Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_392.18.270ON42442422190.0
YDR118W (APC4)8.270ON6524237851e-97
Skud_4.3788.270ON6524177851e-97
TPHA0J007908.270ON6854347793e-96
Smik_4.3628.270ON6484197745e-96
Suva_2.2778.270ON6494217476e-92
ZYRO0C01474g8.270ON5994177081e-86
KAFR0B054608.270ON6104216891e-83
TDEL0F039708.270ON6194206812e-82
NCAS0B037908.270ON6124205344e-61
KNAG0H031908.270ON6224245057e-57
SAKL0H16852g8.270ON6444305022e-56
TBLA0C045708.270ON6083474961e-55
NDAI0J012708.270ON7353744922e-54
CAGL0B01859g8.270ON6224314715e-52
Kwal_56.237668.270ON7404214352e-46
KLTH0G13508g8.270ON6454213997e-42
Ecym_43008.270ON715119980.002
AGR078C8.270ON715197850.066
KLLA0F19316g8.270ON671208830.11
Kpol_392.98.257ON59487770.62
NCAS0I008903.389ON35581731.7
Kwal_55.217865.679ON327212712.5
Suva_4.3983.108ON344150712.6
YBR149W (ARA1)3.108ON344143713.0
Smik_2.289singletonON344157694.8
NCAS0J013304.227ON362108679.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_392.1
         (424 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON} compl...   859   0.0  
YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subuni...   306   1e-97
Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W ...   306   1e-97
TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8....   304   3e-96
Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W ...   302   5e-96
Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa...   292   6e-92
ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {...   277   1e-86
KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa] ...   270   1e-83
TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.2...   266   2e-82
NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {O...   210   4e-61
KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {O...   199   7e-57
SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]...   197   2e-56
TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON} Anc_8...   195   1e-55
NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8....   194   2e-54
CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly...   186   5e-52
Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {...   172   2e-46
KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]...   158   7e-42
Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}...    42   0.002
AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON} S...    37   0.066
KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON} cons...    37   0.11 
Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON} (24389..26...    34   0.62 
NCAS0I00890 Chr9 complement(163457..164524) [1068 bp, 355 aa] {O...    33   1.7  
Kwal_55.21786 s55 (979567..980550) [984 bp, 327 aa] {ON} YOR075W...    32   2.5  
Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W ...    32   2.6  
YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+ ...    32   3.0  
Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W ...    31   4.8  
NCAS0J01330 Chr10 complement(228730..229818) [1089 bp, 362 aa] {...    30   9.6  

>Kpol_392.1 s392 complement(1..1272) [1272 bp, 424 aa] {ON}
           complement(1..1272) [1272 nt, 424 aa]
          Length = 424

 Score =  859 bits (2219), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 424/424 (100%), Positives = 424/424 (100%)

Query: 1   MVIDSGIRLYYSKYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYS 60
           MVIDSGIRLYYSKYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYS
Sbjct: 1   MVIDSGIRLYYSKYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYS 60

Query: 61  GRFISVFLTDGTIRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEFSIPSKLQLFDSNII 120
           GRFISVFLTDGTIRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEFSIPSKLQLFDSNII
Sbjct: 61  GRFISVFLTDGTIRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEFSIPSKLQLFDSNII 120

Query: 121 ECLPTLIKFVKDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDN 180
           ECLPTLIKFVKDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDN
Sbjct: 121 ECLPTLIKFVKDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDN 180

Query: 181 FTIILNGVYEINGIVMPDISKSEVYQLLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNG 240
           FTIILNGVYEINGIVMPDISKSEVYQLLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNG
Sbjct: 181 FTIILNGVYEINGIVMPDISKSEVYQLLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNG 240

Query: 241 LLSNILEIRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTG 300
           LLSNILEIRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTG
Sbjct: 241 LLSNILEIRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTG 300

Query: 301 EINNEFKDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYLN 360
           EINNEFKDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYLN
Sbjct: 301 EINNEFKDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYLN 360

Query: 361 GYMKTDTDFYDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWINDKINEITDEDYK 420
           GYMKTDTDFYDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWINDKINEITDEDYK
Sbjct: 361 GYMKTDTDFYDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWINDKINEITDEDYK 420

Query: 421 NRVL 424
           NRVL
Sbjct: 421 NRVL 424

>YDR118W Chr4 (685882..687840) [1959 bp, 652 aa] {ON}  APC4Subunit
           of the Anaphase-Promoting Complex/Cyclosome (APC/C),
           which is a ubiquitin-protein ligase required for
           degradation of anaphase inhibitors, including mitotic
           cyclins, during the metaphase/anaphase transition;
           component of the platform domain of the APC/C, based on
           structural analysis
          Length = 652

 Score =  306 bits (785), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 167/423 (39%), Positives = 253/423 (59%), Gaps = 14/423 (3%)

Query: 3   IDSGIRLYYSKYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGR 62
           + S I  Y+  YNP F ++ TR  +GLA+YR+ D ++LA I I++ + VA Y+WD  +G+
Sbjct: 1   MSSPINDYFIDYNPLFPIFATRIAKGLAIYRVSDHARLAVIPIRNINLVANYDWDTTTGK 60

Query: 63  FISVFLTDGTIRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEFSIPSKLQLFDSNIIEC 122
           F+S+F  DGTIRI+DIFK+GRLVS++R  S K +   +WDR         + F  NII+ 
Sbjct: 61  FLSIFFKDGTIRIHDIFKDGRLVSFLRIPSTK-ISKGIWDRIPLRYEPNNRDFACNIIDD 119

Query: 123 LPTLIKFVKDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDNFT 182
           LP LI+FVKDS+ INI+ Y  PN  WR  D++  D++++      LDVH+  N   D  T
Sbjct: 120 LPKLIRFVKDSKRINIVPYTQPNSLWRGPDEDDLDSNEK------LDVHVVFNEGNDKIT 173

Query: 183 IILNGVYEINGIVMPDISKSEVYQLLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNGLL 242
           +  NG Y +   V    +++ +  ++K+ +G Y  FY++G  + +N   LL    S  LL
Sbjct: 174 VFFNGDYAVFLSVDNIENENSLKSIIKVQDGFYQCFYEDGTVQTLNLGPLLQSKSSVNLL 233

Query: 243 SNILEIRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGEI 302
           + I+ I+ L  Y+  HL+ I REL  PY DFVK++C +AY  G  KL  ELE+L L GEI
Sbjct: 234 NYIMVIKELIGYMLTHLEFINRELATPYLDFVKRLCDEAYGYG--KLKSELEALFLLGEI 291

Query: 303 NNEFKDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYLNGY 362
           + + +DWL N +G++N K+W+ LG + ++K V+ILTL  +P+CER +IY+E+    L  +
Sbjct: 292 SCDLEDWLCNSVGEKNFKRWKYLGCEAYQKTVQILTLIFVPACERIIIYVEKLRAILQAF 351

Query: 363 -----MKTDTDFYDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWINDKINEITDE 417
                +   +D   +  L +   KL+  ++  I  L      FE F  W ND+++E  DE
Sbjct: 352 SIQNKLSYTSDLTAVEVLLKSSQKLLTMTLNSIIGLGRDETLFEKFFIWFNDRLHEALDE 411

Query: 418 DYK 420
           DYK
Sbjct: 412 DYK 414

>Skud_4.378 Chr4 (657502..659460) [1959 bp, 652 aa] {ON} YDR118W
           (REAL)
          Length = 652

 Score =  306 bits (785), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 166/417 (39%), Positives = 250/417 (59%), Gaps = 16/417 (3%)

Query: 10  YYSKYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLT 69
           Y+  YNP F ++ TR  +GLA++R+ D +++A I +++   VA Y WD  SG+F+S+F  
Sbjct: 8   YFIDYNPRFPIFATRITKGLAIHRVSDHARIAIIPVRNIALVANYSWDRTSGKFLSIFFK 67

Query: 70  DGTIRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEFSIPSKLQLFDSNIIECLPTLIKF 129
           DGT+RI+DIFK+GRLVS++R  S K +   +WDR         + F  N+I+ LP LI+F
Sbjct: 68  DGTVRIHDIFKDGRLVSFLRVPSTK-ISRGIWDRIPLKREYDSETFAYNVIDILPKLIRF 126

Query: 130 VKDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDNFTIILNGVY 189
           VKDS+ ++I+ Y PPN  WR  D++  ++ +      +LDVH+  N   D  TI  NG Y
Sbjct: 127 VKDSKRVSIVPYTPPNGLWRGPDEDDPESGE------ILDVHVIFNEGNDKITIFFNGDY 180

Query: 190 EINGIVMPDISKSEVYQ-LLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNGLLSNILEI 248
            I  + M DI    + + ++K+ +G Y  FY +G  R +N   LL    S  LL  I+ I
Sbjct: 181 TI-LLPMDDIENERILESVVKVQDGFYHCFYNDGSVRTLNLQPLLRSKPSVDLLHYIMVI 239

Query: 249 RNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGEINNEFKD 308
           + L  Y+  H++LI RELI PY DFVK+IC +AY  G  KL  ELE L L GE++ + +D
Sbjct: 240 KELIGYLLAHVELINRELITPYLDFVKRICDEAY--GYNKLKSELECLFLLGEVSCDLED 297

Query: 309 WLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYLNGYMKTD-- 366
           WL N +G++N KKW+ LG + ++K  +ILTL  +P+CER +I++E+  G L  +   +  
Sbjct: 298 WLCNSVGEKNLKKWKFLGCEAYQKTTQILTLVFVPTCERIIIFVEKLRGTLEAFSVQNKS 357

Query: 367 ---TDFYDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWINDKINEITDEDYK 420
              +D   +  L +   +L+ N++  I +L      FE F  W ND+I+E  DEDYK
Sbjct: 358 NNTSDLTAVELLLKNSQELLNNTLKSIIALGRNETLFEKFFIWFNDRIHEGLDEDYK 414

>TPHA0J00790 Chr10 (182991..185048) [2058 bp, 685 aa] {ON} Anc_8.270
           YDR118W
          Length = 685

 Score =  304 bits (779), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 165/434 (38%), Positives = 266/434 (61%), Gaps = 20/434 (4%)

Query: 1   MVIDSGIRLYYSKYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYS 60
           M   S  +LYY K NP +QLY  +SD+GLA+  I D S LA IFIKDF  V  + WD+ +
Sbjct: 1   MTEHSDSQLYYYKLNPIYQLYTFKSDKGLAICTISDHSILATIFIKDFSLVVDFFWDSIT 60

Query: 61  GRFISVFLTDGTIRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEF--SIPSKLQLFDSN 118
           G+F+     DG+IR+YDIFK GRLVS+ R S  K +    WDR     ++  +L++FD +
Sbjct: 61  GKFLLFAFNDGSIRVYDIFKLGRLVSFFR-SPLKQIKCVYWDRIIITETLDQQLKIFDYD 119

Query: 119 IIECLPTLIKFVKDSRNINIIDYYPPNHSWRHVDKE----SQDTDKEIDFRNLLDVHIQH 174
           +   +PTL+KFVKD + + ++       +WR +D +     +++  E+   ++LD+H+ +
Sbjct: 120 LTNSMPTLVKFVKDPQGLQLVPVLKNTQAWRQIDVDLNLKLENSKTEVSTDDVLDIHLLY 179

Query: 175 NPN-EDNFTIILNGVYEINGIVMPDISKSEVYQLLKLHNGEYMSFYKNGHYRKINFNNLL 233
             +  DNF +++NGVY+++ I +P+ S ++V +L+K   G+Y+ FY+N  YR I+     
Sbjct: 180 TESGMDNFAVLVNGVYDLSDIHVPNRSPNKVIKLVKASQGKYLGFYENASYRLIDVTPFS 239

Query: 234 SCNVSNGLLSNILEIRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDEL 293
           S ++   LL+N +++RN    + + +++IK+ELI P+  F+  +C+DAY  G   L   +
Sbjct: 240 SNDIRVNLLNNSIDLRNSVSLLKEQIEIIKKELISPFESFINLVCVDAYE-GYDNLYRSM 298

Query: 294 ESLLLTGEINNEFKDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLE 353
            +LLLTGEI+ EF+DWL+N IG+RN +KW+ LG+++ +K+V+IL+L  IP  E+F+I  E
Sbjct: 299 TNLLLTGEISEEFEDWLINTIGERNLRKWKNLGIELLDKLVQILSLIFIPITEKFIITAE 358

Query: 354 RTDGYLNGY--------MKTDTDFYDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSE 405
           R   Y+           ++ D++  D+I      S +++ SI  I  LNN    FEIF +
Sbjct: 359 RIQNYITAMRLSDNSKILENDSEINDLIL---NLSNILKTSIKQIPILNNDKMAFEIFID 415

Query: 406 WINDKINEITDEDY 419
           WI + I  I DE+Y
Sbjct: 416 WIRNTIYLIIDENY 429

>Smik_4.362 Chr4 (647135..649081) [1947 bp, 648 aa] {ON} YDR118W
           (REAL)
          Length = 648

 Score =  302 bits (774), Expect = 5e-96,   Method: Compositional matrix adjust.
 Identities = 162/419 (38%), Positives = 249/419 (59%), Gaps = 14/419 (3%)

Query: 10  YYSKYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLT 69
           Y+  YNP F ++ TR+ +GLA+ R+ D ++LA I I++ + VA Y WD  +G+F+S+F  
Sbjct: 8   YFIDYNPRFPIFATRTAKGLAINRVSDHARLAAIPIRNINLVANYNWDTVTGKFLSIFFK 67

Query: 70  DGTIRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEFSIPSKLQLFDSNIIECLPTLIKF 129
           DGTIRI+DIFK+GRLVS++R  S K +    WDR      S       NII+ LP LI++
Sbjct: 68  DGTIRIHDIFKDGRLVSFLRIPSTK-ISKGTWDRIPLESESGNGNLAYNIIDYLPKLIRY 126

Query: 130 VKDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDNFTIILNGVY 189
           VKDS+ INI+ Y PPN  WR  D++  + +++      LD+HI  N   D  T+  NG Y
Sbjct: 127 VKDSKRINIVPYTPPNSLWRGPDEDEPENNEK------LDIHIIFNEGHDKITVFFNGDY 180

Query: 190 EINGIVMPDISKSEVYQLLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNGLLSNILEIR 249
            I   V  D ++  V  ++K+ +G Y  FY +G  R +N   LL    S  +L  I+ I+
Sbjct: 181 AIFVPVGADENERFVKSIVKIQDGFYHCFYDDGTVRTLNLGPLLRSEPSMNILKYIMAIK 240

Query: 250 NLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGEINNEFKDW 309
            L  Y+ +H++ I REL+ PY +FV ++C +AY  G  KL  ELE L L GE++ + +DW
Sbjct: 241 ELIGYLLNHIEFINRELVTPYLEFVNRLCDEAY--GYDKLISELECLFLLGEVSCDLEDW 298

Query: 310 LVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYLNGY-----MK 364
           L N +G++N K+W+ LG + ++K  +ILTL  +P+CER +I++E+  G L  +       
Sbjct: 299 LCNSVGEKNFKRWKCLGCEAYQKTTQILTLIFVPACERIIIFVEKLRGILEAFSIQNKFN 358

Query: 365 TDTDFYDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWINDKINEITDEDYKNRV 423
             +D   + +L +   +L+  ++  I  L      FE F  W+ND+I+E+ DEDYK +V
Sbjct: 359 DSSDLTAVDTLLKNSQELLTITLKSIVDLGKDETLFETFFIWLNDRIHEVLDEDYKLKV 417

>Suva_2.277 Chr2 (480574..481624,481684..482579) [1947 bp, 649 aa]
           {ON} YDR118W (REAL)
          Length = 649

 Score =  292 bits (747), Expect = 6e-92,   Method: Compositional matrix adjust.
 Identities = 157/421 (37%), Positives = 243/421 (57%), Gaps = 20/421 (4%)

Query: 10  YYSKYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLT 69
           Y+  YNP F ++  R  +GLA++R+ D ++LA I +++   VA Y WD  +G+F+S+F  
Sbjct: 4   YFIDYNPRFPIFAIRVVKGLAIHRVSDHARLAVIPVRNIALVANYNWDVSTGKFLSIFFK 63

Query: 70  DGTIRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEFSIPSKLQLFDSNIIECLPTLIKF 129
           DGTIRI+DIFK+GRLVS++R    K +   +WDR      S  + F +N+I+ LP LI+F
Sbjct: 64  DGTIRIHDIFKDGRLVSFLRIPRTK-ISRGIWDRIPLKYESSNRNFANNVIDVLPKLIRF 122

Query: 130 VKDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDNFTIILNGVY 189
           VKDS+ + I  Y PPN  WR  D++  +  +       LD+H+  N   D  T+  NG Y
Sbjct: 123 VKDSKRVTIAPYTPPNSLWRGPDEDDPENCEN------LDIHVIFNEGNDKITVFFNGDY 176

Query: 190 EINGIVMP--DISKSEVYQ-LLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNGLLSNIL 246
               I++P  DI   ++ + ++K+ NG Y  FY +G     N   LL    S  LL  ++
Sbjct: 177 ---AILLPVSDIENEKILKSVVKVQNGFYHCFYNDGTVSTFNLERLLQSEPSVDLLRYMM 233

Query: 247 EIRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGEINNEF 306
            I+ L  Y+  H++ I REL  PY DFVK+IC +AY  G +KL  EL+ L L GE+ ++ 
Sbjct: 234 VIKELIGYLLAHIEFINRELTTPYMDFVKRICDEAY--GYSKLKSELKCLFLLGEVPSDL 291

Query: 307 KDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYLNGY---- 362
            DWL N +G++N K+W+ LG + ++K V++ TLA +P+CER +I++++  G L  +    
Sbjct: 292 DDWLCNAVGEKNFKRWKVLGCEAYQKTVQVFTLAFVPTCERIIIFVQKLKGILEAFSIQX 351

Query: 363 -MKTDTDFYDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWINDKINEITDEDYKN 421
                 D   +  L +   +L+  ++  I  L      FE F  W ND+I+E+ DEDYK 
Sbjct: 352 XXXXXXDLTAVELLLKQSQELLNITLKSIIDLGKDETLFEKFLMWFNDRIHEVLDEDYKP 411

Query: 422 R 422
           +
Sbjct: 412 K 412

>ZYRO0C01474g Chr3 complement(106209..108008) [1800 bp, 599 aa] {ON}
           weakly similar to uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 599

 Score =  277 bits (708), Expect = 1e-86,   Method: Compositional matrix adjust.
 Identities = 148/417 (35%), Positives = 251/417 (60%), Gaps = 24/417 (5%)

Query: 11  YSKYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLTD 70
           Y  YNP + LYV +  +G +V+R+ D +++A I ++D   VAGY+WD  +G+F+S+F  D
Sbjct: 5   YVDYNPVYPLYVKQFTRGFSVHRMADDARIATIIVRDMSQVAGYQWDPITGKFLSIFYKD 64

Query: 71  GTIRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEFSIPSKLQL----FDSNIIECLPTL 126
           GT+RIYD F++GRLVS +R+SS   V S +WDR E  + S+  +     D ++ E +P +
Sbjct: 65  GTVRIYDGFRSGRLVSLLRASSNGAV-SGIWDRIEL-LHSEENIKDWSIDHDVTEMMPKM 122

Query: 127 IKFVKDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDNFTIILN 186
           +KF +DSR + ++ Y  P+  WR   + + DT+       LLD H+      D+ +++ +
Sbjct: 123 VKFARDSRQLCVVPYTLPSDVWR--PQAADDTNA------LLDAHVIR--CHDSLSVMFD 172

Query: 187 GVYEINGIVMPDISKSEVYQLLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNGLLSNIL 246
           G + I+ I +  I    V  +   H  +Y++FY++G   + +  NL+    S  LL N++
Sbjct: 173 GEFTIS-IQLAAIPSPLVKFVSAQH--QYLAFYQDGSVERFDLANLVKDPFSLRLLKNVI 229

Query: 247 EIRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGEINNEF 306
            +R L+RY+ DH++LI+R+L+ PY +F+++ C  A+ GG   L ++L  L+L G++  E 
Sbjct: 230 TMRQLHRYLQDHIELIQRDLLQPYDEFLERCCQGAF-GGYDLLREQLIDLMLVGDVTPEL 288

Query: 307 KDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDG-YLNGYMKT 365
           +DWLVN +G++N K+WRKLG D + K +++LTLA +P+CER +   +R  G  L+  +  
Sbjct: 289 EDWLVNSMGEKNLKRWRKLGTDAYHKTLQVLTLACLPACERLISLGQRCTGNLLSRQLTL 348

Query: 366 DTDFYDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWINDKINEITDEDYKNR 422
                  I   ++F   ++N +  I SL++Q +    F +W +D++ E  DEDYK R
Sbjct: 349 QLPLLPPIDCLQFF---LKNVLEAIASLSSQQRLLGSFLDWFDDRVRESIDEDYKLR 402

>KAFR0B05460 Chr2 complement(1118755..1120587) [1833 bp, 610 aa]
           {ON} Anc_8.270 YDR118W
          Length = 610

 Score =  270 bits (689), Expect = 1e-83,   Method: Compositional matrix adjust.
 Identities = 142/421 (33%), Positives = 246/421 (58%), Gaps = 19/421 (4%)

Query: 11  YSKYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLTD 70
           Y  YN    LY  +  +GL VYR  D++ +AH  IK ++ VAG  WD  SG+++S+F  D
Sbjct: 11  YCVYNKKLPLYTEKGPKGLMVYRRSDNTAIAHTIIKKWELVAGIYWDKISGKYLSIFFRD 70

Query: 71  GTIRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEFSIPSKLQLFDSNIIECLPTLIKFV 130
           G+IRI D+FK+G+LV+++R+   KNVD   WDR E    ++++ F+ NI++ +P+LI+FV
Sbjct: 71  GSIRIIDVFKDGKLVAFLRTQF-KNVDCTYWDRIEEQTTNEMKQFNKNIVDLMPSLIQFV 129

Query: 131 KDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDNFTIILNGVYE 190
             +  +++I Y P N +WR +D + +          ++D+H  H    D+F ++LNG Y 
Sbjct: 130 SSANKLSLIPYTPSNANWRELDAKWKKN-------RVIDMHCLHQSETDSFLMVLNGDYY 182

Query: 191 INGIVMPDISKSE---VYQLLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNGLLSNILE 247
           +  +  P+   SE      L+K  N  Y   YK+G  RKI+ ++ LS      LL  IL 
Sbjct: 183 LT-LKTPETDLSEKVPACSLIKSANSLYQCIYKDGSARKIDTSSFLSSKSCIDLLECILS 241

Query: 248 IRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGEINNEFK 307
           ++++++Y  +HLDL++R +I PY DF++KIC  A+  G  KL +EL+   L G I++E +
Sbjct: 242 LKDMSKYTRNHLDLLERVIIKPYLDFLEKICDGAF--GREKLINELKITFLLGTISDELQ 299

Query: 308 DWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYLNGYM---- 363
           DWL   +GD+N  +WR L  D +++  ++ T+A++ +CER ++  ER  G +  +     
Sbjct: 300 DWLHYSVGDKNVTQWRTLCHDAYQQTTELFTIALMCACERMILLSERCFGLIMAFQFESG 359

Query: 364 -KTDTDFYDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWINDKINEITDEDYKNR 422
              ++  +++  L      ++++ I       N+ +  +IF  W+ND+++E  D+DYK +
Sbjct: 360 ADDNSRLHELNELMSNLQDMLKSIIYTAEESANKFEMLKIFLSWLNDRVHEELDDDYKPQ 419

Query: 423 V 423
           +
Sbjct: 420 L 420

>TDEL0F03970 Chr6 (735393..737252) [1860 bp, 619 aa] {ON} Anc_8.270
           YDR118W
          Length = 619

 Score =  266 bits (681), Expect = 2e-82,   Method: Compositional matrix adjust.
 Identities = 143/420 (34%), Positives = 250/420 (59%), Gaps = 15/420 (3%)

Query: 9   LYYSKYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFL 68
           L Y  YNP + LY  + ++GL++ R+ D++++A + ++D + +A ++WD  +G+ ++VF 
Sbjct: 6   LDYRCYNPLYSLYAKKFNKGLSICRVADNAKIATVAVRDLNVLAQFQWDPITGKRMTVFY 65

Query: 69  TDGTIRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEFSIPSKLQLFDSNIIECLPTLIK 128
            DG  RIYD F+ G+L++ +R S  + VD  +WDR E S       FD  ++  +P +I+
Sbjct: 66  KDGNARIYDAFQAGKLLALLRISKTR-VDGAIWDRIELSRQEVTFKFDHFVLNSMPKMIR 124

Query: 129 FVKDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDN-FTIILNG 187
           F +D+R I I+ Y PPN +WR   +E     +E   + +LDVH+ H   EDN   ++L+G
Sbjct: 125 FARDTRQIFILPYEPPNKTWRLATEEEDGVKRE---KEILDVHLVHQ--EDNGLVLMLDG 179

Query: 188 VYEINGIVMPDISKSEVYQLLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNGLLSNILE 247
            + +     P  S   +  ++    G Y  FY++     ++ + L+ C+ +  L+ + + 
Sbjct: 180 DFILRLAAGP--SGPALKDIVVADRGLYHCFYEDATVESLSLDQLIQCDATIQLIQHFIA 237

Query: 248 IRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGEINNEFK 307
           I+ LN Y+ DHLDLIKR+L+ PY++F+ KIC  A+  G   L++ELESLLL G ++ E +
Sbjct: 238 IKQLNHYLQDHLDLIKRDLVAPYTEFLTKICDAAF--GYEILHEELESLLLGGGLSVELE 295

Query: 308 DWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYLNGYM---- 363
           +W    +G++N KKW+K+G++M++K ++ILTL+ IP+CER ++  ER    L        
Sbjct: 296 NWFCYTVGEKNFKKWKKMGLEMYQKTIQILTLSFIPACERVILLSERCRACLKALQLIES 355

Query: 364 KTDTDFYDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWINDKINEITDEDYKNRV 423
            T TD  +  +L       +R+++  I  ++ Q   F+ F +W +D+++E  DEDYK ++
Sbjct: 356 STTTDSSEFANLTSLSQTYLRSTVETIQGVSAQEVLFQTFLQWFDDRLHEALDEDYKQKL 415

>NCAS0B03790 Chr2 complement(676973..678811) [1839 bp, 612 aa] {ON}
           Anc_8.270 YDR118W
          Length = 612

 Score =  210 bits (534), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 117/420 (27%), Positives = 227/420 (54%), Gaps = 30/420 (7%)

Query: 14  YNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLTDGTI 73
           YNP +   + ++  G AV R +D +Q+  I I++ D V    W+++   +++V   DG+ 
Sbjct: 11  YNPSYPAKLYKTSYGFAVRRTRDDTQIVKIVIRNMDAVIATCWNSFGSNYLTVMFNDGSA 70

Query: 74  RIYDIFKNGRLVSYIRSSS--QKNVDSCLWDRAEFSIPSKLQLFDSNIIECLPTLIKFVK 131
           RI+DIF+ G+L++ +R     QK +D+ +W + E         FD +I   +P+ IKFV 
Sbjct: 71  RIHDIFREGKLMTLLRLQDGFQKCMDTGIWSKLEVRQKPNEGEFDRDISGLMPSPIKFVN 130

Query: 132 DSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDNFTIILNGVYEI 191
           ++  + ++ Y      WR+V       DK ++  +++D+H+ HN N D + +++NGVY++
Sbjct: 131 NAGQLEVVPYVVTQTQWRNV-------DKPLEVNDIIDIHMAHNSNTDEYLLMINGVYKL 183

Query: 192 NGIVMPDI----SKSEVYQLLKLHNGE-YMSFYKNGHYRKINFNNLLSCNVSNGLLSNIL 246
              + P+     + +++++++ L     +  FYK+     I+   L+       LL+ + 
Sbjct: 184 T--IQPNSTDENASNQLHKIIHLEKTAIFHCFYKDRKTSTIDLTTLMESTPHVSLLNVLT 241

Query: 247 EIRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGEINNEF 306
           E++ L+RY+ DHLD+I  +L  P  DF++   I      +  L+  L+S +L G +    
Sbjct: 242 EMKQLHRYIVDHLDIIDNDLKKPLDDFLEVTNI----LNIKDLSKSLKSFILYGLMAKSL 297

Query: 307 KDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYL------- 359
             WL N++G++N KKW++L    ++KI++I++LA++P+ E+  +   R +  +       
Sbjct: 298 NHWLCNVVGEKNLKKWKRLSETKYQKIIQIISLAVLPALEKLSLLSIRCEALVVAIALPA 357

Query: 360 NGYMKTDTDFYDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWINDKINEITDEDY 419
           +G+M+ + +++D  SL+   + L   ++ I    + + K   +F  WI D I E  DEDY
Sbjct: 358 SGHMQ-ELEYFD--SLKRTTAALCNQALNITQKTSEEEKKCSVFILWIQDLIFECVDEDY 414

>KNAG0H03190 Chr8 complement(597550..599418) [1869 bp, 622 aa] {ON}
           Anc_8.270 YDR118W
          Length = 622

 Score =  199 bits (505), Expect = 7e-57,   Method: Compositional matrix adjust.
 Identities = 119/424 (28%), Positives = 211/424 (49%), Gaps = 25/424 (5%)

Query: 8   RLYYSKYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVF 67
           R +Y++ N    LYVTR  + L V R  D S +A  FI+D   V  Y+WD   G  ISV 
Sbjct: 9   RQFYTEVNNVLPLYVTRGTKQLVVNRDTDDSTIASTFIRDPSQVVSYQWDTIGGEIISVM 68

Query: 68  LTDGTIRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEFSIPSKLQL--FDSNII-ECLP 124
             DG+IRI D+  + +LV+ +R + +  +D  LWDR    +PS+ Q   +D +II + LP
Sbjct: 69  FQDGSIRINDVMYDAKLVALLR-TQRTGLDCVLWDR--IRLPSRAQSMEWDPDIITQSLP 125

Query: 125 TLIKFVKDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDNFTII 184
            L+KF+    + ++  Y P NHSWR  +  +           +LDVH  H    D    +
Sbjct: 126 RLVKFMGSDASPSMSPYLPTNHSWRFPNSGAAG--------GILDVHFLHQKLGDTLVAL 177

Query: 185 LNGVYEINGIVMPDISKSEVYQLLKLHNGE---YMSFYKNGHYRKINFNNLLSCNVSNGL 241
           LNG Y++         +SE+ +++   + +   Y  +YK G  R+++    +    +  L
Sbjct: 178 LNGEYQLQLTGPHQEDQSELRKIIARTDSKRHVYNCYYKTGPVRQVDLTGFVEDKDTIKL 237

Query: 242 LSNILEIRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGE 301
           L   L  ++   Y   HL+ I+ E + PY +F++++C DA+  G  KL + L    L G 
Sbjct: 238 LERFLLFQDYLGYFLAHLEPIQTECVEPYQEFIERLCEDAF--GKEKLQESLTDHFLVGS 295

Query: 302 INNEFKDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYL-- 359
           ++ E +DWLV  +G+RN ++W+ L    + +  +++ + ++P  ER +I  E+    +  
Sbjct: 296 MDEELRDWLVYSLGERNLEEWKSLMNTAYRRTSQVVLMCLVPVSERLIILCEQLQALVLT 355

Query: 360 ----NGYMKTDTDFYDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWINDKINEIT 415
                G +    +  +   L E   +L++  +  +  L   +K  ++F  W+ + +    
Sbjct: 356 AQLSEGMVGDSLEISEFTDLLENCQELLQLVLQTVKQLAKDIKDIKVFLLWLENVLKTTI 415

Query: 416 DEDY 419
           ++DY
Sbjct: 416 NKDY 419

>SAKL0H16852g Chr8 complement(1482321..1484255) [1935 bp, 644 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C) which is a
           ubiquitin-protein ligase required for degradation of
           anaphase inhibitors including mitotic cyclins during the
           metaphase/anaphase transition
          Length = 644

 Score =  197 bits (502), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 126/430 (29%), Positives = 223/430 (51%), Gaps = 37/430 (8%)

Query: 14  YNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLTDGTI 73
           +NP   L++  + +G+AV R  D  ++A + +KD  T+  Y+W+   GR  +V  ++G I
Sbjct: 20  WNPVLSLFLVPTVKGIAVNRPVDGQRIATVSVKDHGTIVDYQWEQSEGRIFAVCHSNGII 79

Query: 74  RIYDIFKNGRLV-SYIRSSSQKNVDSCLWDRAEFSIPSKLQ-LFDSNIIECLPTLIKFVK 131
           R+YD    G+ V S I   S  +V    W +  ++  SK   +FD  I   +P L+KFVK
Sbjct: 80  RLYDSSLAGKSVGSVILGDSDCDVLKFCWSQDSWTFGSKFSNVFDHEITSLMPRLVKFVK 139

Query: 132 DSRNINIIDYYPPNHSWRHVDKESQ-DTDKEIDFRNLLDVHIQHNPNEDNFTIILNGVYE 190
           DSR + ++    P      V + S+ D +K   F       + ++       + ++G ++
Sbjct: 140 DSRQLTML----PTDVGDGVPRWSKLDGNKSFIF-------LGYDSKRQKILMAIDGAFK 188

Query: 191 INGIVMPDISKSE-----------VYQLLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSN 239
           ++  V   ++  E           V  +LK  NGEY+    + + +KI F+  L+CN++ 
Sbjct: 189 LSFSVAALVAAGERLDEGDSVPNNVRDILKYDNGEYLVITDDWYIQKIKFD-FLNCNLTR 247

Query: 240 GLLSNILEIRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLT 299
            ++S    IR+L++ +++ + L+K EL+ PY+ F++++ + AY G +     +L  LL T
Sbjct: 248 EMISCCNRIRSLHKQLHESVSLVKTELVEPYTQFIERV-LGAYEGDLI---GDLTELLFT 303

Query: 300 GEINNEFKDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYL 359
           G +  E +DWL N IGD+N ++W+KL   M+E  VKI+ L ++P CER ++  ER  G +
Sbjct: 304 GSVPPELEDWLSNTIGDKNLRRWKKLSSVMYENAVKIMVLTMVPVCERLILCGERLHGII 363

Query: 360 NGY----MKTDTDFYDIISLREYF---SKLIRNSITIINSLNNQLKYFEIFSEWINDKIN 412
            G     +K   D  +++  ++      + + N I  I  +N      E F +W +D + 
Sbjct: 364 KGLKLIGLKELEDNLEVLEAQKLVCLSQEALENIIVSIKQINVDSNLHEAFIDWFHDMVM 423

Query: 413 EITDEDYKNR 422
           E  DEDYK +
Sbjct: 424 EAVDEDYKRK 433

>TBLA0C04570 Chr3 (1107010..1108836) [1827 bp, 608 aa] {ON}
           Anc_8.270 YDR118W
          Length = 608

 Score =  195 bits (496), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 110/347 (31%), Positives = 195/347 (56%), Gaps = 13/347 (3%)

Query: 13  KYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLTDGT 72
           K NP   L + +SD GL V R  D S + +  I++ + +  Y+W+N  G ++++F   GT
Sbjct: 11  KSNPTLPLTLCKSDSGLKVIRTADKSIIINYKIRNKNDIIYYQWENNIGNYVAIFFQRGT 70

Query: 73  IRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEFSIPSKLQLFDSNIIECLPTLIKFVKD 132
           + IYD  K  RL++ + +  + NVD+ +WDR  F   ++  +FDS+I   +PTLI+ ++D
Sbjct: 71  VMIYDGIKTSRLLAML-NGGKPNVDAGIWDRYYFPNDNEKDIFDSDITLYMPTLIQIIRD 129

Query: 133 SRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDNFTIILNGVYEIN 192
              I    Y+PP+ +WR   +ES   +        LD+H+ H+  +D+FT ILNG  E+ 
Sbjct: 130 KEKICPGTYFPPHSTWRAKKEESLKNE-------FLDIHLLHHSVDDSFTFILNG--ELK 180

Query: 193 GIVMPDISKSEVYQLLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNGLLSNILEIRNLN 252
                + +      ++K  N  ++ FY++   R I+ ++LL    +  L+ + + I +L 
Sbjct: 181 LPFPSNSTSGRAIGIIKGENNCFICFYQDLTVRMIDCHDLLQLKGNEILVDHFIRINHLL 240

Query: 253 RYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGEINNEFKDWLVN 312
           +Y+ +H+  IK  +  P+++F+  +  +A    M    + L ++L++G I+ E ++W+ N
Sbjct: 241 KYLKEHIMFIKDNMSTPFNEFLTSVKGEATQEMMM---ENLITMLVSGYISTELEEWIRN 297

Query: 313 IIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYL 359
            IG +N  +W  LG   +EK V I+TL +IP+CERFMI + R  G +
Sbjct: 298 TIGIKNLTRWATLGGIFYEKGVDIITLMVIPACERFMILVARLQGLI 344

>NDAI0J01270 Chr10 (297256..299463) [2208 bp, 735 aa] {ON} Anc_8.270
           YDR118W
          Length = 735

 Score =  194 bits (492), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 118/374 (31%), Positives = 210/374 (56%), Gaps = 27/374 (7%)

Query: 15  NPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLTDGTIR 74
           NP F LY+T++   +   R  D  Q+++I I++   V   +WD+ +G+++++   DGT R
Sbjct: 28  NPSFPLYLTKTSNSIIARRTLDGFQISNIIIRNMQNVIAIDWDSKTGKYLTINFDDGTFR 87

Query: 75  IYDIFKNGRLVSYIRSS-------SQKNVDSCLWDRAEFSIPSKLQLFDSNIIECLPTLI 127
           IYDIF++G+L++ +R          +  VD+ +WDR       +   F+ +I + +PTLI
Sbjct: 88  IYDIFQDGKLITLVRPQRNLLDIHRKTKVDNAIWDRLIILNSIQELEFNHDITKLMPTLI 147

Query: 128 KFVKDSRNINIIDY-----------YPPNHSWRHV----DKESQDTDKEID-FRNLLDVH 171
           KFVKDS NI I+ Y           + P  S++ +    D     T++E++     LD+H
Sbjct: 148 KFVKDSTNIYIVPYSHNEKQNIWREFQPVSSYKPISTNMDAIDMTTNQEVEKSMRYLDLH 207

Query: 172 IQHNPNEDNFTIILNGVYEINGI--VMPDISKSEVYQLLKLH-NGEYMSFYKNGHYRKIN 228
           I H  + D FTI +NG Y+IN +   +   +++++ ++LK   +G Y  F++NG  R + 
Sbjct: 208 IIHVIDPDCFTIAINGTYQINLVRKTINTTNRNKIVRILKSTVHGVYHCFHENGSIRSLY 267

Query: 229 FNNLLSCNVSNGLLSNILEIRNLNRYVNDHLDLIKRELIIPYSDFV-KKICIDAYAGGMT 287
           F++  S  +   LL   +EI  + +Y   HLDLI + L+  ++DF+   I  +   GG  
Sbjct: 268 FSHFTSSTLHVELLEIFMEINEMIKYFQYHLDLINKHLLKTFTDFLYPTIFEEKQNGGGN 327

Query: 288 KLNDELESLLLTGEINNEFKDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCER 347
            +  +L+  LL+GE++ E  +WL   IG++N KKW++L  +++ K ++I +LA+IP+CE 
Sbjct: 328 SMLQQLKLSLLSGEMSEELIEWLTLSIGEKNLKKWKRLSEELYSKSIQIFSLALIPACEL 387

Query: 348 FMIYLERTDGYLNG 361
            ++  ++    LN 
Sbjct: 388 TLLLSQKCLAILNA 401

>CAGL0B01859g Chr2 (168976..170844) [1869 bp, 622 aa] {ON} weakly
           similar to uniprot|Q04601 Saccharomyces cerevisiae
           YDR118w APC4 subunit of the anaphase promoting complex
          Length = 622

 Score =  186 bits (471), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 121/431 (28%), Positives = 225/431 (52%), Gaps = 43/431 (9%)

Query: 11  YSKYNPCFQLYVTRSD-QGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLT 69
           + KYNP + L+    D   L + R  D+  +  I +++   +  Y WD   G+++++FL 
Sbjct: 10  FLKYNPKYGLFGMNEDNHSLVIRRTSDNVGIVKINVRNIVLLLDYFWDPIDGKYLALFLK 69

Query: 70  DGTIRIYDIFKNGRLVSYIR------SSSQKNVDSCLWDRAEFSIP----SKLQLFDSNI 119
           DG++RIYDIF  G+L+S++R       S++ ++D CLWDR    IP    S+L++ ++++
Sbjct: 70  DGSVRIYDIFNGGKLISFLRVLPVVLGSNKPSLDCCLWDR--IIIPKSGSSELRIPNNDL 127

Query: 120 IECLPTLIKFVKDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNED 179
            E +PTL+KFV+D++ I+II        WR +             + ++DVH+ ++ +  
Sbjct: 128 TESMPTLVKFVQDAKQIDIIPNRSITKLWRSIGNNE---------KKVVDVHLGYSCSSA 178

Query: 180 NFTIILNGVYEINGIVMPDISKSEVYQLLKLHNGEYMSFYKNGHY-----RKINFNNLLS 234
             TI++NG Y I   V  DI++ +    + L+  E+       H+      +I+   +L 
Sbjct: 179 QVTILINGEYLIEKSV-SDINQIQKKIPISLNKKEFCEAIYEIHFDDYSRLQIDLTGILL 237

Query: 235 CNVSNGLLSNILEIRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELE 294
            +    L+   +++ N    + DH +LI++ ++ PY +F++ I      GG+  L D LE
Sbjct: 238 NDDKLDLIETQIKMTNHFDLIKDHFNLIEKSVLAPYYEFLESI------GGINDL-DVLE 290

Query: 295 SLLLTGEINNEFKDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLER 354
            L L GE++ +  +W    I ++N KKW +LG + +    ++L +  +P CER M+   R
Sbjct: 291 RLFLIGELDTKLGNWFKETINEKNLKKWSRLGNEFYSNFKQVLIIVFVPICERLMVLTNR 350

Query: 355 TDGYLNG---YMKTDTDFYDIISLREYFSKLIRNSITIINSLNNQLKYF-EIFSEWINDK 410
            +G + G       +T   DI  L+ + + +++    ++  LN    YF + F  W+ DK
Sbjct: 351 INGMIKGIDLQESQETSLLDISELQSFLNLVLK----LLAELNEDETYFKQDFLPWLTDK 406

Query: 411 INEITDEDYKN 421
           + E  + +YK+
Sbjct: 407 VYESINNEYKS 417

>Kwal_56.23766 s56 complement(695943..698165) [2223 bp, 740 aa] {ON}
           YDR118W (APC4) - subunit of the anaphase promoting
           complex (APC) [contig 173] FULL
          Length = 740

 Score =  172 bits (435), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 109/421 (25%), Positives = 208/421 (49%), Gaps = 33/421 (7%)

Query: 14  YNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLTDGTI 73
           +NP   LY+  +D+ +AV R+ D  Q+A + ++D   + G +W+    +  +VF ++G +
Sbjct: 21  WNPRLSLYLVLTDKKIAVNRVIDGQQIAAVNLRDEHEIVGIQWEKNESKLFAVFQSNGVV 80

Query: 74  RIYDIFKNGRLVSYIR-----SSSQKNVDSCLWDRAEFS-IPSKLQLFDSNIIECLPTLI 127
           RIYD    G L   +       +++  VD+ +W   E++  P   +  D +I   +P ++
Sbjct: 81  RIYDCSIGGSLREMVNLVEEGQAAEVKVDAVVWMTVEWAKFPESYRGLDFDITTLMPGMV 140

Query: 128 KFVKDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDNFTIILNG 187
           + V+DS+ +++        SW  +D +  D            + + H+     + + ++G
Sbjct: 141 RLVRDSKQLSLAPLDLGKLSW--LDGKYGDAA----------IFLAHDCESTEYMVAIDG 188

Query: 188 VYEINGIVMPDISKSEVYQLLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNGLLSNILE 247
              +     P   ++    L +  +G +++  K+G  + +     L C +   L+ +  +
Sbjct: 189 QLSLR---FPSGIRNVHKILPQGGSGSFLAVGKDGTLQWVTLK-FLECALMRELVKSSGQ 244

Query: 248 IRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGEINNEFK 307
           IR L RY+ +++ L   ELI PY  F+ ++ + AY G    L   L  +LLTG I ++ +
Sbjct: 245 IRFLCRYLAENVSLCHTELIEPYRVFLTRL-MGAYEGD--DLATRLRDILLTGYIPDDLE 301

Query: 308 DWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGY-----LNGY 362
           +WL N +GD+N K+W++L   M+  +  +LTLA++P+CER ++  ER  G      L  +
Sbjct: 302 EWLCNSVGDKNYKRWKQLSTRMYGDLNNVLTLAVVPACERLILAAERMQGIHKSLKLQRF 361

Query: 363 MKTDTDFYDIISLREYFSK---LIRNSITIINSLNNQLKYFEIFSEWINDKINEITDEDY 419
            K        + L+   S+   L+  ++ +I  LN      ++F+EW  D + E  DEDY
Sbjct: 362 CKDYAGELTTVELQTLISECQTLLEFTLNLITELNRDAALHQVFAEWFYDVVMETVDEDY 421

Query: 420 K 420
           K
Sbjct: 422 K 422

>KLTH0G13508g Chr7 complement(1159671..1161608) [1938 bp, 645 aa]
           {ON} some similarities with uniprot|Q04601 Saccharomyces
           cerevisiae YDR118W APC4 Subunit of the
           Anaphase-Promoting Complex/Cyclosome (APC/C)
          Length = 645

 Score =  158 bits (399), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 101/421 (23%), Positives = 203/421 (48%), Gaps = 33/421 (7%)

Query: 14  YNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIKDFDTVAGYEWDNYSGRFISVFLTDGTI 73
           +NP   LY+   D+ ++V R  D  ++A + ++    + G +W+   G+  ++F  +G +
Sbjct: 21  WNPRLSLYLVLGDKTVSVNRAIDGQRIAAVNLRGDGQLIGAQWELAEGKLFALFFGNGAV 80

Query: 74  RIYDIFKNGRLVSYI-----RSSSQKNVDSCLWDRAEFS-IPSKLQLFDSNIIECLPTLI 127
           RIYD    G L   +       S+   VD+ +W  A+++    + +  +  I + LP ++
Sbjct: 81  RIYDCATGGSLREVVDLVDEGQSADVTVDTAVWSGAQWAQFRQEYKGLNIEITKQLPGMV 140

Query: 128 KFVKDSRNINIIDYYPPNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDNFTIILNG 187
           + V+D++ ++++        W        D  K+        + + H+    ++ + ++G
Sbjct: 141 RLVRDAKQLSVVPLETGKLRWL------ADPGKDAA------IFLGHDEKSGDYLMTVDG 188

Query: 188 VYEINGIVMPDISKSEVYQLLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNGLLSNILE 247
           +  +    +P   K     L +  +G ++    +G  + +     L+  +   L+    +
Sbjct: 189 LLSVR---VPSGIKKMHKILRQGEDGTFVGVGADGTVQWVVLR-FLNSALMRELIRYSGQ 244

Query: 248 IRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGEINNEFK 307
           IR L  Y+ +++++ K +LI PY  F+ +I  DAY GG  +L      ++L+G I  + +
Sbjct: 245 IRFLCSYLTENINMCKTDLIEPYRQFLTRIA-DAYEGG--ELASRFRDIILSGYIPEDLE 301

Query: 308 DWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYLNGY----- 362
           DWL N IGD+N K+W++L   M+  +  +L LA+IP+CER ++  E+  G   G      
Sbjct: 302 DWLCNSIGDKNYKRWKQLSTRMYGDLNNVLALAVIPACERLILAAEQLQGIHKGLKLQEF 361

Query: 363 -MKTDTDF--YDIISLREYFSKLIRNSITIINSLNNQLKYFEIFSEWINDKINEITDEDY 419
            + +  +F   ++  L      L+  S+ ++  LN   +   IF++W  D + E  DEDY
Sbjct: 362 GLASPQEFESAEVTELITGCQALLHASLELVVDLNRDTRLHAIFADWFYDVVMETVDEDY 421

Query: 420 K 420
           K
Sbjct: 422 K 422

>Ecym_4300 Chr4 complement(642023..644170) [2148 bp, 715 aa] {ON}
           similar to Ashbya gossypii AGR078C
          Length = 715

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 28/119 (23%), Positives = 57/119 (47%), Gaps = 2/119 (1%)

Query: 241 LLSNILEIRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTG 300
           L+    +I+ L +Y+ D+  +I  +L+ P++ F+  +  D  A  + K   ++  L  + 
Sbjct: 250 LMKCCSQIQFLMKYLRDNHKIIGVKLMEPHATFINSLFPDEQASRLLKGLKDVFYLGYSA 309

Query: 301 EINNEFKDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYL 359
           E N E  +W    +G      W++     +     IL   +IP+CER ++ ++R  G +
Sbjct: 310 EKNIE--NWFTLKLGRHGISIWKQRNHLFWSSSQGILVTCMIPACERLIVAVKRLQGLI 366

>AGR078C Chr7 complement(877135..879282) [2148 bp, 715 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR118W
           (APC4)
          Length = 715

 Score = 37.4 bits (85), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 39/197 (19%), Positives = 85/197 (43%), Gaps = 23/197 (11%)

Query: 241 LLSNILEIRNLNRYVNDHLDLIKRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTG 300
           L+     I+ L +Y+ D+  LI  +L+ P++ F   +  +      TK    L+ +   G
Sbjct: 250 LMKCCSHIQFLLKYIRDNHRLIGTKLMEPHATFTGSLFPEEQ---FTKFMKGLKDVFYLG 306

Query: 301 EINNE-FKDWLVNIIGDRNGKKWRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGY- 358
             +++  ++W    +G      W++     +     +L   +IP+CER ++  +R  G  
Sbjct: 307 YSDDKTVENWFTLKLGRHGTAIWKQRNHLFWSSSQGVLVTCMIPACERLIVSAKRLLGLV 366

Query: 359 ----LNGYMKTDTDFYDIISLREYFSKLIRNSITIINSLNNQLKYFEI----------FS 404
               LN +   D +    + +++    L++ S+ ++  L  Q++ F +          + 
Sbjct: 367 KSLKLNVFGLDDDNELTAVEVQD----LLQMSLGLLKGLVEQVEQFHVGENVSKDGLAWI 422

Query: 405 EWINDKINEITDEDYKN 421
           E++ D +    DED  N
Sbjct: 423 EYMMDSLLHNEDEDAHN 439

>KLLA0F19316g Chr6 (1786659..1788674) [2016 bp, 671 aa] {ON}
           conserved hypothetical protein
          Length = 671

 Score = 36.6 bits (83), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 40/208 (19%), Positives = 86/208 (41%), Gaps = 11/208 (5%)

Query: 203 EVYQLLKLHNGEYMSFYKNGHYRKINFNNLLSCNVSNGLLSNILEIRNLNRYVNDHLDLI 262
           ++ +++K+ +G+YM   K+  Y+ ++   L   N+   L+    E   L RY+      +
Sbjct: 191 DIKRIIKVSSGKYMCLGKDWSYQVLDLTFLQDPNIYK-LIKTTQEYSALLRYLKQLHRHL 249

Query: 263 KRELIIPYSDFVKKICIDAYAGGMTKLNDELESLLLTGEINNEFKDWLVNI-IGDRNGKK 321
           + +L  PY +FV+ +  + +          L+ L   G    E  + L  + +      K
Sbjct: 250 RMKLTEPYFEFVETLLKEEHKNA-------LQELFYIGVTKLEVMEELHEVQLQTFRLDK 302

Query: 322 WRKLGMDMFEKIVKILTLAIIPSCERFMIYLERTDGYLNG--YMKTDTDFYDIISLREYF 379
           W  L  D+    + ++    IP  ER ++     +       ++K   + +    LRE  
Sbjct: 303 WSALSNDLCSNSIGLMVACTIPLLERMIVLAASIEALCEAITWIKFPNEIWVGSKLRERT 362

Query: 380 SKLIRNSITIINSLNNQLKYFEIFSEWI 407
            + +++  +  +S+    K  E+   WI
Sbjct: 363 VETLKSVRSQTDSIMKNKKTQELGLMWI 390

>Kpol_392.9 s392 (24389..26173) [1785 bp, 594 aa] {ON}
           (24389..26173) [1785 nt, 595 aa]
          Length = 594

 Score = 34.3 bits (77), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 27/87 (31%), Positives = 45/87 (51%), Gaps = 8/87 (9%)

Query: 224 YRKINFNNLLSCN---VSNGLLSNILE--IRNLNRYVNDHLDLIKRELIIPYSDFVKKIC 278
           + KI+ + L S N   +   + S  LE  IR++  YV    ++  +EL +P +  V    
Sbjct: 208 FTKIDLDELSSDNFSAIGGSIHSEQLENNIRSVGEYVGHLSEISAKELGLPTTCIVGSGI 267

Query: 279 IDAYAGGMTKLNDELESLLLTGEINNE 305
           IDAYAG +  +  ++E +   G INN+
Sbjct: 268 IDAYAGWVGTVAAKVEEI---GTINND 291

>NCAS0I00890 Chr9 complement(163457..164524) [1068 bp, 355 aa] {ON}
           Anc_3.389 YBR128C
          Length = 355

 Score = 32.7 bits (73), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 26/81 (32%), Positives = 45/81 (55%), Gaps = 6/81 (7%)

Query: 331 EKIVKILTLAIIPSCERFMIYLERTDGYLNGYMKTDTDFYDIISLREYFSKLIRNSITII 390
           +KIV++     + S  ++ +  +R D YL  +      F  IISL+   +  +  S+TI 
Sbjct: 147 QKIVQMAQQEKLHSLRKWFMVRQRKDLYLVSF---SILFQPIISLQNVPN--LPRSVTI- 200

Query: 391 NSLNNQLKYFEIFSEWINDKI 411
           +SLNN  +Y +IF++ IN K+
Sbjct: 201 SSLNNMFQYLDIFAQIINFKL 221

>Kwal_55.21786 s55 (979567..980550) [984 bp, 327 aa] {ON} YOR075W
           (UFE1) - endoplasmic reticulum t-SNARE, coprecipitates
           with Sec20p, Tip1p. and Sec22p [contig 126] FULL
          Length = 327

 Score = 32.0 bits (71), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 51/212 (24%), Positives = 91/212 (42%), Gaps = 21/212 (9%)

Query: 95  NVDSCLWDRAEFSIPSKLQLFDSNIIECLPTLIKFVKDSRN--INIIDYYPPNHSWRHVD 152
           N+D     +A+   P+K  + D+ I ECL  L+K +++ +   I+I + Y         +
Sbjct: 20  NIDPETTGKAQPKAPNKYLINDTFIKECLD-LLKGIRELQRVVISIEEQYKAEGELSERE 78

Query: 153 KESQDTDKEIDFRNLLDVHIQHNPNEDNFTIILNGVYEINGIVMPDISKSEVYQLLKLHN 212
           K+  DT+  +  +   D        E+    I+N  Y  NG        SE+  L +LH+
Sbjct: 79  KDDFDTEVRLIIQQYFDKLRFLGDYENKRQQIINSRYTGNG-------SSEIMSLFRLHD 131

Query: 213 GEYMSFY--KNGHYRKI--NFNNLLSCNVSNGLLSNILEIRNLNRYVNDHLDLIKRELII 268
            E   F+   N H   I  + N LLS   S   +SN+ + R L +   + +D    +L  
Sbjct: 132 EELEQFHLINNKHREGILQSLNMLLSSVFSK--ISNMQQERLLRQRELESIDF-NAQLYA 188

Query: 269 PYSDFVKKI----CIDAYAGGMTKLNDELESL 296
           P  + +  +     I+     + + N+ +E L
Sbjct: 189 PIHNMISSVSQSPAIETTEQEIAQYNEAVEKL 220

>Suva_4.398 Chr4 (709192..710226) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score = 32.0 bits (71), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 33/150 (22%), Positives = 57/150 (38%), Gaps = 31/150 (20%)

Query: 2   VIDSGIRLYYSKYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIK----DFDTVAGYEWD 57
            +++G+R+      P   L      + LA     ++ Q     IK      DT   YE +
Sbjct: 26  TLNNGVRV------PALGLGTANPHEKLA-----ETKQAVKAAIKAGYRHIDTAWAYETE 74

Query: 58  NYSGRFISVFLTDGTIRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEFSIPSKLQLFDS 117
            + G  I   L +G+I+  D+F   +            V   LWD  E S+   L+    
Sbjct: 75  PFVGEAIKELLEEGSIKREDLFITTK------------VWPVLWDEVERSLSESLKAMGL 122

Query: 118 NIIECL----PTLIKFVKDSRNINIIDYYP 143
           + ++      P   + VKD + I+ +   P
Sbjct: 123 DYVDLFLQHWPLCFEKVKDPKGISGLVKTP 152

>YBR149W Chr2 (539987..541021) [1035 bp, 344 aa] {ON}  ARA1NADP+
           dependent arabinose dehydrogenase, involved in
           carbohydrate metabolism; purified as homodimer;
           naturally occurs with a N-terminus degradation product
          Length = 344

 Score = 32.0 bits (71), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 32/143 (22%), Positives = 55/143 (38%), Gaps = 31/143 (21%)

Query: 3   IDSGIRLYYSKYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIK----DFDTVAGYEWDN 58
           +++G+R+      P   L      + LA     ++ Q     IK      DT   YE + 
Sbjct: 27  LNNGVRI------PALGLGTANPHEKLA-----ETKQAVKAAIKAGYRHIDTAWAYETEP 75

Query: 59  YSGRFISVFLTDGTIRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEFSIPSKLQLFDSN 118
           + G  I   L DG+I+  D+F   +            V   LWD  + S+   L+     
Sbjct: 76  FVGEAIKELLEDGSIKREDLFITTK------------VWPVLWDEVDRSLNESLKALGLE 123

Query: 119 IIECL----PTLIKFVKDSRNIN 137
            ++ L    P   + +KD + I+
Sbjct: 124 YVDLLLQHWPLCFEKIKDPKGIS 146

>Smik_2.289 Chr2 (526189..527223) [1035 bp, 344 aa] {ON} YBR149W
           (REAL)
          Length = 344

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 35/157 (22%), Positives = 61/157 (38%), Gaps = 31/157 (19%)

Query: 3   IDSGIRLYYSKYNPCFQLYVTRSDQGLAVYRIKDSSQLAHIFIK----DFDTVAGYEWDN 58
           +++G+R+      P   L      + LA     ++ Q     IK      DT   Y  + 
Sbjct: 27  LNNGVRI------PALGLGTANPQEKLA-----ETKQAVKAAIKAGYRHIDTAWAYRTEP 75

Query: 59  YSGRFISVFLTDGTIRIYDIFKNGRLVSYIRSSSQKNVDSCLWDRAEFSIPSKLQLFDSN 118
           + G  I   L +GTI+  D+F   +            V   LWD  + S+   L+    +
Sbjct: 76  FVGEAIKELLEEGTIQREDLFITTK------------VWPVLWDEVDRSLNESLKALGLD 123

Query: 119 IIECL----PTLIKFVKDSRNINIIDYYPPNHSWRHV 151
            ++ L    P   + VKD + I+ +   P + S + V
Sbjct: 124 YVDLLLQHWPLCFEKVKDPKGISGLVKTPVDDSGKTV 160

>NCAS0J01330 Chr10 complement(228730..229818) [1089 bp, 362 aa] {ON}
           Anc_4.227 YLR377C
          Length = 362

 Score = 30.4 bits (67), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 28/108 (25%), Positives = 45/108 (41%), Gaps = 9/108 (8%)

Query: 144 PNHSWRHVDKESQDTDKEIDFRNLLDVHIQHNPNEDNFTIILNGVYEINGIVMPDISKSE 203
           P+   R    E+ +TD     R +L+   Q      N T++LN +      +   I K+E
Sbjct: 13  PSTEQRRNSSEAINTDIVTLPRFILESQQQFKQARGNLTLLLNALQFAFKFISQTIRKAE 72

Query: 204 VYQLLKLHNGEYMSFYKNGHYRK--------INFNNLLSCNVSNGLLS 243
           +  L+ LHN   ++    G  +K        I  N + SC V   L+S
Sbjct: 73  LVNLINLHNSS-ITINATGDVQKKLDIISDEIFLNAMKSCGVVKILVS 119

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.141    0.421 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,086,467
Number of extensions: 2608133
Number of successful extensions: 9084
Number of sequences better than 10.0: 53
Number of HSP's gapped: 9309
Number of HSP's successfully gapped: 53
Length of query: 424
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 312
Effective length of database: 40,638,807
Effective search space: 12679307784
Effective search space used: 12679307784
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 67 (30.4 bits)