5%)

Query: 1    MLATIVRLIS-LGIIGVSQASQLTNVKDSLGINTVNIPQINFGNT-NNEIQILSNIEGLT 58
            M AT     S L +      S L  ++  LG+   +IP ++   + NNE+Q+L N + + 
Sbjct: 1    MRATTCLATSVLALAKFCSGSHLDALESKLGVEVYDIPNLDLSKSKNNEVQLLGNFKDIN 60

Query: 59   FYQYQGQQNFTGSIDTNSNTHGLIYYSNDTLIKLLEGSDNTKI---DQIVPLDEDAFILS 115
              +Y GQ+NFTG +  N   + LIYYSN+T +++   SD++++   D IVP  +DAFILS
Sbjct: 61   ILKYSGQKNFTGEVSGNPE-NALIYYSNETFLEIYSSSDSSEVFSVDHIVPFKDDAFILS 119

Query: 116  GSGTLGGFQLENQLLYNLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTAN 175
            G+G++ G QL  QLL+NLS L    +F   L  + +I  + D V+FGG+F Y  +N+T +
Sbjct: 120  GAGSISGHQLSRQLLFNLSSLEFREIFGQDLAQVNTITANGDKVFFGGSFEYEMSNQTIH 179

Query: 176  SIISWNKVTKNVDMLPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVXXXXXXX 235
            S++ W+ +   V++LPF GFGKNSTVNSIL LD  N+LF G+FS +D+   L        
Sbjct: 180  SLLVWDSIKDGVEVLPFGGFGKNSTVNSILNLDNSNILFAGNFSAVDNTQQL-------- 231

Query: 236  XXXXXXXXXXXXXXXXXXQISLKYASWASLGDLKSSTQFICPNGQNEAWSSAGTT-GEIT 294
                              QISL+ A+W S G L  S    CP+ ++  W   G+T G+  
Sbjct: 232  NNINVSNTSNTSVPELGHQISLQSAAWVSDGTLDKSA-IKCPSTESTGWLKTGSTQGQFE 290

Query: 295  CNLAFEASLSKIRIFNSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLY 354
              +  E   SK+R+FN+    +Q++ FRIVT PSNGIMNLTYLDP T E+  CDA+CPL 
Sbjct: 291  LYMPEETRPSKLRVFNARDSDEQVSLFRIVTTPSNGIMNLTYLDPTTGELASCDAWCPLL 350

Query: 355  SSNALQXXXXXXXXXXXXXXFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDN 414
            SS  L               F   N+T + WS  +Q+FAFVN VPV+ L  IAL SYG +
Sbjct: 351  SSQNLTDISSKSYPGDQVQYF--ENRTTLQWSESFQDFAFVNNVPVSDLTFIALDSYGSS 408

Query: 415  VGLSGFQLYQNSYSIFANNSLNEPACDSPNTVIPSSYLSN-NIWYQGLNSQSYIATKYTP 473
            VGL+G +LY+++YS++ANN+LN P C +  +   ++ LSN + W  G +  +Y++T    
Sbjct: 409  VGLAGIELYESAYSVYANNTLNAPNC-AQGSATSNALLSNSSAWDSGSSEGNYLSTS-VQ 466

Query: 474  GDDPSPLVNFYPSINRIGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIY 533
              + +P V FYPSI   G YT+++ TPGC  D +C  RGI+N T+ D   N L+ +  IY
Sbjct: 467  DSETNPFVIFYPSIIYPGVYTIDVLTPGCLEDSSCQTRGIINATIRDVQNNTLLDSIEIY 526

Query: 534  QNNNEMKYDQLFEGFLDYAPKVTLEYYSGINDENSPXXXXXXXXXXXPINIE-LDETI-G 591
            QNN+  K+D L+ GFLD   KVTLE+   I   NS             +NIE  D+++  
Sbjct: 527  QNNDYEKFDTLYSGFLDSEVKVTLEFDGAI---NSGTEVPVMVASKIVVNIEDFDQSVFE 583

Query: 592  NVTSSTEELKVPLNGMFQYQLXXXXXXXXXXXLKVDNTSLNLFPVSRFSSSVSLYGVEYN 651
            N TS        +NG+  Y                  T L  + VS+     +++   + 
Sbjct: 584  NNTSGF------INGLLHYSTSNTSSFLSELG-SYSATDLAHYSVSKLPKHSNIFANMFE 636

Query: 652  ETLLLGGSIAGVYALSLSNYTNIRSTRIXXXXXXXXXXXXXXXXXXLFGNFNISNRIVSS 711
            + L+L  +   +  L L+N  +I                       + G FN S+   ++
Sbjct: 637  DDLVLFTTDGEMARLKLANNLSIEEYTFETIGKDISTISEYSGGLIIVGTFNGSSE-PAA 695

Query: 712  LSYNGTFDSFGNVNSNIATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSA 771
              +NGTF +    NS + TFSNLT G++E+L F+     N +T   I++TS L+L + SA
Sbjct: 696  RGFNGTFFNLTEFNSTVRTFSNLTLGQTEMLIFDKNIILNGTTGEKIYDTSKLTLEVASA 755

Query: 772  GSNDFGDTLFSGLITRNEFPNLNNSAVLTGNG--TAQSLQLRNGIQPYLGVYLNDSLTAY 829
            G N + DTLF G + +N++ NLN S  ++ N    +Q+     G  PY   ++++S TAY
Sbjct: 756  GRNPYNDTLFQGYVLQNDYTNLNGSFFISTNSEEVSQNFWALGGKLPYDAAFVDNSTTAY 815

Query: 830  LY---DSSSNS---NILFSNGLQ---GNWNLPRSVSSAYYSDNETMF-VGSSLSNGDSGA 879
             Y   D++SNS   +++  +G       W+    V +   S N+++  +G    + DS  
Sbjct: 816  AYYNPDNTSNSFGVSVMNDSGSTVQLSAWS--GKVGAMASSKNDSLLAIGGKDQHTDS-- 871

Query: 880  ELFVLNFTTMDLLYNETFDVNSSINSIVSFGRNSSLLVGGDFTAPXXXXXXXXXXXXXXX 939
            +L V N ++ + L +  +D   S+NSI+ F RN+S+LVGG F                  
Sbjct: 872  QLLVTNSSSGESLASYKWDSEISLNSIIFFARNNSVLVGGSFRVNNTQCSGLCLFNYQDK 931

Query: 940  QWSSF-SNKFDGTITGLEFANDSRLLISGSYRFENQSGISLGYIDLNNQEFKSLLSDSQK 998
            +WS F +N   G I  +E  N+S LLI+GS+R     G+SL  I L +   + L   +  
Sbjct: 932  KWSPFLNNSIRGVINRMEIFNNSNLLIAGSFRLNETDGVSLASICLKDSSSEILHEGNIT 991

Query: 999  VNSFNYNNGT---IVAWDSSTIYSYRGDSWSNHQIP-NTNSSTSIKNVQIVSKXXXXXXX 1054
            +N F   +G+   +VA+  +++       W   QI  N   ++  K + +          
Sbjct: 992  LNGFVSMDGSSNNVVAFSDTSLLQLESGKW--QQISTNFTENSKFKGLDVFP---LKDTT 1046

Query: 1055 XXXXXXXXDELILVFGELYSEDYGFVQAMFYDFQNWIPYYIT-QPYSSLNTSKNSLFMNK 1113
                     +++L+ G L    +G + A FYD   W P+  + Q  SS +   + +F+N+
Sbjct: 1047 RKQKRDSSSKVLLITGSLQHAKFGSINAAFYDSGEWTPFLSSNQATSSSDLETSHVFLNR 1106

Query: 1114 DISLLYESQVVLQNPNXXXXXXXXXXXXXXXXXXXXXXXXLKNGNIESKIHRGYVVLIGL 1173
            D+S   + +  LQ                            K      KI RG++VLI L
Sbjct: 1107 DLSDFLDYKGYLQGTFSSNTSSGTSGTPSPSGSSPSNLQRKKK-----KIDRGFIVLISL 1161

Query: 1174 ALAIGTVAILGIFGVTMAYIFSDDKGEYVRIKPRIDEHEMLDTVPPEKLMKFI 1226
            ALA+GT+A+LG+ GV  +Y F D    Y   KPR DE+EM+DTVPPEKLM+FI
Sbjct: 1162 ALALGTLAVLGLLGVIFSYFFGDSGDGYQLSKPRTDENEMIDTVPPEKLMRFI 1214

>Kwal_56.23589 s56 complement(610601..614242) [3642 bp, 1213 aa] {ON}
            YLR084C (RAX2) - YLR084C [contig 176] FULL
          Length = 1213

 Score =  608 bits (1567), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/1238 (32%), Positives = 642/1238 (51%), Gaps = 58/1238 (4%)

Query: 11   LGIIGVSQASQLTNVKDSLGINTVNIPQINF-GNTNNEIQILSNIEGLTFYQYQGQQNFT 69
            L +  +   + L  ++ +LG+    +P ++  G+ N EIQ+L N + L +Y+Y GQ NFT
Sbjct: 12   LVVAKLCSGTHLNTIESALGVKNFEVPSLDLSGSNNEEIQLLGNFQNLNYYRYTGQDNFT 71

Query: 70   GSIDTNSNTHGLIYYSNDTLIKLLE---GSDNTKIDQIVPLDEDAFILSGSGTLGGFQLE 126
            G  D  +    LIY+SN TL++L      +++  +D ++PL +D+FILSG+G + G  L+
Sbjct: 72   GISDEKAR-ESLIYHSNGTLLELSSPQYSNESFSVDHVIPLRDDSFILSGTGAISGAVLD 130

Query: 127  NQLLYNLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISWNKVTKN 186
            +Q+++NLSDLS   +FN  L  + +I V+ +  YFGG+F +   ++  + +I W+ V   
Sbjct: 131  HQVVFNLSDLSYTAIFNQSLSPVNAITVNGNKAYFGGSFKFKGPDQDTHGLIVWDFVKNE 190

Query: 187  VDMLPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVXXXXXXXXXXXXXXXXXX 246
            V+ LPF G GK+S VNSIL LD++N+LF G+FST+D+KS L                   
Sbjct: 191  VETLPFGGLGKDSNVNSILVLDDNNILFAGNFSTIDEKSAL--------NSTLGINSTSD 242

Query: 247  XXXXXXXQISLKYASWASLGDLKSSTQFICP-NGQNEAWSSAGTTGEITCNLAFEASLSK 305
                   +I LK A W S G L+     +CP N    AW   GTTG+   ++A     SK
Sbjct: 243  SAPELSHKIPLKTAKWTSDGSLQKD-DLVCPSNSATSAWLGTGTTGQFELSIAHTIRPSK 301

Query: 306  IRIFNSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQXXXXX 365
            +R+ N+    ++++ FR++T PSNGIMNLTYLDP + E++ CDA+CPL S+  L      
Sbjct: 302  LRLHNARTLDEEVSLFRVITTPSNGIMNLTYLDPSSGELRTCDAWCPLLSTQNL-TAAKS 360

Query: 366  XXXXXXXXXFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGFQLYQN 425
                     F+N N+T + WS  YQ+FAFVN VPVT++  +AL SYG +VG++GF+LY++
Sbjct: 361  KAASTDQVEFLN-NQTTVQWSESYQDFAFVNSVPVTSITFMALDSYGSSVGVNGFELYED 419

Query: 426  SYSIFANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPGDDPSPLVNFYP 485
             +S++AN+S N P C S +    +S LS + W QG + + Y+ T        +P V FYP
Sbjct: 420  DFSVYANDSFNVPDCSSTSNYSKAS-LSASQWDQGSSDEDYVYT-LVENSQEAPSVTFYP 477

Query: 486  SINRIGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLF 545
             I   G YT+N+ TPGC  DG+C  R +VN +LWD+    L+S+  IYQNN+  KYD L+
Sbjct: 478  QIVYSGLYTINVLTPGCLADGSCQSRSVVNASLWDSNNGTLLSSITIYQNNDYEKYDNLY 537

Query: 546  EGFLDYAPKVTLEYYSGI-NDENSPXXXXXXXXXXXPINIELDETIGNVTSSTEELKV-P 603
             G+L+   KV LEY   I N E SP            I++  DE   +V   T++ K   
Sbjct: 538  SGYLENEVKVVLEYEGAIGNTEGSP------MMVAGQISVNTDEFDSSVF--TDKYKTGK 589

Query: 604  LNGMFQYQLXXXXXXXXXXXLKVDN-TSLNLFPVSRFSSSVSLYGVEYNETLLLGGSIAG 662
            LNG+                 K +N T L  + VS F+ + + +  ++   ++L  S   
Sbjct: 590  LNGL--LHYSLSNSSSYLQNFKSNNSTDLAQYSVSNFAKNSNFFVDKFKNYIMLFASSGK 647

Query: 663  VYALSLSNYTNIRSTRIXXXXXXXXXXXXXXXXXXLFGNFNISNRIVSSLSYNGTFDSFG 722
            V  L +    ++R+                     + G F+ S +   +  YNG+F    
Sbjct: 648  VSKLEIDQQFDVRTVTTEEVGDEVSGVFAFSEGLGVIGTFDGSTK--GAKFYNGSFFDIP 705

Query: 723  NVNSNIATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTLFS 782
              +SN+ TF+N T   +E+++  N Y  NT+T +   N+S ++L+  SAG N+ G+T+F 
Sbjct: 706  LSHSNVTTFTNFTLDGAELVSLGNYYAINTTTDTLFRNSSKMTLTARSAGLNNLGETVFY 765

Query: 783  GLITRNEFPNLNN-SAVLTGNGTAQSLQLRNGIQPYLGVYLNDSLTAYLYDSSSNSNILF 841
            G +TRNE+ +LN    + + + ++  L+   G   Y   Y+++S T Y +   S++N  +
Sbjct: 766  GSLTRNEYTDLNGSFFISSNSQSSSRLRGSQGRIWYDATYIDNSTTGYAFYDPSSTNGSY 825

Query: 842  SNGLQGNWNLPRSVS--------SAYYSDNETMFVGSSLSNGDSGAELFVLNFTTMDLLY 893
               +  +    R +S        S  YS N ++ +   + N     +L + N TT +   
Sbjct: 826  GVSIYKDMAKERDLSYRWTNMVGSMLYSKNSSL-LALGMKNETRSPQLLLTNLTTGEDTA 884

Query: 894  NETFDVNSSINSIVSFGRNSSLLVGGDFTAPXXXXXXXXXXXXXXXQWSS-FSNKFDGTI 952
               +  N SINS++ F +N+S+LVGGDF                   WS  F N  +G+I
Sbjct: 885  TFEWKTNVSINSLIFFDQNTSVLVGGDFNESESNCSGLCLFDYERKHWSPFFDNMINGSI 944

Query: 953  TGLEFANDSRLLISGSYRFENQSGISLGYIDLNNQEFKSLLSDSQKVNSFNYNNGTI--- 1009
              ++  N S L++ G +   +   ++L  + L +  +  L   ++ +  F + +G +   
Sbjct: 945  HSMKIFNKSSLVLGGFFDINDTKQVNLASMSLTDGSYNILHQGTETILDFIFVDGKVDNL 1004

Query: 1010 VAWDSSTIYSYRGDSWSNHQIPNTNSSTSIKNVQIVSKXXXXXXXXXXXXXXXDELILVF 1069
            VA  ++ ++    ++W +      +SS        +S+                  +L+ 
Sbjct: 1005 VAVSANDLFRLTNNNWESISAQFDDSSV----FGGLSEFPIQQGGQNKKREEEKNSLLIT 1060

Query: 1070 GELYSEDYGFVQAMFYDFQNWIPYYITQPYSSLN-TSKNSLFMNKDISLLYESQVVLQNP 1128
            G+L  + YG + A  YDF +WIPY+ T P +S +   ++ ++ NKDIS  +  Q VLQ+ 
Sbjct: 1061 GDLLHKTYGKISAALYDFNDWIPYFSTTPATSTDGLGQSRIYSNKDISSAFNYQGVLQSS 1120

Query: 1129 NXXXXXXXXXXXXXXXXXXXXXXXXLKNGNIESKIHRGYVVLIGLALAIGTVAILGIFGV 1188
                                      KN     KI RG+VVLIGLALA+GT+A++G+ G+
Sbjct: 1121 RGGNSSSVPSGTSSPTSSSPSQLGAKKN-----KIARGFVVLIGLALAMGTLAVMGVIGI 1175

Query: 1189 TMAYIFSDDKGEYVRIKPRIDEHEMLDTVPPEKLMKFI 1226
             + + F     +Y  ++PR DE EM+DTVPPEKLM+FI
Sbjct: 1176 ALTFFFGKSSDKYQSLEPRADESEMIDTVPPEKLMRFI 1213

>CAGL0L12144g Chr12 complement(1304574..1308044) [3471 bp, 1156 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084c
          Length = 1156

 Score =  599 bits (1544), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/1188 (33%), Positives = 613/1188 (51%), Gaps = 46/1188 (3%)

Query: 45   NNEIQILSNIEGLTFYQYQGQQNFTGSIDTNSNTHGLIYYSNDTLIKLLEGSDNTKIDQI 104
            NNEIQ+L +IE   +Y YQGQQNFT +  ++ N   LIYYSN+TL++L     + ++  I
Sbjct: 9    NNEIQLLGSIETFNYYNYQGQQNFT-TASSSQNELELIYYSNNTLLRLDAVPTDVEMRHI 67

Query: 105  VPLDEDAFILSGSGTLGGFQLENQLLYNLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGN 164
            +P  +D FILSG GT+ G +L  Q+L NL+ LS  P+F  +L  +KSI VD ++VYFGG+
Sbjct: 68   IPFMDDCFILSGIGTISGIELSRQILLNLTQLSYQPIFEKELGMVKSIFVDNEVVYFGGD 127

Query: 165  FSYTSNNKTANSIISWNKVTKNVDMLPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDK 224
             +Y +N  +  S++ WN  T +  +LPF GFG NSTVNSI++L+ +NLLF G F+ L++ 
Sbjct: 128  ITYNNNGVSGRSVVQWNSTTNSSSLLPFGGFGSNSTVNSIIRLENNNLLFTGQFAKLENN 187

Query: 225  SLLVXXXXXXXXXXXXXXXXXXXXXXXXXQISLKYASWASLGDLKSSTQFICPNGQNEAW 284
            S +                          QISL+ A+W +  +L     FICPN   +AW
Sbjct: 188  SFV------SKTNRTRNFSISMEDSEVGQQISLRQATWNANSNLDVDA-FICPNSDQQAW 240

Query: 285  SSAGTTGEITCNLAFEASLSKIRIFNSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEV 344
             S G+ G ITCN     +LSKIRI+N+P   +QI+ FR++  P NGI+NLTYLDP++ ++
Sbjct: 241  YSEGSYGVITCNFPNTLTLSKIRIYNTPITDNQISLFRLIAIPGNGILNLTYLDPISHDI 300

Query: 345  KYCDAFCPLYSSNALQXXXXXXXXXXXXXXFINGNKTNIGWSTDYQEFAFVNQVPVTALQ 404
            K+C   CPL++   L               FIN N TNI W+  YQEFAFVNQ+P+T+LQ
Sbjct: 301  KHCTENCPLFTRETLLNAMGNVTQESDVIRFINNNSTNIKWNEYYQEFAFVNQLPITSLQ 360

Query: 405  VIALTSYGDNVGLSGFQLYQNSYSIFANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQ 464
             +A  SY  NVGLSGFQ+YQ+S+ IF NNS NEP C S N +     LS N W+   N  
Sbjct: 361  FVASNSYYQNVGLSGFQIYQDSFPIFPNNSFNEPNCPSSNDIASYVKLSGNGWFTVANDN 420

Query: 465  SYIATKYTPGDDPSPLVNFYPSINRIGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATN 524
            SY+A  Y P     P + ++  IN  G Y +N+ TPGC  D TCS RGIVNVT +D +  
Sbjct: 421  SYLANSYIPNQGTKPSITYFVGINVPGEYVLNLVTPGCDKDNTCSTRGIVNVTTFDNSNG 480

Query: 525  DLISTTLIYQNNNEMKYDQLFEGFLDYAPKVTLEYYSGINDENSPXXXXXXXXXXXPINI 584
            +++ + LIYQNNN +KYDQ+F G L+ +  V +EYYSGIN                 ++I
Sbjct: 481  NILGSALIYQNNNNLKYDQIFAGVLNNSISVQVEYYSGINTNTGTATVVVGVVDVVRVSI 540

Query: 585  ELDETIGNVTSSTEELKVPLNGMFQYQLXXXXXXXXXXXLKVDNTSLNLFPVSRFSSSVS 644
               E I +       L   LNG+F+Y              K+D T L+ F VS F+   S
Sbjct: 541  S-SEFISDQIDGDRSLH--LNGIFEYSPSNFTFDNGYLTGKIDYTILDDFGVSNFNKGAS 597

Query: 645  LYGVEYNETLLLGGSIAGVYALSLSNYTNIRSTRIXXXXXXXXXXXXXXXXXXLFGNFNI 704
            ++ V+ N+ L LG +   VY L+  N +++ ST                    +FG+   
Sbjct: 598  IFAVDQNQNLYLGSTNGSVYELNSLNGSSVPSTE-NNLSGLINGMYSVEEGLVIFGSIAH 656

Query: 705  SNRIVSSLSYNGTFDSFGNV--NSNIATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTS 762
              R   ++  N +      V  +S  A+F++  FG S +L F+N   FN ++     NTS
Sbjct: 657  RGREYGAVILNKSITPLDIVANDSIQASFNSTLFG-SNLLVFDNSTIFNMTSFMVFENTS 715

Query: 763  ALSLSIWSAGSNDFGDTLFSGLITRNEFPNLNNSAVLTGNGTAQSLQLRNGIQPYLGVYL 822
              +L + +AG N   D L  G I        N S +++ NGT     L +       +YL
Sbjct: 716  YRNLDLRNAGKNSNDDMLLVGNIVNKGSAIGNESLLISSNGTYSPFSLSDNDTIEGAIYL 775

Query: 823  NDSLTAYLYDSSSNSNILFSNGLQGNWNLPRSVSSAYYSDNETMFVGSSLSNGDSGAELF 882
            ND+   Y   S + +    S+  +  W    +V   +YS+ + + +G+   N +    + 
Sbjct: 776  NDTKALYSLSSGNVNYFQLSDKQRLPWTWQSTVVPVFYSNGQQL-LGAIQENSNKSQIVL 834

Query: 883  VLNFTTMDLLYNETFDVN-SSINSIVSFGRNSSLLVGGDFTAPXXXXXXXXXXXXXXXQW 941
            +  F++   + N+T ++    IN+IV+F  N++ LVGGDF+                  W
Sbjct: 835  IDLFSSQ--VINDTGNLTMHKINAIVNFASNATALVGGDFSLSNPACVGLCLYNYNNSNW 892

Query: 942  SSF-SNKFDGTITGLEFANDSRLLISGSYRFENQSGISLGYIDL-NNQEFKSLLSDSQKV 999
            SSF +N   G I+ ++F ND+++L+SG       + I+L  I+L +N++   L ++S  +
Sbjct: 893  SSFLNNSITGNISQIKF-NDTQMLLSGKLEVNKTADINLLSINLTSNKQDILLYNNSVVL 951

Query: 1000 NSFNYNNGTIVAWDSSTIYSYRGDSWSNHQIPNTNSSTSIKNVQIVSKXXXXXXXXXXXX 1059
            + F      +V W+S+ I+      WSN  I +  ++ +I  ++                
Sbjct: 952  DDFILVRNLVVGWNSTDIFIRNVTQWSNLNIFDDGTNATINRIE-------------NFG 998

Query: 1060 XXXDELILVFGELYSEDYGFVQAMFYDFQNWIPYYITQPYSSLNTSKNSLFMNKDISLLY 1119
               +  ++++G+  S  YG + A+ YDF +W PY+     S   T+    F ++D S   
Sbjct: 999  ADSNPALIIYGQFDSMKYGTINAVIYDFNSWYPYFEVDVVSQ--TATPLFFADRDQSSYG 1056

Query: 1120 ESQVVLQNPNXXXXXXXXXXXXXXXXXXXXXXXXLKNGNIESKIHRGYVVLIGLALAIGT 1179
             ++ V+ +                           K      KI RG+VVLIGLALA+ T
Sbjct: 1057 NTRHVVPD--------HIIVSSSHSSSAPSSSSSHKTNEKPYKIRRGFVVLIGLALALAT 1108

Query: 1180 VAILGIFGVTMAYIFSDD-KGEYVRIKPRIDEHEMLDTVPPEKLMKFI 1226
            + +LGI GV +A +F+    G+Y  IK    ++     + PEKL++ +
Sbjct: 1109 LIVLGITGVVIALLFNPSVNGDYDIIKTNDSDNFAGSNITPEKLIRVL 1156

>KLLA0F18975g Chr6 complement(1739543..1743145) [3603 bp, 1200 aa]
            {ON} similar to uniprot|Q12465 Saccharomyces cerevisiae
            YLR084C RAX2 N-glycosylated protein involved in the
            maintenance of bud site selection during bipolar budding
            localization requires Rax1p
          Length = 1200

 Score =  598 bits (1543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/1244 (33%), Positives = 623/1244 (50%), Gaps = 83/1244 (6%)

Query: 11   LGIIGVSQASQLTNVKDSLGINTVNIPQINFGNTNNEIQILSNIEGLTFYQYQGQQNFTG 70
            L + G+ + SQL+N++  L I+    P  +    + ++  ++N E LT   Y GQQNFT 
Sbjct: 12   LVLAGMVRGSQLSNIEKLLNISRYEAPNWD----SPDLTYMNNFEELTVISYTGQQNFT- 66

Query: 71   SIDTNSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTLGGFQLENQLL 130
                 +N   L+YYSNDT +KL E S  T +  IVPL ED+FILSG+G + G  LE Q+L
Sbjct: 67   ---VQANESSLLYYSNDTFVKLFETSPETTVTMIVPLFEDSFILSGTGQINGVALEQQIL 123

Query: 131  YNLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISWNKVTKNVDML 190
             NL+ L+  P+F + ++N+  IL   + V F GNFS + +N+T +  + W+ V    ++ 
Sbjct: 124  LNLTSLTTSPIFPSAVENVMDILTVNETVIFVGNFSMSVSNETGHGAVLWDVVANTTELF 183

Query: 191  PFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVXXXXXXXXXXXXXXXXXXXXXX 250
            PF GFG+NS VNS++KL+ DN+LF G F  + + SLL                       
Sbjct: 184  PFKGFGENSIVNSVVKLNSDNILFAGSFQEIQNASLL-----QEFGNATNSSHEDLTSLQ 238

Query: 251  XXXQISLKYASWASLGDLKSSTQFICPNGQNEAWS-SAGTTGEITCNLAFEASLSKIRIF 309
                + LK +S    G+   S   +CP+G    WS S      +  +L  E   SK+RI+
Sbjct: 239  FDQSVPLKLSSIT--GENVQSDILLCPSGGQNGWSASEAVQSTLQFDLKNEIHPSKVRIY 296

Query: 310  NSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQXXXXXXXXX 369
            NS  E  +I+ FRI+T PSNGIMNLTYLDP + E+K CDA+CPL S   L          
Sbjct: 297  NSVEENSEISLFRIITGPSNGIMNLTYLDPASGELKQCDAWCPLLSIEDLTQISQNSTAA 356

Query: 370  XXXXXFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGFQLYQNSYSI 429
                  IN N TN+ WS  YQEFAFVN +PVT LQ +AL SYG N  L   ++++  + +
Sbjct: 357  PKSVG-INNNSTNLKWSESYQEFAFVNDIPVTMLQFVALASYGSNAALHSIEIFETEFMV 415

Query: 430  FANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPGDDPSPLVNFYPSINR 489
            +ANNS NEP C+S  T    + LS++ WY    S +YI+T     DD  P V F+P+I  
Sbjct: 416  YANNSYNEPNCESV-TEYSKAELSSDNWYTTDESDTYISTNI---DDNIPYVTFHPNITY 471

Query: 490  IGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLFEGFL 549
             G YT NIYTPGC  D +CS RGIVNVT+ D + N+++++ LIYQ NNE K+D L+ G L
Sbjct: 472  PGRYTFNIYTPGCLQDNSCSKRGIVNVTMIDRSINEVLASVLIYQTNNEDKFDPLYTGSL 531

Query: 550  DYAPKVTLEYYSGINDENSPXXXXXXXXXXXPINIELDETIGNVTSSTEELKVPLNGMFQ 609
              AP++ + +   I + +S                 + E I  ++ S+ +    LNG+FQ
Sbjct: 532  GSAPEIIVTWDKAIGESDSVMVVDRLGV--------ITEYIDTISISSNDTTFHLNGLFQ 583

Query: 610  YQLXXXXXXXXXXXLKVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLGGSIAGVYALSLS 669
            Y             +   N + N + +  F    +LY    N  +L+GG+  G+  + L+
Sbjct: 584  YN-----TANVTASIFSTNDTFNDYALYNFPLDANLYAASLNNDILIGGNFNGIAKVELN 638

Query: 670  NYTNIRSTRIXXXXXXXXXXXXXXXXXXLFGNFNISNRIVSS-LSYNG-TFDSFGNVNSN 727
            +   I S++                   L G + + N      LSY+G  F+SFG ++  
Sbjct: 639  DEALISSSQKLGTSGYTTGIFEYSNGLLLSGTYQVENDSRHEILSYDGNAFNSFGQLDEP 698

Query: 728  IATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGDTLFSGLITR 787
            I    N T    E+L F+N Y FN S + Y+ N+S   ++  SAG N   D+L  G   +
Sbjct: 699  IDRIVNFTIDGHELLLFDNAYIFNVSANMYVSNSSTFEITGQSAGINSGNDSLLFGSFLK 758

Query: 788  NEFPNLNNSAVLTGNGTAQS---LQLRNGIQPYLGVYLNDSLTAYLYDSSSNSNILF--- 841
                 LN  A L+ +G   S    +L   +QPY   Y+ND+  AY     S  N+     
Sbjct: 759  RSVGELNGLASLSSDGQVSSPTLPELPTDVQPYKAAYINDTSAAYALQEGSTDNVQHRVL 818

Query: 842  -------SNGLQGNWNLPRSVSSAYYSDN--ETMFVGSSLSNGDS--GAELFVLNFTTMD 890
                   S+ LQ  W+ P    +A+  DN    + +G++ SN  S    +  +LN T  +
Sbjct: 819  ITNTNSSSHMLQIQWSAPI---NAFLYDNVPNILAIGTNGSNSSSQYDVQFSILNLTGYE 875

Query: 891  LLYNETFDVNSSINSIVSFGRNSSLLVGGDFTAPXXXXXXXXXXXXXXXQWSSFSN-KFD 949
             +    F  N  +NS+VSF  N+S+LVGG +                  +W+SF N    
Sbjct: 876  NVARVNFSTNERVNSMVSFSSNNSILVGGSY--EIDNCNDLCLYNYQTKEWTSFLNDSIT 933

Query: 950  GTITGLEFANDSR-LLISGSYRFENQSGISLGYIDLNNQEFKSLLSDSQKVNSF---NYN 1005
            G I  ++FA++ + LL+ G  +  N+S I L  +++ +  F ++ S ++ + SF   + +
Sbjct: 934  GDIRQMQFADEGKTLLVGGLIKTNNESNIQLLSVEVGSNIFSTVKSGTEPLLSFVPIDDS 993

Query: 1006 NGTIVAWDSSTIYSYRGDSWSNHQIPNTNSSTSIKNVQIVSKXXXXXXXXXXXXXXXDEL 1065
               I+A  +S I      +WS+           + N  IVS                  +
Sbjct: 994  TDNIIAQMNSEILRLESGTWSSF-------GPQLNNDSIVSGFKVLSGTESKKRDEGSHI 1046

Query: 1066 ILVFGELYSEDYGFVQAMFYD--FQNWIPYY-ITQPYSSLNTSKNSLFMNKDISLLYESQ 1122
            +L+ G L S ++G + ++ YD   Q W PY+ I+ P    +   +S F N +   L  SQ
Sbjct: 1047 VLLEGTLNSSEWGNLTSVVYDGSTQKWQPYFVISDPKEQESLPSSSFFQNVNDLYLSSSQ 1106

Query: 1123 VVLQNPNXXXXXXXXXXXXXXXXXXXXXXXXLKNGNIESKIHRGYVVLIGLALAIGTVAI 1182
             VLQ+ N                              + KI RG++VLIGLALA+ TVA+
Sbjct: 1107 TVLQSNNSDTSASSTPTPSTTSSSHSTK---------DKKIDRGFIVLIGLALALATVAV 1157

Query: 1183 LGIFGVTMAYIFSDDKGEYVRIKPRIDEHEMLDTVPPEKLMKFI 1226
            +G+ G  + Y F ++ G Y  +KPRI++ EMLDTVPPEKLMKFI
Sbjct: 1158 IGLIGALICYFFINNNG-YESLKPRINQDEMLDTVPPEKLMKFI 1200

>Ecym_4315 Chr4 (679627..683265) [3639 bp, 1212 aa] {ON} similar to
            Ashbya gossypii AGR095W
          Length = 1212

 Score =  589 bits (1518), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 431/1255 (34%), Positives = 642/1255 (51%), Gaps = 97/1255 (7%)

Query: 13   IIGVSQASQLTNVKDSLGINTVNIPQINFGNTNN-EIQILSNIEGLTFYQYQGQQNFTGS 71
            + G++Q SQ+  V +   I     P ++     N ++ I  + +   +Y Y+GQQ FTG 
Sbjct: 14   VAGLAQGSQINGVVNHFNITQYTAPHLDLSTVRNSQLLIFDDFQTFDYYTYKGQQIFTGL 73

Query: 72   IDTNSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTLGGFQLENQLLY 131
             D   N+  LIYYSN+T ++L E  D  +I +IVP  +D+FILSG G   G +LE+QL+Y
Sbjct: 74   ADERKNS--LIYYSNNTYVQLAELPDGAEIKKIVPWGDDSFILSGRGVFEGHRLEHQLIY 131

Query: 132  NLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISWNKVTKNVDMLP 191
            NLS   I  +    L+++  IL D ++VYFGG F+Y   N + +S++ W+   K+  +LP
Sbjct: 132  NLSSFEITEILKEPLEHVNDILTDGEVVYFGGGFTYNDGNLSGHSVVKWDATDKSSSLLP 191

Query: 192  FIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVXXXXXXXXXXXXXXXXXXXXXXX 251
            F GFG+ S VN+I+KLD+ N+LF G FST+D+ +LL                        
Sbjct: 192  FYGFGQGSVVNNIIKLDDSNILFVGKFSTIDNTALLPHRNVSSSFLSNSTNIETNALA-- 249

Query: 252  XXQISLKYASWASLGDLKSSTQFICPNGQNEAWS-SAGTTGEITCNLAFEASLSKIRIFN 310
                SL+++S    G L SS  F+CP G  ++W+    T GE+T  +  + + SKIRI+N
Sbjct: 250  ----SLRFSSLVHDGTLNSSA-FVCPEGSADSWTIPHSTMGELTIRVINQMTPSKIRIYN 304

Query: 311  SPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYSSNALQXXXXXXXXXX 370
            S    +Q+  FRIVT+PS  IMN+TY+DP+T  +  CDA+CPL   + L           
Sbjct: 305  SKDSNNQVNLFRIVTSPSRSIMNMTYVDPITGALAVCDAWCPLQPLSVLSNLAENSTSSV 364

Query: 371  XXXXFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNVGLSGFQLYQNSYSIF 430
                F N N   + W+  YQEFAFVN+VP+  L  IA+ S+G NVGL G +L+Q  Y  +
Sbjct: 365  MAA-FPNNNNVLVKWTAAYQEFAFVNRVPIQELTFIAIDSFGHNVGLLGIELFQAEYDTY 423

Query: 431  ANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPGDDPSPLVNFYPSINRI 490
             NN+LN+P CDS      S    + +WYQGL  QSY+AT +T G    P V   PSI   
Sbjct: 424  VNNTLNQPNCDSQQNFPASVVSKDTVWYQGLPDQSYMATSFTAG---KPSVTLTPSIPYP 480

Query: 491  GNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQNNNEMKYDQLFEGFLD 550
            G YT+N+ TPGC  D TC+FRGIVNVT+       L++   IYQNN  +KYD LF G+LD
Sbjct: 481  GIYTLNLVTPGCLTDNTCAFRGIVNVTIRAQNGTHLMN-RWIYQNNENLKYDPLFRGYLD 539

Query: 551  YAPKVTLEYYSGINDENSPXXXXXXXXXXXPINIELDETIGNVTSSTEELKVP------- 603
             +P V LE+   I+    P             N+ + + + ++  S E+L++        
Sbjct: 540  DSPNVVLEWIGPID----PAAAN---------NVMVADRVTSIIDSIEDLEMKNGTSNSN 586

Query: 604  -LNGMFQYQLXXXXXXXXXXXLKVDNTSLNLFPVSRFSSSVSLYGVEYNETLLLGG-SIA 661
             LNG+FQY               V +T+++ +PV     S SL+G  YN+TL +G  SI 
Sbjct: 587  LLNGLFQYAASNFTNTNLSTL--VGSTNIDQYPVRNIPHSSSLFGQIYNDTLFIGSPSID 644

Query: 662  GVYALSLS--NYTN-IRSTRIXXXXXXXXXXXXXXXXXXLFGNFNISNRIVSSLSYNGTF 718
            G+  +S    ++ + I   ++                  L  + N +N + SSLS+NG+ 
Sbjct: 645  GLAKISRRKDDWNDIIVDPQLIDTEGPVTGIFPYSNGLALTVHSNQTN-MASSLSFNGSI 703

Query: 719  DSFGNVNSNIATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWSAGSNDFGD 778
             +    N+   +  NLT   SEIL F+N Y +N S+ S I N+  L LS+ SAG+N   D
Sbjct: 704  STIFRSNAPSLSILNLTIDGSEILVFDNGYVYNVSSQSDISNSETLKLSLLSAGANLEDD 763

Query: 779  TLFSGLI--TRNEFPNLNNSAVLTGNGTAQS--LQLRNGIQPYLGVYLNDSLTAYLYDS- 833
             + +G +  T++  PN   +     N    S    + +GI  Y G+++NDS +AY Y S 
Sbjct: 764  LILAGNVQSTKHFVPNGAIAIDADSNEVVTSGLPSVDDGII-YRGLFINDSSSAYAYYSK 822

Query: 834  ---SSNSNILFSNGLQGNWNLPRSVSSAYYSDNETMFVGSS-----LSNGDSG--AELFV 883
               SS   I+     +     P  +S+   + N+ +++  S     +++G S   A L++
Sbjct: 823  SLGSSKGGIVVYGEHE-----PEYLSTDDSTVNDMLYIKDSNLLAVVTSGTSQGLASLYI 877

Query: 884  LNFTTMDLLYNETFDVNSSINSIVSFGRNSSLLVGGDFTAPXXXXXXXXXXXXXXXQWSS 943
             + +       ETF++   IN++V FGRN +LLVGG FT                  W+ 
Sbjct: 878  HDLSADFAPIKETFEIGEVINTMVLFGRNYTLLVGGTFTR--NGCRDLCLYNYATNNWTR 935

Query: 944  FSNKFDGTITG----LEFANDSRLLISGSYRFENQSGISLGYIDLNNQEFKSLLSDS--- 996
            F    DG ITG    L+F + + L+++G     +   + L  IDL+N E  S L  +   
Sbjct: 936  F---MDGNITGDIRQLQFLDGNTLMVAGLLASSDSKDLQLVEIDLSNMEIISKLQGTNTG 992

Query: 997  --QKVNSFNYNNGTIVAWDSSTIYSYRGDSWSNHQIPNTNSSTSIKNVQIVSKXXXXXXX 1054
              Q V +   ++  ++A D + ++ +    W N   P+T+  T I  + ++S        
Sbjct: 993  TFQHVLTVGNSSSELIAHDGNQVFHFVDGQWKNIS-PDTSGQTQINGLTLLSTDFSQRNS 1051

Query: 1055 XXXXXXXXDELILVFGELYSEDYGFVQAMFYDFQNWIPYYITQPYSSLNTS---KNSLFM 1111
                    +EL+++ G   S DYG + AM+YDF  W PYY + P  S +     +  LF+
Sbjct: 1052 IMKRDRVGNELVVINGNFSSPDYGDINAMYYDFNGWNPYYFSVPRESNSDEVIPQGQLFL 1111

Query: 1112 NKDISLLYESQVVLQNPNXXXXXXXXXXXXXXXXXXXXXXXXLKNGNIESKIHRGYVVLI 1171
            NKD+S    SQ+ L N N                                K+ + +VVLI
Sbjct: 1112 NKDVSFTSSSQIYLSNDNDNDDTPAASEPATHEKHT-------------KKLAKIFVVLI 1158

Query: 1172 GLALAIGTVAILGIFGVTMAYIFSDDKGEYVRIKPRIDEHEMLDTVPPEKLMKFI 1226
             LALA+ TVA+LG+ GV  AY+F D    Y  +KPRI+E EML TVPPEKLMKFI
Sbjct: 1159 ALALALATVAVLGVVGVLFAYLFGDHNA-YEPLKPRINEAEMLKTVPPEKLMKFI 1212

>AGR095W Chr7 (914098..917703) [3606 bp, 1201 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YLR084C (RAX2)
          Length = 1201

 Score =  585 bits (1508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 409/1264 (32%), Positives = 614/1264 (48%), Gaps = 106/1264 (8%)

Query: 2    LATIVRLISLGIIGVSQASQLTNVKDSLGINTVNIPQINFGNTNNE-IQILSNIEGLTFY 60
            +  +  L  LG   V + S L +V     I     P+++     NE + +  + +   +Y
Sbjct: 5    MGLVAALAPLG--DVVRGSHLESVAQHFDIKHWQTPRLDLSAARNERLLVFDDFQAFEYY 62

Query: 61   QYQGQQNFTGSIDTNSNTHGLIYYSNDTLIKLLEGSDNTKIDQIVPLDEDAFILSGSGTL 120
             Y+GQQ FTG      ++  LIYYS  T ++L +  D+T + +IVP   D+FILSG+G L
Sbjct: 63   NYKGQQLFTGQEQHQGSS--LIYYSEGTYVQLAKLDDDTVVRRIVPFGSDSFILSGTGKL 120

Query: 121  GGFQLENQLLYNLSDLSIIPLFNNQLQNIKSILVDKDIVYFGGNFSYTSNNKTANSIISW 180
               +LE+QL+YNLS L +  +    L+++  ILVD D+VYFGG F+Y+  NK+ +S + W
Sbjct: 121  QDQRLEHQLMYNLSTLEVTEILPQSLESVNDILVDGDMVYFGGQFTYSDGNKSGHSAVQW 180

Query: 181  NKVTKNVDMLPFIGFGKNSTVNSILKLDEDNLLFFGDFSTLDDKSLLVXXXXXXXXXXXX 240
            N  ++   +LPF GFG+ S+VN+ILKL    +LF G FS L+  S               
Sbjct: 181  NATSRTTSLLPFGGFGRGSSVNNILKLSGSGVLFVGRFSNLEAASY---AETASVLASTE 237

Query: 241  XXXXXXXXXXXXXQISLKYASWASLGDLKSSTQFICPNGQNEAW-----SSAGTTGEITC 295
                           SL+Y++  S G L    +FICP   +++W           GE+  
Sbjct: 238  KPQLNVTTIETNALTSLRYSTITSDGHLDKG-KFICPTSNDDSWFVPHSGDGPARGELNI 296

Query: 296  NLAFEASLSKIRIFNSPYEQDQIASFRIVTAPSNGIMNLTYLDPLTSEVKYCDAFCPLYS 355
             +      SKIRI+NS    ++I  FRIVT+PS  IMN+TY+DP T E+  CDA+CPL  
Sbjct: 297  KVLHRIIPSKIRIYNSKKNGNEIKLFRIVTSPSQSIMNMTYIDPNTGELATCDAWCPLMP 356

Query: 356  SNALQXXXXXXXXXXXXXXFINGNKTNIGWSTDYQEFAFVNQVPVTALQVIALTSYGDNV 415
             + L                +N  K  I W+ DYQEFAF+NQ+ +  ++ IAL SYG+NV
Sbjct: 357  RSNL-TSKAAESGPADVARLVNDEKVLIKWTPDYQEFAFINQIHMEEIKFIALDSYGNNV 415

Query: 416  GLSGFQLYQNSYSIFANNSLNEPACDSPNTVIPSSYLSNNIWYQGLNSQSYIATKYTPGD 475
            GL G +L+Q  Y  + N++LN+P C     + P S  + NIW+QG    SY++       
Sbjct: 416  GLVGVELFQTEYDAYVNSTLNQPNCGE-QQLSPFSTTA-NIWHQGATDASYLSANVV--- 470

Query: 476  DPSPLVNFYPSINRIGNYTVNIYTPGCTGDGTCSFRGIVNVTLWDTATNDLISTTLIYQN 535
            + +P+VN  P I   G YT+N+YTPGC  DGTC +RGIVNVTL  +    L+ T  IYQN
Sbjct: 471  ESNPMVNVKPVIPHSGTYTLNLYTPGCEDDGTCDYRGIVNVTLLASNGTTLM-TRWIYQN 529

Query: 536  NNEMKYDQLFEGFLDYAPKVTLEYYSGINDENSPXXXXXXXXXXXPINIELDETIGNVTS 595
            N  +KYD L+ G LD  P V +E+ S I   NS               I+  + + ++  
Sbjct: 530  NYRLKYDPLYTGHLDPNPTVRMEWVSPI---NSAVNRKIMVADRVSAIIDSLDGLDDIRH 586

Query: 596  STEELKVPLNGMFQYQLXXXXXXXXXXXLKVDN---TSLNLFPVSRFSSSVSLYGVEYNE 652
              E+    LNG+FQY               +DN     +N  P +     VSL G  Y+ 
Sbjct: 587  PREK---SLNGLFQYTPAGS---------SLDNGIQKYINKDPQTDMPEGVSLVGQVYDG 634

Query: 653  TLLLGGSIAGVYALSLSNYTNIRSTRIXXXXXXXXXXXXXXXXXXLF--GNFNISNRIVS 710
             L+LG    G  A+     T+     +                  L   G FN+S+   S
Sbjct: 635  KLILGVKSTGHIAVVTPKGTDWNDVDVTRQDVPGSLNGISPYSKGLVFTGKFNLSSGPSS 694

Query: 711  SLSYNGTFDSFGNVNSNIATFSNLTFGESEILAFNNEYFFNTSTSSYIFNTSALSLSIWS 770
            +L Y+G F SF ++NS  ++  N+T   SE+L FNN++ +NTSTS  +  +S   LS  S
Sbjct: 695  ALHYDGNFGSFFDLNSETSSIINMTIDGSELLLFNNKFIYNTSTSQ-MLTSSMFQLSALS 753

Query: 771  AGSNDFGDTLFSGLITRNEFPNLNNSAVLTGNG---TAQSLQLRNGIQPYLGVYLNDSLT 827
            A +N   D LF+G I   +  + + +  L   G   T+ +  + +G + + GVYLND+ T
Sbjct: 754  AAANSNNDLLFTGSIADIKHGSAHGAVALDAEGNIFTSGTPSI-SGARVHRGVYLNDTAT 812

Query: 828  AYLYDSSSNSNILFSNGL-----QGNWNLPRSVSSA----YYSDNETMFVGSSLSNGDSG 878
            AY Y S S ++ + + G+       N+NL  ++++     Y      + + ++   G  G
Sbjct: 813  AYAYYSVSPNSSVATGGVVIETPGNNFNLSNNIATVREMIYVKKTNFLVISTNEVEGTPG 872

Query: 879  AELFVLNFTTMDLLYNETFDVNSSINSIVSFGRNSSLLVGGDFTAPXXXXXXXXXXXXXX 938
            A L + +  T+  +  E  +    INSIV FG +++LLVGG F                 
Sbjct: 873  A-LILYDLRTLQEVAREKLNPGERINSIVLFGEDNTLLVGGSFEK--DGCHDLCLYNFVK 929

Query: 939  XQWSSFSNKF-DGTITGLEFANDSRLLISGSYRFENQSGISLGYIDL------------N 985
              WS+F++    G I  L+F N+  L+  GS   +++  I     DL            N
Sbjct: 930  RSWSAFASGLISGEIKQLQFVNNRNLIAVGSMTVQSRPNILFLNFDLVRSRVVEQHEQPN 989

Query: 986  NQEFKSLLSDSQKVNSFNYNNGTIVAWDSSTIYSYRGDSWSNHQIPNTNSSTSIKNVQIV 1045
             + F S+L+     + +       VA D   ++ Y G  W     P +     I  + ++
Sbjct: 990  GRAFNSVLTIGDSGDEY-------VAEDGKQVWHYSGSEWKT-VTPLSGGQIRIDGISLL 1041

Query: 1046 SKXXXXXXXXXXXXXXXDELILVFGELYSEDYGFVQAMFYDFQNWIPYYIT---QPYSSL 1102
                             +EL+++ G++ S +YG + AM Y+F+NW PYY T         
Sbjct: 1042 --MLNNPRSQNKRNRVGNELVVIHGQMNSSEYGEINAMHYNFENWEPYYFTIGSSAREEF 1099

Query: 1103 NTSKNSLFMNKDISLLYESQVVLQNPNXXXXXXXXXXXXXXXXXXXXXXXXLKNGNIESK 1162
            N  +  +F+N+DIS    + + L+                                 + K
Sbjct: 1100 NVPRGQIFLNQDISRQTTTSLPLE---------------------VVVSDSPPTAEPKRK 1138

Query: 1163 IHRGYVVLIGLALAIGTVAILGIFGVTMAYIFSDDKGEYVRIKPRIDEHEMLDTVPPEKL 1222
            + +GYVVLI L LA+ T+A+LGI GV +AY F D    Y  +KPRI+E EML TVPPEKL
Sbjct: 1139 LAKGYVVLIALGLALATIALLGIIGVILAYAFGDHNA-YQPLKPRINEDEMLKTVPPEKL 1197

Query: 1223 MKFI 1226
            MKFI
Sbjct: 1198 MKFI 1201

>Smik_4.93 Chr4 complement(178595..179446) [852 bp, 283 aa] {ON}
           YDL142C (REAL)
          Length = 283

 Score = 34.7 bits (78), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 38/129 (29%), Positives = 56/129 (43%), Gaps = 14/129 (10%)

Query: 98  NTKIDQIVPLDEDAFILSGSGTLGGFQLENQLLYNL------SDLSIIPL----FNNQLQ 147
            T + + +P     ++LSG      FQ+E QL YNL       +L+  P       N L 
Sbjct: 11  TTLLLRTIPKRPSYYVLSG--LTKHFQVEAQLKYNLLRSHTRRELATAPARPPKVKNNLL 68

Query: 148 NIKSILVDKDIVY--FGGNFSYTSNNKTANSIISWNKVTKNVDMLPFIGFGKNSTVNSIL 205
           NI +IL    I    F G F  TSN   A S+ +++ +T  +D      +G  +   +IL
Sbjct: 69  NIPNILTLSRIACTPFIGLFIITSNLTPALSLFAFSSITDFMDGYIARKYGLKTVAGTIL 128

Query: 206 KLDEDNLLF 214
               D LL 
Sbjct: 129 DPLADKLLM 137

>TPHA0K01360 Chr11 complement(283543..284961) [1419 bp, 472 aa] {ON}
           Anc_4.155 YGR019W
          Length = 472

 Score = 33.1 bits (74), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 22/55 (40%), Positives = 29/55 (52%), Gaps = 6/55 (10%)

Query: 277 PNGQNEAWSSAGTTGEITCNLAFEASL----SKIRIFNSPYEQDQIASFRIVTAP 327
           PNGQN+ WS  G +G     LAF+A+      K R F + Y +D+ AS     AP
Sbjct: 122 PNGQNKIWS--GLSGSDANELAFKAAFMYYCGKKRGFKTKYTEDENASVMDNQAP 174

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 128,193,423
Number of extensions: 5934781
Number of successful extensions: 19045
Number of sequences better than 10.0: 86
Number of HSP's gapped: 19333
Number of HSP's successfully gapped: 105
Length of query: 1226
Length of database: 53,481,399
Length adjustment: 121
Effective length of query: 1105
Effective length of database: 39,606,813
Effective search space: 43765528365
Effective search space used: 43765528365
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 72 (32.3 bits)