Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_363.145.524ON76143018730.0
YDR420W (HKR1)5.524ON18022333434e-32
Skud_4.6945.524ON15042263416e-32
Smik_4.6955.524ON15552393344e-31
Suva_2.5975.524ON17972283301e-30
SAKL0G04862g5.524ON24442523274e-30
TPHA0L003605.524ON11612953013e-27
TDEL0A038805.524ON16962772971e-26
KLTH0G03696g5.524ON20852592917e-26
KNAG0C032605.524ON15302442863e-25
ZYRO0D12496g5.524ON23852682765e-24
Kwal_47.186505.524ON21592632731e-23
Ecym_40605.524ON22012512552e-21
KAFR0E033205.524ON11902542532e-21
CAGL0F03003g5.524ON11852562452e-20
KLLA0A01826g5.524ON14642242416e-20
ADR200C5.524ON23382282372e-19
KLTH0E08844g4.150ON1520881942e-14
SAKL0H23188g4.150ON12621031834e-13
Kwal_47.177034.150ON1568891701e-11
AGR019C4.150ON1105921692e-11
TDEL0D030104.150ON11231431682e-11
KLLA0C17985g4.150ON9081021673e-11
NDAI0K025804.150ON985931575e-10
Kpol_1062.374.150ON973961575e-10
ZYRO0G11242g4.150ON14871081551e-09
YGR014W (MSB2)4.150ON13061021541e-09
KAFR0F034704.150ON949961477e-09
CAGL0F08833g4.150ON936881478e-09
Skud_7.2994.150ON11691031478e-09
TPHA0K013904.150ON8262311451e-08
TBLA0G012104.150ON1825931442e-08
NCAS0A052304.150ON7851011389e-08
Suva_7.2964.150ON11351011381e-07
Smik_7.3024.150ON11891141381e-07
TBLA0G009505.524ON22532861362e-07
Ecym_73494.150ON11291071362e-07
KNAG0D035904.150ON9941111316e-07
ACR165W2.662ON113964743.7
Suva_2.2103.299ON71294725.7
TPHA0M012603.299ON711112717.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_363.14
         (761 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {...   726   0.0  
YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Muc...   136   4e-32
Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR42...   135   6e-32
Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR42...   133   4e-31
Suva_2.597 Chr2 (1058501..1059391,1059470..1059725,1059765..1059...   131   1e-30
SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some ...   130   4e-30
TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {O...   120   3e-27
TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5....   119   1e-26
KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some ...   116   7e-26
KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {...   114   3e-25
ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} som...   110   5e-24
Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] ...   109   1e-23
Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar ...   102   2e-21
KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {...   102   2e-21
CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some ...    99   2e-20
KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa] ...    97   6e-20
ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON...    96   2e-19
KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some ...    79   2e-14
SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} som...    75   4e-13
Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR04...    70   1e-11
AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON} ...    70   2e-11
TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {...    69   2e-11
KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa]...    69   3e-11
NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {...    65   5e-10
Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {O...    65   5e-10
ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakl...    64   1e-09
YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin...    64   1e-09
KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.1...    61   7e-09
CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly...    61   8e-09
Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W...    61   8e-09
TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {...    60   1e-08
TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4....    60   2e-08
NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON} Anc_4...    58   9e-08
Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W...    58   1e-07
Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W...    58   1e-07
TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {...    57   2e-07
Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON...    57   2e-07
KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.1...    55   6e-07
ACR165W Chr3 (644229..647648) [3420 bp, 1139 aa] {ON} Syntenic h...    33   3.7  
Suva_2.210 Chr2 complement(358205..360343) [2139 bp, 712 aa] {ON...    32   5.7  
TPHA0M01260 Chr13 complement(258932..261067) [2136 bp, 711 aa] {...    32   7.2  

>Kpol_363.14 s363 (25673..27781,27783..27959) [2286 bp, 761 aa] {ON}
           (25673..27781,27783..27959) [2286 nt, 762 aa]
          Length = 761

 Score =  726 bits (1873), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/430 (86%), Positives = 371/430 (86%)

Query: 332 NPETKSTSTSGTNXXXXXXXXXXXXXXXXXXXXXXXXXXXXXVDSVLTRTYSSKYIXXXX 391
           NPETKSTSTSGTN                             VDSVLTRTYSSKYI    
Sbjct: 332 NPETKSTSTSGTNKVTSESTSKLKSKSVTSSIGTTSETTSKSVDSVLTRTYSSKYIESST 391

Query: 392 XXXXXXXXXXXXYISLGDAVSSGVTKTYTSARSETFSSNGAMSNPIETNSKKVSNYDEED 451
                       YISLGDAVSSGVTKTYTSARSETFSSNGAMSNPIETNSKKVSNYDEED
Sbjct: 392 LTKLKSSESKTKYISLGDAVSSGVTKTYTSARSETFSSNGAMSNPIETNSKKVSNYDEED 451

Query: 452 XXXXXXXXXXXXXXVTLSSNFESLRHTTTLSNLISEAGRLTSTALAVPTTSTAVAVPLSS 511
                         VTLSSNFESLRHTTTLSNLISEAGRLTSTALAVPTTSTAVAVPLSS
Sbjct: 452 TTSTIYTIYPSSSYVTLSSNFESLRHTTTLSNLISEAGRLTSTALAVPTTSTAVAVPLSS 511

Query: 512 EQTRDSFAWLPTNIVVQSSNTDMTNSPETNTNTSGLPVRIAPTAVTQPADSILISIGFKI 571
           EQTRDSFAWLPTNIVVQSSNTDMTNSPETNTNTSGLPVRIAPTAVTQPADSILISIGFKI
Sbjct: 512 EQTRDSFAWLPTNIVVQSSNTDMTNSPETNTNTSGLPVRIAPTAVTQPADSILISIGFKI 571

Query: 572 ELNYPFLIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDTSVISTEYQDYSS 631
           ELNYPFLIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDTSVISTEYQDYSS
Sbjct: 572 ELNYPFLIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDTSVISTEYQDYSS 631

Query: 632 IFSYETTLSNLGLTLYDLSDGETSVLEASPTVASMNKYQRDTSSISVKQIIPILIPGNLY 691
           IFSYETTLSNLGLTLYDLSDGETSVLEASPTVASMNKYQRDTSSISVKQIIPILIPGNLY
Sbjct: 632 IFSYETTLSNLGLTLYDLSDGETSVLEASPTVASMNKYQRDTSSISVKQIIPILIPGNLY 691

Query: 692 ITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALIDSTIPIFSTIDPDGNLY 751
           ITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALIDSTIPIFSTIDPDGNLY
Sbjct: 692 ITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALIDSTIPIFSTIDPDGNLY 751

Query: 752 LVDFLHRKFK 761
           LVDFLHRKFK
Sbjct: 752 LVDFLHRKFK 761

 Score =  397 bits (1020), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 208/242 (85%), Positives = 208/242 (85%)

Query: 1   MANVLLLIQFLVVFSFIKRSKCYDDFNTTPVNSYATDAVDEADFQSVPAISTYDFQGISA 60
           MANVLLLIQFLVVFSFIKRSKCYDDFNTTPVNSYATDAVDEADFQSVPAISTYDFQGISA
Sbjct: 1   MANVLLLIQFLVVFSFIKRSKCYDDFNTTPVNSYATDAVDEADFQSVPAISTYDFQGISA 60

Query: 61  ISTYDFQGVSAISTYDYSDEGISGIITTSNEEPIYTIYTNTTDETVESAFVXXXXXXXXX 120
           ISTYDFQGVSAISTYDYSDEGISGIITTSNEEPIYTIYTNTTDETVESAFV         
Sbjct: 61  ISTYDFQGVSAISTYDYSDEGISGIITTSNEEPIYTIYTNTTDETVESAFVSIIISAADY 120

Query: 121 XXXPVISSELSFIDPDVNGVSSSYNILTNDEANSSNDFWIDTYSSNDENVDRTISDNIFS 180
              PVISSELSFIDPDVNGVSSSYNILTNDEANSSNDFWIDTYSSNDENVDRTISDNIFS
Sbjct: 121 SSYPVISSELSFIDPDVNGVSSSYNILTNDEANSSNDFWIDTYSSNDENVDRTISDNIFS 180

Query: 181 SISTVEAESSTRDLVXXXXXXXXXXXXXXXXXXXXXXKTNEKPSSSTSTVYLITNTPSSS 240
           SISTVEAESSTRDLV                      KTNEKPSSSTSTVYLITNTPSSS
Sbjct: 181 SISTVEAESSTRDLVSKLTTTSSSSTSSTPTTVDTESKTNEKPSSSTSTVYLITNTPSSS 240

Query: 241 SL 242
           SL
Sbjct: 241 SL 242

>YDR420W Chr4 (1306267..1311675) [5409 bp, 1802 aa] {ON}  HKR1Mucin
            family member that functions as an osmosensor in the
            Sho1p-mediated HOG pathway with Msb2p; proposed to be a
            negative regulator of filamentous growth; mutant displays
            defects in beta-1,3 glucan synthesis and bud site
            selection
          Length = 1802

 Score =  136 bits (343), Expect = 4e-32,   Method: Compositional matrix adjust.
 Identities = 92/233 (39%), Positives = 126/233 (54%), Gaps = 22/233 (9%)

Query: 516  DSFAWLPTNIVVQSSNTDMTNSPETNTNTSGLPVRIAPT-AVTQPADSILISIGFKIELN 574
            +S+AWLPT I+V+SS T  T +    + T  LP  I P  AV++P +  LI+IGF   LN
Sbjct: 1206 NSYAWLPTAIIVESSETGPTTASFNPSITGSLPNAIEPAVAVSEPINHTLITIGFTAALN 1265

Query: 575  YPFLIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDTSVISTEYQDYSSIFS 634
            Y FL++   +SAQIFNFLPL+L YPF   SS  +LD SI           E   +  I S
Sbjct: 1266 YVFLVQNPLSSAQIFNFLPLVLKYPFSNTSS--ELDNSIG----------ELSTF--ILS 1311

Query: 635  YETTLSNLGLTLYDLSD-------GETSVLEASPTVASMNKYQRDTSSISVKQIIPILIP 687
            Y +  S   L+   +S               A+ +   ++  Q DTSSI+VK+I+P++  
Sbjct: 1312 YRSGSSTTTLSPKSISSLSVVKKKKNQQKKNATKSTEDLHPPQVDTSSIAVKKIVPMVDS 1371

Query: 688  GNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALIDSTIPI 740
               YI S+AE  FP E V  LQ  I +  S +Y NP   L+ +A LIDS IP+
Sbjct: 1372 SKAYIVSVAEVYFPTEAVTYLQQLILDENSTLYSNPQTPLRSLAGLIDSGIPL 1424

>Skud_4.694 Chr4 (1228095..1232609) [4515 bp, 1504 aa] {ON} YDR420W
            (REAL)
          Length = 1504

 Score =  135 bits (341), Expect = 6e-32,   Method: Compositional matrix adjust.
 Identities = 89/226 (39%), Positives = 131/226 (57%), Gaps = 12/226 (5%)

Query: 518  FAWLPTNIVVQSSNTDMTNSPETNTNTSGLPVRIAPT-AVTQPADSILISIGFKIELNYP 576
            +AWLPT I+V+ S T  + +P   + T  LP  I P  AV++PA+  LI++GF   LNY 
Sbjct: 916  YAWLPTTIIVEPSQTGSSTAPFNPSITGSLPSLIEPAVAVSEPANHTLITVGFTAGLNYE 975

Query: 577  FLIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDTSVISTEYQDYSSIFSYE 636
            FL++   +SAQIFNFLPL+L YPF    SN +L+    +QS T  +S+    Y S  S  
Sbjct: 976  FLVQNPLSSAQIFNFLPLVLGYPF----SNTRLE----VQSSTQGLSSFVLSYQSGTS-T 1026

Query: 637  TTLSNLGLTLYDLSDGETSVLEASPTVASMNKY--QRDTSSISVKQIIPILIPGNLYITS 694
            TTLS   ++   +   +    + + T ++ + Y    +TSSI VKQI+P++     Y+ +
Sbjct: 1027 TTLSPKSVSSLSIVKKKKKGEKRNATASTADLYLPSIETSSIVVKQIVPMVNSSKAYVIA 1086

Query: 695  LAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALIDSTIPI 740
            +AE  FP E +  LQ  I + +S IY NP   L+ +A LIDS IP+
Sbjct: 1087 VAEVYFPTEAISYLQKLILDASSPIYNNPQTPLRTLAGLIDSRIPL 1132

>Smik_4.695 Chr4 (1227757..1232424) [4668 bp, 1555 aa] {ON} YDR420W
            (REAL)
          Length = 1555

 Score =  133 bits (334), Expect = 4e-31,   Method: Compositional matrix adjust.
 Identities = 94/239 (39%), Positives = 134/239 (56%), Gaps = 15/239 (6%)

Query: 516  DSFAWLPTNIVVQSSNTDMTNSPETNTNTSGLPVRIAPTAVT--QPADSILISIGFKIEL 573
            +S+AWLPT I+VQSS TD + +    T T  LP  I P AVT  +P +  LI++GF   L
Sbjct: 964  NSYAWLPTAIIVQSSETDTSTTLFNPTITGSLPNLIEP-AVTASEPINHTLITVGFTAAL 1022

Query: 574  NYPFLIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDTSVISTEYQDYSSIF 633
            NY FL++   +SAQIFNFLPL+L YPF   SS         ++S    +S+    Y S  
Sbjct: 1023 NYVFLVQNPLSSAQIFNFLPLVLKYPFSDTSSG--------VESSNGELSSFILSYRSGT 1074

Query: 634  SYETTLSNLGLTLYDLSDGETSVLEASPTVASMNKY--QRDTSSISVKQIIPILIPGNLY 691
            S  TTLS    +   +   +    +  P  ++M+ Y    + SSI+VKQI+P++     Y
Sbjct: 1075 S-TTTLSPQSKSSLSIVRKKKKGDKEKPPTSTMDLYFPSINASSIAVKQIVPMMDSSKAY 1133

Query: 692  ITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALIDSTIPIFS-TIDPDGN 749
            I ++AE  FP E V  LQ  I ++ S +Y NP   L+ +A LID++IP+ S T+   GN
Sbjct: 1134 IIAVAEVYFPTEAVSYLQELILDVNSTLYNNPQSPLRTLAGLIDNSIPLGSLTLYSSGN 1192

>Suva_2.597 Chr2
            (1058501..1059391,1059470..1059725,1059765..1059812,
            1059849..1059854,1059891..1061045,1061361..1064398) [5394
            bp, 1797 aa] {ON} YDR420W (REAL)
          Length = 1797

 Score =  131 bits (330), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 83/228 (36%), Positives = 131/228 (57%), Gaps = 5/228 (2%)

Query: 514  TRDSFAWLPTNIVVQSSNTDMTNSPETNTNTSGLPVRIAPT-AVTQPADSILISIGFKIE 572
            T + +AWLPT I+V+ + +D + +    + T+ LP  IAP  AVT+PA+  LI+IGF   
Sbjct: 1199 TSNDYAWLPTAIIVEPTKSDTSTTSFNPSITASLPNVIAPAIAVTEPANHTLITIGFTAG 1258

Query: 573  LNYPFLIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDTSVISTEYQDYSSI 632
            LNY FL++   +SAQIFNFLPL+L YPF   +S  +   +  + S + V+S +    ++ 
Sbjct: 1259 LNYVFLVQNPLSSAQIFNFLPLVLKYPFSDTTSQQEESSTYEMGSSSFVLSYQSGSSTTT 1318

Query: 633  FSYETTLSNLGLTLYDLSDGETSVLEASPTVASMNKYQRDTSSISVKQIIPILIPGNLYI 692
             S E+  S   +       G+ SV+    + A+++      SSI VKQI+P++     Y+
Sbjct: 1319 LSPESVSSIPIVRKKKKKGGKNSVM----STANLDLPSIGNSSIVVKQIVPMIDSSRSYV 1374

Query: 693  TSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALIDSTIPI 740
             ++AE  FP E +  LQ  I +  S +Y NP   L+ +A LIDS++P+
Sbjct: 1375 IAVAEVYFPTEAISSLQELILDTNSTLYNNPQTSLQTLAGLIDSSVPL 1422

>SAKL0G04862g Chr7 (392107..399441) [7335 bp, 2444 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2444

 Score =  130 bits (327), Expect = 4e-30,   Method: Compositional matrix adjust.
 Identities = 94/252 (37%), Positives = 133/252 (52%), Gaps = 24/252 (9%)

Query: 520  WLPTNIVVQSSNTDMTNSPETNTN-TSGLPVRIAP-TAVTQPADSILISIGFKIELNYPF 577
            WLP +++V+S +T   +S   +   TS LP  I P TAV QPA   LI+IGFK  LNYPF
Sbjct: 1474 WLPYSLIVESKDTSTQSSTTVDLGATSTLPQAITPPTAVPQPAGHSLITIGFKEALNYPF 1533

Query: 578  LIKESYASAQIFNFLPLILTYPFEQDSSN----YQLDPSI---------SLQSDTSVIST 624
            LI    +SAQIF+FLP +L YPF   + +     + D  +         S  ++    S 
Sbjct: 1534 LISHPLSSAQIFSFLPRVLQYPFSSTAGSVPIYRRQDIEVMTLLQRRLTSSAAEIDTCSL 1593

Query: 625  EYQDYSSIFSYETTLSNLGLTLYDLSDGETSVLE---ASPTVASMNKYQR----DTSSIS 677
             +Q+Y  I      L+ L  T  + +D E + L     +  V+ MN        D S I 
Sbjct: 1594 SFQNYDKIQLVSVKLALLKST--NRTDQENNSLHRRSVNDKVSVMNSTSDSSNIDYSQIV 1651

Query: 678  VKQIIPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALIDST 737
            VKQIIP++     YI S+AE  FP   +D LQ  + N  S +Y+NP+  LK +A+LID +
Sbjct: 1652 VKQIIPLVSSSINYIVSVAEVYFPDHSIDTLQRLVRNQNSELYKNPENSLKALASLIDPS 1711

Query: 738  IPIFSTIDPDGN 749
            +P+   +D DGN
Sbjct: 1712 VPLTGLVDSDGN 1723

>TPHA0L00360 Chr12 complement(50396..53881) [3486 bp, 1161 aa] {ON} 
          Length = 1161

 Score =  120 bits (301), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 97/295 (32%), Positives = 147/295 (49%), Gaps = 50/295 (16%)

Query: 498 VPTTSTAVAV-PLSSEQTRD-----SFAWLPTNIVVQSSNTDMTNSPETNTNTSGLP-VR 550
           +P  +TA+   P++  Q  +     SF WLP+ I +QS +T  +  P    +TSGLP + 
Sbjct: 488 IPNDATAIITKPITDSQASEVYLTRSFDWLPSEIAIQSDSTAESMEPSFLIDTSGLPNII 547

Query: 551 IAPTAVTQPADSILISIGFKIELNYPFLIKESYASAQIFNFLPLILTYPFEQDSSNYQLD 610
            APTA+T P+++ LI++ FK ELNY FL+   Y+SAQIFNFLP+I+ +PF    S    D
Sbjct: 548 TAPTAITIPSNTTLITVAFKRELNYAFLVNNFYSSAQIFNFLPIIIKHPFTALVSESCND 607

Query: 611 PSISLQSDTSVISTEY--------------------QDYSSIFSYETTLSNLGLTLYDL- 649
            S+      S + TEY                     D+ S   +     N+ L+L+   
Sbjct: 608 DSV-----CSPLFTEYILNSYASSAASSMSTSSVNNVDFQSGGKHSV---NINLSLHSTI 659

Query: 650 -------SDGETSVLEASPTVASMN-------KYQRDTSSISVKQIIPILIPGNLYITSL 695
                  +  +T++    P++A  +       + Q  +  I+V +IIP ++  N YI S+
Sbjct: 660 VQTAISPTGFQTNMTSQIPSLAKKDLSKNASLQKQEISMDITVARIIPYIVQNNKYIISI 719

Query: 696 AEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALIDSTIPIFSTIDPDGNL 750
           AE   P E V+ LQ  I N  S  Y +    LK +A LID  IP+   +D +GNL
Sbjct: 720 AEVYVPNEIVETLQELILNPASSFYNSESSSLKTLAFLIDPNIPLTGMLDSNGNL 774

>TDEL0A03880 Chr1 (690387..695477) [5091 bp, 1696 aa] {ON} Anc_5.524
            YDR420W
          Length = 1696

 Score =  119 bits (297), Expect = 1e-26,   Method: Compositional matrix adjust.
 Identities = 98/277 (35%), Positives = 140/277 (50%), Gaps = 33/277 (11%)

Query: 474  SLRHTTTLSNLISEAGRLTSTALAVPTTSTAVAVPLSSEQTRDSFAWLPTNIVVQSSNTD 533
            SLR T T     S    LT+      TT+       SS   R +F WLP++I VQS  T 
Sbjct: 1028 SLRMTLTTRPAQSTGSLLTTGQ----TTAANTGARSSSVGGRTTF-WLPSSIQVQSDPTR 1082

Query: 534  MTNSPETNTNTSGLPVRIAP-TAVTQPADSILISIGFKIELNYPFLIKESYASAQIFNFL 592
               S      T+ LP  IAP TAV  P ++  I++GFK  LNY FL+  S  +AQIF+FL
Sbjct: 1083 SGTSSFDPAVTATLPQLIAPPTAVPVPENASKITVGFKKNLNYEFLVSSSTTAAQIFHFL 1142

Query: 593  PLILTYPFEQDSSNYQLDPSISLQSDTSVISTEYQDYSSI----FSYETTLSNLGLTLYD 648
            P +L++PFE+   N   D S   +    V S E+ + +++    F  ET        +  
Sbjct: 1143 PFVLSFPFEE---NGTKDFSYKRRGTLLVSSFEFNNTTTLMPAQFHQETVTG-----ISK 1194

Query: 649  LSDGETSVLEASPTVASMNKYQRDTSSISVKQIIPILIPGNLYITSLAEGLFPGEKVDEL 708
             SD E               +  + S++ V QI+P++I    Y+TS+A   FP   V EL
Sbjct: 1195 RSDSE---------------FPFNASAVDVIQIMPMIIKDRNYLTSIAVLYFPSAYVSEL 1239

Query: 709  QNYINNLTSIIYQNPDPRLKDMAALIDSTIPIFSTID 745
            Q+ +++ TS ++ NPDP L  +AALID +IP+   ID
Sbjct: 1240 QSMVSDDTSQLFNNPDPTLDALAALIDPSIPLTGLID 1276

>KLTH0G03696g Chr7 (286341..292598) [6258 bp, 2085 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2085

 Score =  116 bits (291), Expect = 7e-26,   Method: Compositional matrix adjust.
 Identities = 95/259 (36%), Positives = 133/259 (51%), Gaps = 29/259 (11%)

Query: 498  VPTTSTAVAVPLSSEQTRDSFAWLPTNIVVQSSNTDMTNSPETNTN-----TSGLPVRIA 552
             P+ +T +A   ++ +   S  WLP+NIV  S     T S  T ++     T+ LP  I 
Sbjct: 1206 TPSLATVLAPSSTNSEGSTSMDWLPSNIVTAS----YTGSAHTQSSFDADATATLPQAIM 1261

Query: 553  PTAVTQPADSI-LISIGFKIELNYPFLIKESYASAQIFNFLPLILTYPFEQDSSNYQLDP 611
            P        +   I+IGFK  LNYPFLI+   ASAQIF FLP IL YPF        +  
Sbjct: 1262 PPTPVTMPPNYSQITIGFKESLNYPFLIENPLASAQIFGFLPEILRYPFS-------VRA 1314

Query: 612  SISLQSDTSVISTEYQDYSSIFSYETTLSNLGLTLYDLSDGETSVLEASPTV------AS 665
            S S  S +SV      D  ++    +TL      + D  + +TS++ +  +        S
Sbjct: 1315 SRSNSSTSSVKRDLVGDSGNLLLDNSTL------ILDKLNWKTSIMNSLSSNVSVSRNGS 1368

Query: 666  MNKYQRDTSSISVKQIIPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDP 725
             N ++ + S ++V  I+P+++ GN YITS+A   FP E V+ LQ  I N  S IY+NPD 
Sbjct: 1369 HNAFRANFSGVAVSSIVPLIVSGNDYITSVAVVYFPTEAVEVLQKMIINGASRIYKNPDQ 1428

Query: 726  RLKDMAALIDSTIPIFSTI 744
             L+DMA LIDS IPI   I
Sbjct: 1429 SLRDMALLIDSKIPITGII 1447

>KNAG0C03260 Chr3 complement(639021..643613) [4593 bp, 1530 aa] {ON}
            Anc_5.524 YDR420W
          Length = 1530

 Score =  114 bits (286), Expect = 3e-25,   Method: Compositional matrix adjust.
 Identities = 83/244 (34%), Positives = 127/244 (52%), Gaps = 8/244 (3%)

Query: 506  AVPLSSEQTRDSFAWLPTNIVVQSSNTDMTNSPETNTNTSGLPVRIAPTAVTQ-PADSIL 564
            A P S   + D+  WLPTNI++ +SN D T++    + T+ LP  IAP    Q P D  L
Sbjct: 875  ASPTSGSDSTDTV-WLPTNIII-ASNADSTHTARAES-TASLPAAIAPAEELQSPPDFEL 931

Query: 565  ISIGFKIELNYPFLIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDTSVIST 624
            I+IGF   LNY FL+    +SAQ+F+FLP +L +P E  +   +     S    T++++ 
Sbjct: 932  ITIGFLSGLNYAFLVGNPLSSAQVFDFLPHVLFFPIEDAAEKSKAIQPQSSDITTTLVAP 991

Query: 625  EYQDYSSIFSYETTLSNLGLTLYDLSDGETSVLEASPTVASMNKYQRDTSSISVKQIIPI 684
              ++  ++    T ++   +   + +   +  L  S      N  +    +I VKQIIP+
Sbjct: 992  LRKNRKTV----TDMTRANVVNQNEATSSSLNLAVSSEATGSNDVELIFKNIRVKQIIPL 1047

Query: 685  LIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALIDSTIPIFSTI 744
            +I GN YITS+AE  FP   +D L   I++  S +Y NP      +A+LID  IP+ S  
Sbjct: 1048 VIEGNDYITSVAEVYFPTIYIDSLSALISDPNSTLYSNPKKNFATLASLIDKAIPLTSLR 1107

Query: 745  DPDG 748
              DG
Sbjct: 1108 KNDG 1111

>ZYRO0D12496g Chr4 (1047901..1055058) [7158 bp, 2385 aa] {ON} some
            similarities with uniprot|P41809 Saccharomyces cerevisiae
            YDR420W HKR1 Serine/threonine rich cell surface protein
            that contains an EF hand motif involved in the regulation
            of cell wall beta-1 3 glucan synthesis and bud site
            selection overexpression confers resistance to Hansenula
            mrakii killer toxin HM-1
          Length = 2385

 Score =  110 bits (276), Expect = 5e-24,   Method: Compositional matrix adjust.
 Identities = 87/268 (32%), Positives = 142/268 (52%), Gaps = 45/268 (16%)

Query: 494  TALAVPTTSTAVA--VP-LSSEQTRDSFAWLPTNIVVQSSNTDMTNS---PETNTNTSGL 547
            ++L  P+T T +   VP  +S  T  +  WLP +I++QS+ +  +     PE    T+ L
Sbjct: 1619 SSLVSPSTITNIGSSVPSATSAPTESNTNWLPYSIIMQSTPSPSSAPSFNPEV---TATL 1675

Query: 548  PVRIAP-TAVTQPADSILISIGFKIELNYPFLIKESYASAQIFNFLPLILTYPFEQDSSN 606
            P  IAP T V++P +S  I+IGFK +++Y FL+    +SAQIF FLP +L YPF     N
Sbjct: 1676 PHAIAPQTPVSEPPNSSTITIGFKRQIDYDFLVNNPLSSAQIFTFLPDVLIYPF-----N 1730

Query: 607  YQLDPSISLQSDTSVISTEYQDYSSIFSYETTLSNLGLTLYDLSDGETSVLEASPTVASM 666
            Y          D ++    + + SS +  +TT      TL    D           +   
Sbjct: 1731 Y----------DQNIDKGTHTNESSHYKRKTT------TLQPYRD----------VMVRT 1764

Query: 667  NKYQR----DTSSISVKQIIPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQN 722
            NK  +     T+++SV QI+P+L     Y+ ++AE  FP + V++L++Y+ N  S++Y N
Sbjct: 1765 NKKHKVQMISTANVSVIQIMPMLSRDKSYLVAVAELYFPAQYVNKLKDYMKNSNSMLYNN 1824

Query: 723  PDPRLKDMAALIDSTIPIFSTIDPDGNL 750
             +P L  +A LID +IP+   +D +G++
Sbjct: 1825 TNPTLFALADLIDPSIPLTGMVDDNGDV 1852

>Kwal_47.18650 s47 complement(913245..919724) [6480 bp, 2159 aa] {ON}
            YDR420W (HKR1) - Type 1 membrane protein with EF hand
            motif [contig 191] FULL
          Length = 2159

 Score =  109 bits (273), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 94/263 (35%), Positives = 129/263 (49%), Gaps = 37/263 (14%)

Query: 492  TSTALAVPTTSTAVAVPLSSEQTRDSFAWLPTNIVVQSSNTDMTNSPET--NTNTSGLPV 549
            TST L+ P+ S A +        R S  WLPT ++V +S T+  N+  +     T+ LP 
Sbjct: 1284 TSTFLSKPSQSVAGS--------RTSSDWLPT-LLVTASATESVNTQSSFDTAATATLPQ 1334

Query: 550  RIAP-TAVTQPADSILISIGFKIELNYPFLIKESYASAQIFNFLPLILTYPFEQDSSNYQ 608
             I P T V+ PA+   I+IGF+  LNYPFLIK   ASAQIF FLP +L YPF       +
Sbjct: 1335 FIVPSTPVSIPANYSQITIGFQKALNYPFLIKNPLASAQIFGFLPDVLRYPFVS-----R 1389

Query: 609  LDPSISLQSDTSVISTEYQDYSSIFSYETTLSNL-----------GLTLYDLSDGETSVL 657
             D +      T+V  ++   Y   F  +  L N            GLT +   DG+    
Sbjct: 1390 FDRT------TNVSESQPWRYFKEFPRDGHLENTNLSEDERKLKNGLTNHIFEDGQALQY 1443

Query: 658  EASPTVASMNKYQRDTSSISVKQIIPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTS 717
                   +   +  + S + V  IIP++I GN YI S+A   FP   V+ LQ  I N  S
Sbjct: 1444 RMHNRTGA---FSANFSEVVVSSIIPLIISGNDYIASVAIVYFPTSAVNVLQKMILNSAS 1500

Query: 718  IIYQNPDPRLKDMAALIDSTIPI 740
            ++Y NPD   + +A LID  IPI
Sbjct: 1501 MLYSNPDSTQESLALLIDPKIPI 1523

>Ecym_4060 Chr4 (125127..131732) [6606 bp, 2201 aa] {ON} similar to
            Ashbya gossypii ADR200C
          Length = 2201

 Score =  102 bits (255), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 86/251 (34%), Positives = 117/251 (46%), Gaps = 39/251 (15%)

Query: 519  AWLPTNIVVQSSNTDMTNSPETNTNTSG-----LPVRIAP-TAVTQPADSILISIGFKIE 572
             WLPT IV  S    M  SP+ +T         LP  I P T V +P +  LI+IGF   
Sbjct: 1326 GWLPTTIVTAS----MQTSPKESTTVGSAATYTLPRAITPATPVAKPDNYDLITIGFVQG 1381

Query: 573  LNYPFLIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDTSVISTEYQDYSSI 632
            LNY FL+    ASAQIF+FLP +L YP+ ++     L   I+ +S+ +++        S 
Sbjct: 1382 LNYAFLVSNPVASAQIFSFLPHLLNYPYIENKEALLLR-HIN-ESNNNILGNRGSVSGSY 1439

Query: 633  FSYETTLSNLGLTLYDLSDGETSVLEASPTVASMNKYQRDTS------SISVKQIIPILI 686
            F+    LS        L    T+  E    V      + DTS       I VKQI+P L+
Sbjct: 1440 FNIYGNLS--------LEHKHTNSTEP---VKRRQNNEEDTSDEHGYSQIVVKQIVPFLL 1488

Query: 687  PGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALIDSTIPI------ 740
             G  Y  S+AE  FP E V  L+  + +  S +Y NP   L  +A+L+D  IP+      
Sbjct: 1489 QGADYTASVAEVYFPSEAVTSLRKMVADKNSKLYLNPVATLNQLASLVDPRIPVLTITSG 1548

Query: 741  ----FSTIDPD 747
                FS  DPD
Sbjct: 1549 SSPSFSNTDPD 1559

>KAFR0E03320 Chr5 complement(659303..662875) [3573 bp, 1190 aa] {ON}
           Anc_5.524 YDR420W
          Length = 1190

 Score =  102 bits (253), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 84/254 (33%), Positives = 131/254 (51%), Gaps = 20/254 (7%)

Query: 503 TAVAVPLSSEQTRDSFAWLPTNIVVQSSNTDMTNSPETNTNTSGLPVRIA-PTAVTQPAD 561
           T++    +S  T+++  WLP +++  S  +D T S      T+ LP  IA PT   QP +
Sbjct: 575 TSITQKPASTGTQNTNDWLPNSMIFASDQSDSTFSSLNPEITATLPAEIAAPTEAVQPPN 634

Query: 562 SILISIGFKIELNYPFLIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDTSV 621
           + L++IGFK ELNY FLI    ASAQIF FLPL L+YPF     N   +   SL S    
Sbjct: 635 TTLVTIGFKKELNYIFLIDNPLASAQIFEFLPLTLSYPFLLTQYNASSEEITSLCSS--- 691

Query: 622 ISTEYQD--YSSIFSYETTLSN----LGLTLYDLSDGETSVLEASPTVASMNK-YQRD-- 672
            S  Y+D   + + ++E+T  +    +   +   S+  T+ L +SP+ +   + + R+  
Sbjct: 692 -SLYYEDDGRTILTTHESTTVDSTQFVKKIMGPASNLLTAQLASSPSSSPTQRPHPRESS 750

Query: 673 ------TSSISVKQIIPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPR 726
                 +S++ VK I+P++     YI S+AE  FP + +  LQ +IN   S +Y NP   
Sbjct: 751 PPPFFNSSNVVVKHILPMISNQRDYIVSVAEVYFPTDTLGILQKFINKPNSPLYSNPSTP 810

Query: 727 LKDMAALIDSTIPI 740
              +  LID  I +
Sbjct: 811 YSTLVHLIDPWISL 824

>CAGL0F03003g Chr6 (289923..293480) [3558 bp, 1185 aa] {ON} some
           similarities with uniprot|P32334 Saccharomyces
           cerevisiae YGR014w MSB2 or uniprot|P41809 Saccharomyces
           cerevisiae YDR420w HKR1
          Length = 1185

 Score = 99.0 bits (245), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 81/256 (31%), Positives = 117/256 (45%), Gaps = 51/256 (19%)

Query: 490 RLTSTALAVPTTSTAVAVPLSSEQTRDSFAWLPTNIVVQSSNTDMTNSPETNTNTSGLPV 549
           ++ S+A   P T T     LSS++      WLP+ I+ QS      +S    T T  LP 
Sbjct: 693 QIPSSASPPPATPTGPKT-LSSDEN-----WLPSGIIFQSDFATTVSSSFNPTATKSLPQ 746

Query: 550 RIAPTAVT-QPADSILISIGFKIELNYPFLIKESYASAQIFNFLPLILTYPFEQDSSNYQ 608
            IAP  +T +  ++ L++IG K  LNY FLI    +SAQIFNFLP +LTYPF   + N  
Sbjct: 747 FIAPPKMTVKSPNTTLVTIGLKQGLNYQFLIDNPLSSAQIFNFLPSVLTYPFSSYAPND- 805

Query: 609 LDPSISLQSDTSVISTEYQDYSSIFSYETTLSNLGLTLYDLSDGETSVLEASPTVASMNK 668
                                   F   + + +  L   D                  N 
Sbjct: 806 ------------------------FPINSLIDDNALAFLD-----------------SNL 824

Query: 669 YQRDTSSISVKQIIPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLK 728
           +  + S+ISV  I+P+LIPG+ +  S+ E  FP + +D L   I +  S +Y NP+  L 
Sbjct: 825 F--NASTISVHGIVPLLIPGHEFFVSVVEVYFPNDLLDSLSALIKDRNSSLYSNPNDSLS 882

Query: 729 DMAALIDSTIPIFSTI 744
            +A LID +IP+   I
Sbjct: 883 ALARLIDPSIPLTGLI 898

>KLLA0A01826g Chr1 complement(163010..167404) [4395 bp, 1464 aa]
           {ON} some similarities with uniprot|P41809 Saccharomyces
           cerevisiae YDR420W HKR1 Serine/threonine rich cell
           surface protein that contains an EF hand motif involved
           in the regulation of cell wall beta-1 3 glucan synthesis
           and bud site selection overexpression confers resistance
           to Hansenula mrakii killer toxin HM-1
          Length = 1464

 Score = 97.4 bits (241), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 76/224 (33%), Positives = 109/224 (48%), Gaps = 42/224 (18%)

Query: 520 WLPTNIVVQSSNTDMTNSPETN--TNTSGLPVRIAPTA-VTQPADSILISIGFKIELNYP 576
           WLPT +V++ +    T++  +     TS LP  I P + V  P    +I++GFK  LNYP
Sbjct: 722 WLPTTLVIEPTAAHATSAATSADLGATSTLPQAINPASDVPLPDGYTVITVGFKEPLNYP 781

Query: 577 FLIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDTSVISTEYQDYSSIFSYE 636
           FLI    ASAQIFNFLP +L  PF               Q  T+  +  Y+   +IF   
Sbjct: 782 FLIANPLASAQIFNFLPKVLVRPF---------------QLTTTGAAPVYRRSWNIFKK- 825

Query: 637 TTLSNLGLTLYDLSDGETSVLEASPTVASMNKYQRDTSSISVKQIIPILIPGNLYITSLA 696
                 G+  + LS             +S+  Y      + VK I+P++I    YI S+A
Sbjct: 826 ------GINTHLLS-------------SSLPTYD----DVQVKSIVPLVIQNVSYIVSIA 862

Query: 697 EGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALIDSTIPI 740
           E  FP E V  LQ  + + +SI+Y NP   L D+A+LI+  IP+
Sbjct: 863 EVYFPTESVHTLQELVLDSSSILYSNPVSYLADLASLINPAIPL 906

>ADR200C Chr4 complement(1051878..1058894) [7017 bp, 2338 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YDR420W
            (HKR1)
          Length = 2338

 Score = 95.9 bits (237), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 77/228 (33%), Positives = 109/228 (47%), Gaps = 25/228 (10%)

Query: 520  WLPTNIVVQSSNTDMTNSPET--NTNTSGLPVRIAPTAVTQPADSI-LISIGFKIELNYP 576
            WLP  I+ +S    + N+  T    +T+ LP  I P ++ + +D   LISIGF   LNY 
Sbjct: 1498 WLPATIITESVQQHLPNAASTTGGVSTTLLPAAIHPQSLVEGSDGYDLISIGFLKGLNYV 1557

Query: 577  FLIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDTSVISTEYQDYSSIFSYE 636
            F+   + +SAQIF FLP +LTYPFE        + ++ +   T     E     S +S  
Sbjct: 1558 FVTSFALSSAQIFTFLPPVLTYPFES-----HTEETVKIHDPTEKRQLERPPPVSFYSRA 1612

Query: 637  ----TTLSNLGLTLYDLSDGETSVLEASPTVASMNKYQRDTSSISVKQIIPILIPGNLYI 692
                TTLS+   +       ETS +              D S + VKQ+ P +     YI
Sbjct: 1613 SRDTTTLSSFTHSQVIAVQKETSDVP-------------DLSFVKVKQLAPDVSEERGYI 1659

Query: 693  TSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALIDSTIPI 740
             +LA   FP + V +LQ  I +  S +Y NPD  LK  A+LID TI +
Sbjct: 1660 ATLAHVYFPSKLVPKLQELILDSESPLYNNPDVNLKIFASLIDPTIKV 1707

>KLTH0E08844g Chr5 (804120..808682) [4563 bp, 1520 aa] {ON} some
            similarities with uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1520

 Score = 79.3 bits (194), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 43/88 (48%), Positives = 56/88 (63%), Gaps = 6/88 (6%)

Query: 520  WLPTNIVVQSSNTDMTNSPETNTN-----TSGLPVRI-APTAVTQPADSILISIGFKIEL 573
            WLPT +V  SS+T+ T S  T++N     T  LP  I APT V+QP    LI+IGFK  L
Sbjct: 1179 WLPTALVTASSDTNDTQSGSTDSNGSQLATQTLPQAIGAPTEVSQPEGYTLITIGFKQAL 1238

Query: 574  NYPFLIKESYASAQIFNFLPLILTYPFE 601
            NYPF++  +  SAQIF +LP  L +PF+
Sbjct: 1239 NYPFVVTNAVTSAQIFAYLPETLNFPFD 1266

 Score = 41.2 bits (95), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 39/68 (57%), Gaps = 3/68 (4%)

Query: 674  SSISVKQIIPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIY-QNPDPRLKDMAA 732
            S I+V ++ P+ +    Y+ ++AE  FP  +V+ LQ  I N  S  Y +N    L  +AA
Sbjct: 1270 SDITVARLGPLKVSNRDYLLTIAEVYFPSAQVENLQTLIQNDESKFYAKNATKNL--LAA 1327

Query: 733  LIDSTIPI 740
             +D+TIP+
Sbjct: 1328 FVDATIPL 1335

>SAKL0H23188g Chr8 (2009677..2013465) [3789 bp, 1262 aa] {ON} some
            similarities with uniprot|P08640 Saccharomyces cerevisiae
            YIR019C MUC1 GPI-anchored cell surface glycoprotein
            required for diploid pseudohyphal formation and haploid
            invasive growth transcriptionally regulated by the MAPK
            pathway (via Ste12p and Tec1p) and the cAMP pathway (via
            Flo8p)
          Length = 1262

 Score = 75.1 bits (183), Expect = 4e-13,   Method: Compositional matrix adjust.
 Identities = 43/103 (41%), Positives = 59/103 (57%), Gaps = 11/103 (10%)

Query: 520  WLPTNIVVQSSNTD--MTNSPETNTNTSGLPVRIAPTA------VTQPADSILISIGFKI 571
            WLPT ++V+S+ TD    N+  + T  S L  +  P A      V+QP    LI+IGFK 
Sbjct: 902  WLPTAMLVESTATDNGQANAGGSGTGISTLATQTLPQAIAAATQVSQPDGYTLITIGFKK 961

Query: 572  ELNYPFLIKESYASAQIFNFLPLILTYPFE---QDSSNYQLDP 611
             LNYPF++    +SAQ+F++LP +L YPF     D   YQL P
Sbjct: 962  SLNYPFVVSHPVSSAQLFSYLPNVLNYPFNYTFSDVQVYQLVP 1004

>Kwal_47.17703 s47 (521283..525989) [4707 bp, 1568 aa] {ON} YNR044W
            (AGA1) - anchorage subunit of a-agglutinin [contig 206]
            FULL
          Length = 1568

 Score = 70.1 bits (170), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 38/89 (42%), Positives = 50/89 (56%), Gaps = 7/89 (7%)

Query: 520  WLPTNIVVQSSNT------DMTNSPETNTNTSGLPVRI-APTAVTQPADSILISIGFKIE 572
            WLPT ++  ++NT      D ++  +    T  LP  I APT V QP    LI++GFK  
Sbjct: 1224 WLPTAMITANANTESASPTDSSDPKDAQQATKTLPQAIGAPTEVVQPEGYTLITVGFKKA 1283

Query: 573  LNYPFLIKESYASAQIFNFLPLILTYPFE 601
            LNYPF++     SAQIF FLP  L  PF+
Sbjct: 1284 LNYPFVVGNPVTSAQIFAFLPDTLNSPFD 1312

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 40/74 (54%)

Query: 676  ISVKQIIPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALID 735
            I+V ++ P+ +    Y+ ++AE  FP  +V+ LQ  I N  S  Y         +A+L+D
Sbjct: 1318 ITVARLGPLKVSSRDYLLTVAEVYFPSAQVENLQKLIQNDASKFYFVNGTSRNVVASLVD 1377

Query: 736  STIPIFSTIDPDGN 749
            +TIP+   +  DG+
Sbjct: 1378 ATIPLTGLLQDDGS 1391

>AGR019C Chr7 complement(747644..750961) [3318 bp, 1105 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YGR014W
           (MSB2)
          Length = 1105

 Score = 69.7 bits (169), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 40/92 (43%), Positives = 49/92 (53%), Gaps = 11/92 (11%)

Query: 520 WLPTNIVVQS----------SNTDMTNSPETNTNTSGLP-VRIAPTAVTQPADSILISIG 568
           WLPT I+  +           NT     P    N   LP V  AP  VT   D  LI+IG
Sbjct: 757 WLPTVIITATEQEVVSTESPQNTQSKPKPTATPNIQTLPQVIAAPDRVTPKKDYTLITIG 816

Query: 569 FKIELNYPFLIKESYASAQIFNFLPLILTYPF 600
           FK +LNYPF+    +A+AQIF++LP IL YPF
Sbjct: 817 FKKQLNYPFIAMNPFANAQIFDYLPGILNYPF 848

 Score = 48.5 bits (114), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 25/65 (38%), Positives = 39/65 (60%)

Query: 676 ISVKQIIPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALID 735
           ISV Q++P+      YI ++A+  FP EKVDEL   + +  S +Y + D  +K  A+LID
Sbjct: 855 ISVIQLVPLKANSKDYIATIAQVYFPSEKVDELAKLVVDTNSELYSSYDANMKVFASLID 914

Query: 736 STIPI 740
             +P+
Sbjct: 915 PQLPL 919

>TDEL0D03010 Chr4 complement(564735..568106) [3372 bp, 1123 aa] {ON}
           Anc_4.150 YGR014W
          Length = 1123

 Score = 69.3 bits (168), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 52/143 (36%), Positives = 71/143 (49%), Gaps = 7/143 (4%)

Query: 520 WLPTNIVVQSSNTDMTNSPETNTNTSGLPVRIAP-TAVTQPADSILISIGFKIELNYPFL 578
           W+PT IV Q+S T  T+S      T+ LP  IA  T V +P    LI++GFK  LNY F+
Sbjct: 796 WVPTQIVTQTSQT--TSSGTVGQATATLPQAIAAATQVARPDGYTLITLGFKRALNYNFV 853

Query: 579 IKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDT----SVISTEYQDYSSIFS 634
           +    +SAQIF FLP +L  PFE    N  +   + LQS      + ++  Y   S I +
Sbjct: 854 VSNPISSAQIFAFLPEMLRTPFENSYENITVQQLVPLQSKAVSYLATVAEVYFPTSEISA 913

Query: 635 YETTLSNLGLTLYDLSDGETSVL 657
               +SN    LY   +G    L
Sbjct: 914 LSKLISNTSSNLYTDVEGPAKYL 936

 Score = 43.9 bits (102), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 40/65 (61%)

Query: 676 ISVKQIIPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALID 735
           I+V+Q++P+      Y+ ++AE  FP  ++  L   I+N +S +Y + +   K +A LID
Sbjct: 882 ITVQQLVPLQSKAVSYLATVAEVYFPTSEISALSKLISNTSSNLYTDVEGPAKYLAYLID 941

Query: 736 STIPI 740
           ++IP+
Sbjct: 942 ASIPL 946

>KLLA0C17985g Chr3 complement(1596320..1599046) [2727 bp, 908 aa]
           {ON} some similarities with uniprot|P32334 Saccharomyces
           cerevisiae YGR014W MSB2 Mucin family member at the head
           of the Cdc42p- and MAP kinase-dependent filamentous
           growth signaling pathway also functions as an osmosensor
           in parallel to the Sho1p-mediated pathway potential
           Cdc28p substrate
          Length = 908

 Score = 68.9 bits (167), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 44/102 (43%), Positives = 59/102 (57%), Gaps = 7/102 (6%)

Query: 502 STAVAVPLSSEQTRDSFAWLPTNIVVQ--SSNTDMTNSPETNTNTSGLPVRI-APTAVTQ 558
           ST    P+S+ Q      WLPT +V +  +S T  T++  +   T  LP  I A T + Q
Sbjct: 521 STTTEQPVSTTQQ----VWLPTTMVAEFETSGTQSTSTTSSKIATETLPQAITAATEIVQ 576

Query: 559 PADSILISIGFKIELNYPFLIKESYASAQIFNFLPLILTYPF 600
           PA   LI++GFK ELNYPF +    ++AQIF FLP +L YPF
Sbjct: 577 PAGYTLITVGFKKELNYPFTVNNPVSNAQIFEFLPKVLNYPF 618

 Score = 43.5 bits (101), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 40/64 (62%)

Query: 677 SVKQIIPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALIDS 736
           SV +++P+ +    Y+ ++A+  FP + V  LQ  I N +S+IY N    LK +++ ID+
Sbjct: 628 SVLELVPLKVTSLDYLVTVAKVYFPEDSVSTLQAQILNSSSVIYNNDVTALKQLSSYIDA 687

Query: 737 TIPI 740
           +IP+
Sbjct: 688 SIPL 691

>NDAI0K02580 Chr11 complement(574995..577952) [2958 bp, 985 aa] {ON}
           Anc_4.150
          Length = 985

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 41/93 (44%), Positives = 56/93 (60%), Gaps = 5/93 (5%)

Query: 513 QTR---DSFAWLPTNIVVQSSNTDMTNS-PETNTNTSGLPVRIA-PTAVTQPADSILISI 567
           QTR   D+  W+PT ++ QS+    + S P +NT T  LP  IA  T + +P    LI+I
Sbjct: 596 QTRASSDTNWWIPTVLITQSNQPSESASVPTSNTATKTLPQVIAVGTTIPEPEGYSLITI 655

Query: 568 GFKIELNYPFLIKESYASAQIFNFLPLILTYPF 600
           GFK  LNY F++    +SAQIF+FLP +L  PF
Sbjct: 656 GFKKPLNYEFIVANPKSSAQIFSFLPDVLNAPF 688

>Kpol_1062.37 s1062 complement(78801..81722) [2922 bp, 973 aa] {ON}
           complement(78801..81722) [2922 nt, 974 aa]
          Length = 973

 Score = 65.1 bits (157), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 54/96 (56%), Gaps = 4/96 (4%)

Query: 520 WLPTNIVVQSSNTDMTNSPETNTNTSGLPVRIAP-TAVTQPADSILISIGFKIELNYPFL 578
           W+PT+++ +S  TD   +  T + T  +P+ IA  T    P    L++IGFK  LNY F+
Sbjct: 643 WVPTSLITESDVTDSAVTTRTLSATKSVPLAIAASTQTATPEGCSLVTIGFKEALNYQFV 702

Query: 579 IKESYASAQIFNFLPLILTYPFEQDSSN---YQLDP 611
           +  S   AQIF FLP  L  PFE+  +N   Y+L P
Sbjct: 703 LSSSVTVAQIFAFLPGGLIAPFEEQLANVTVYRLSP 738

 Score = 38.1 bits (87), Expect = 0.10,   Method: Compositional matrix adjust.
 Identities = 22/73 (30%), Positives = 42/73 (57%), Gaps = 2/73 (2%)

Query: 669 YQRDTSSISVKQIIPILIPGNL-YITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRL 727
           ++   ++++V ++ P+   GN  Y  ++AE  FP  K+DEL  ++ +  S +Y N     
Sbjct: 724 FEEQLANVTVYRLSPLNY-GNFNYTLTVAEVYFPTSKIDELAAFVADSESALYVNASGTE 782

Query: 728 KDMAALIDSTIPI 740
           +++ +LID  IPI
Sbjct: 783 EELVSLIDPRIPI 795

>ZYRO0G11242g Chr7 (900370..904833) [4464 bp, 1487 aa] {ON} weakly
            similar to uniprot|P32334 Saccharomyces cerevisiae
            YGR014W MSB2 Mucin family member at the head of the
            Cdc42p- and MAP kinase-dependent filamentous growth
            signaling pathway also functions as an osmosensor in
            parallel to the Sho1p-mediated pathway potential Cdc28p
            substrate
          Length = 1487

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 47/108 (43%), Positives = 62/108 (57%), Gaps = 10/108 (9%)

Query: 510  SSEQTRDSFAWLPTNIVVQSSNTDMTNSPETNTNTSGLPVRIAPTAVTQ---PADSILIS 566
            SS  T D++ W+PT I+ Q +  + T S  ++  T+ LP  IA  A TQ   P    L++
Sbjct: 1150 SSSTTNDNW-WVPTKIITQPA-PNTTASSTSSQATATLPQAIA--AATQQVRPKGYSLLT 1205

Query: 567  IGFKIELNYPFLIKESYASAQIFNFLPLILTYPFEQDSSN---YQLDP 611
            IGFK  LNY FLI    +SAQIF FLP IL  PF+   +N   YQ+ P
Sbjct: 1206 IGFKSALNYNFLISSPLSSAQIFAFLPSILNDPFQNQFNNVSIYQIVP 1253

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 23/72 (31%), Positives = 41/72 (56%)

Query: 669  YQRDTSSISVKQIIPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLK 728
            +Q   +++S+ QI+P+      Y+ ++AE  FP + + +L + I N  S +Y +     K
Sbjct: 1239 FQNQFNNVSIYQIVPLKSESLDYLATVAEVYFPTKHISDLNSLITNNASSLYTDAHGSAK 1298

Query: 729  DMAALIDSTIPI 740
             +A LID TIP+
Sbjct: 1299 YLAELIDPTIPL 1310

>YGR014W Chr7 (516943..520863) [3921 bp, 1306 aa] {ON}  MSB2Mucin
            family member involved in the Cdc42p- and MAP
            kinase-dependent filamentous growth signaling pathway;
            also functions as an osmosensor in parallel to the
            Sho1p-mediated pathway; potential Cdc28p substrate
          Length = 1306

 Score = 63.9 bits (154), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 40/102 (39%), Positives = 55/102 (53%), Gaps = 2/102 (1%)

Query: 520  WLPTNIVVQSSNTDMTNSPETN-TNTSGLPVRIAP-TAVTQPADSILISIGFKIELNYPF 577
            W+PT ++ Q+     T S     T T  LP  IA  T V +P    LI+IGFK  LNY F
Sbjct: 961  WIPTELITQAPEAASTASSTVGGTQTMTLPHAIAAATQVPEPEGYTLITIGFKKALNYEF 1020

Query: 578  LIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDT 619
            ++ E  +SAQIF +LP  L  PF+   +N  +   + LQ D+
Sbjct: 1021 VVSEPKSSAQIFGYLPEALNTPFKNVFTNITVLQIVPLQDDS 1062

 Score = 52.0 bits (123), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 40/65 (61%)

Query: 676  ISVKQIIPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALID 735
            I+V QI+P+      Y+ S+AE  FP  +++EL N I N +S  Y +     K MAA++D
Sbjct: 1050 ITVLQIVPLQDDSLNYLVSVAEVYFPTAEIEELSNLITNSSSAFYTDGMGTAKSMAAMVD 1109

Query: 736  STIPI 740
            S+IP+
Sbjct: 1110 SSIPL 1114

>KAFR0F03470 Chr6 (689705..692554) [2850 bp, 949 aa] {ON} Anc_4.150
           YGR014W
          Length = 949

 Score = 61.2 bits (147), Expect = 7e-09,   Method: Compositional matrix adjust.
 Identities = 38/96 (39%), Positives = 53/96 (55%), Gaps = 4/96 (4%)

Query: 520 WLPTNIVVQSSNTDMTNSPETNTNTSGLPVRIA-PTAVTQPADSILISIGFKIELNYPFL 578
           W+ ++++  S     T      T T  LP  IA PT VT P D  LI+IGFK  LNY F+
Sbjct: 591 WVASDLMTASEEASTTTRASATTATGSLPQAIAAPTEVTAPDDYSLITIGFKKALNYEFV 650

Query: 579 IKESYASAQIFNFLPLILTYPFEQDSSN---YQLDP 611
           +    +SAQ+F++LP+ L  PF    +N   YQ+ P
Sbjct: 651 VNTPESSAQLFSYLPIALNTPFNNSFTNISVYQIVP 686

 Score = 37.7 bits (86), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 24/67 (35%), Positives = 39/67 (58%), Gaps = 2/67 (2%)

Query: 676 ISVKQIIPILIPG-NLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALI 734
           ISV QI+P++    N YIT +AE  FP +++  LQ  I + +S ++       K + +LI
Sbjct: 679 ISVYQIVPLVESSLNYYIT-VAEVYFPEQEIASLQQMIKDNSSALFTENVGAPKTLVSLI 737

Query: 735 DSTIPIF 741
           D +IP+ 
Sbjct: 738 DPSIPLV 744

>CAGL0F08833g Chr6 (873849..876659) [2811 bp, 936 aa] {ON} weakly
           similar to uniprot|P32334 Saccharomyces cerevisiae
           YGR014w MSB2 multicopy suppressor of a CDC24 bud
           emergence defect
          Length = 936

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 56/88 (63%), Gaps = 5/88 (5%)

Query: 519 AWLPTNIVVQSSNTDMTNSP-ETN--TNTSGLPVRIAPTAVTQ--PADSILISIGFKIEL 573
           AW+PT++++  + T+  ++P E+N  T  S LP  I  +A ++  P    +I+IGFK  L
Sbjct: 590 AWIPTSLIIAPTETESESTPTESNDGTQLSSLPKVIYGSAYSESVPEGYSVITIGFKKPL 649

Query: 574 NYPFLIKESYASAQIFNFLPLILTYPFE 601
           NYPF++ ES +SAQI  +LP +L   FE
Sbjct: 650 NYPFVVSESKSSAQIMYYLPKLLNANFE 677

>Skud_7.299 Chr7 (520447..523956) [3510 bp, 1169 aa] {ON} YGR014W
           (REAL)
          Length = 1169

 Score = 61.2 bits (147), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 40/103 (38%), Positives = 57/103 (55%), Gaps = 6/103 (5%)

Query: 520 WLPTNIVVQSSNTDMT-NSPETNTNTSGLPVRIAPTAVTQPADS---ILISIGFKIELNY 575
           W+PT ++ Q+  T  T +S    T T  LP  +A  A TQ  +S    LI++GFK  LNY
Sbjct: 823 WIPTELITQAPETASTISSAIGGTQTMTLPQAVA--AATQIPESEGYSLITVGFKKPLNY 880

Query: 576 PFLIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSD 618
            F++ E  +SAQIF +LP  L  PF+   +N  +   + LQ D
Sbjct: 881 EFVVSEPKSSAQIFGYLPAALNTPFKNVFTNITVLQIVPLQDD 923

 Score = 50.1 bits (118), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%)

Query: 676 ISVKQIIPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALID 735
           I+V QI+P+      Y+ S+AE  FP  +V+EL N I N +S  Y +     K MAA++D
Sbjct: 912 ITVLQIVPLQDDSLNYLISVAEVYFPTAEVEELSNLIMNTSSTFYTDGTGTAKSMAAMVD 971

Query: 736 STIPI 740
            +IP+
Sbjct: 972 PSIPL 976

>TPHA0K01390 Chr11 complement(287666..290146) [2481 bp, 826 aa] {ON}
           Anc_4.150 YGR014W
          Length = 826

 Score = 60.5 bits (145), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 64/231 (27%), Positives = 95/231 (41%), Gaps = 72/231 (31%)

Query: 520 WLPTNIVVQSSNT-DMTNSPETNTNTSGLPVRIA-PTAVTQPADSILISIGFKIELNYPF 577
           W+PT I+ +S  T +  +S +T + T   P  IA PT +  P+   LI+IGFK  LNY F
Sbjct: 488 WVPTRIITESDKTQNSVSSTQTVSTTRIKPKAIAAPTTIPVPSGYTLITIGFKEALNYDF 547

Query: 578 LIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDTSVISTEYQDYSSIFSYET 637
           ++    +SAQIF FLP  L  PF+                               F+ ++
Sbjct: 548 VLDNPVSSAQIFAFLPEALDLPFQ-------------------------------FANDS 576

Query: 638 TLSNLGLTLYDLSDGETSVLEASPTVASMNKYQRDTSSISVKQIIPILIPGNLYITSLAE 697
           ++S L L  Y LS+   +VL                                     +AE
Sbjct: 577 SVSILKLVPYSLSNYNYTVL-------------------------------------VAE 599

Query: 698 GLFPGEKVDELQNYINNLTSIIYQ-NPDPRLKDMAALIDSTIPIFSTIDPD 747
             FP + +DEL + I +  S +Y  N   RL  +  LID  IP+   ++ D
Sbjct: 600 VYFPSDSIDELSSLIKDSDSPLYTLNTGSRLA-LVNLIDQNIPLTGLVNLD 649

>TBLA0G01210 Chr7 (321555..327032) [5478 bp, 1825 aa] {ON} Anc_4.150
            YGR014W
          Length = 1825

 Score = 60.1 bits (144), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 37/93 (39%), Positives = 50/93 (53%), Gaps = 14/93 (15%)

Query: 514  TRDSFAWLPTNIVVQSSNTDMTNSPETNTNTSGLPVRIAPTAVTQ------PADSILISI 567
            TR S  W+PT++ V S+     NS    T+TS LP +  P A+        P +  LI+I
Sbjct: 1492 TRQSNWWIPTSLAVAST----MNS----TDTSTLPTQAIPQAIGSVEQPPAPENHSLITI 1543

Query: 568  GFKIELNYPFLIKESYASAQIFNFLPLILTYPF 600
            GFK ELNY F++    + AQI N+LP  L   F
Sbjct: 1544 GFKKELNYEFVVSHPMSGAQIINYLPNTLVNAF 1576

 Score = 33.1 bits (74), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 18/75 (24%), Positives = 41/75 (54%)

Query: 666  MNKYQRDTSSISVKQIIPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDP 725
            +N +  + ++ISV  ++P     + Y+ ++A   FP +++  L+  I++ +S  Y     
Sbjct: 1573 VNAFFGNVTNISVNNLVPYNDTKSDYLITIATVYFPTDEIKHLRELIHDKSSSFYTASQD 1632

Query: 726  RLKDMAALIDSTIPI 740
              + +A L+D +IP+
Sbjct: 1633 VARQLANLVDPSIPL 1647

>NCAS0A05230 Chr1 (1034523..1036880) [2358 bp, 785 aa] {ON}
           Anc_4.150
          Length = 785

 Score = 57.8 bits (138), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 38/101 (37%), Positives = 55/101 (54%), Gaps = 8/101 (7%)

Query: 520 WLPTNIVV---QSSNTDMTNSPETNTNTSGLPVRI-APTAVTQPADSILISIGFKIELNY 575
           W+PT ++    Q + + M +S  T T    LP  I A T+V  P    +I+IGFK  LNY
Sbjct: 452 WIPTQLITASTQVTGSAMVSSAATKT----LPQVIGAATSVPTPEGYTVITIGFKEALNY 507

Query: 576 PFLIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQ 616
            F++    +SAQIF+FLP +L  PF+    N  +   + LQ
Sbjct: 508 EFIVSSPKSSAQIFSFLPYVLNTPFDDIYDNITVSRLVPLQ 548

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 36/65 (55%)

Query: 676 ISVKQIIPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALID 735
           I+V +++P+      Y  ++AE LFP   +  L  YI +  S +Y   D  L+ +A LID
Sbjct: 539 ITVSRLVPLQKKDIGYFITVAEVLFPESAIANLSVYIKDTNSSLYTKNDDALRSLALLID 598

Query: 736 STIPI 740
            +IP+
Sbjct: 599 PSIPL 603

>Suva_7.296 Chr7 (508904..512311) [3408 bp, 1135 aa] {ON} YGR014W
           (REAL)
          Length = 1135

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 37/101 (36%), Positives = 54/101 (53%), Gaps = 2/101 (1%)

Query: 520 WLPTNIVVQSSNTDMTNSPETNTNTSG-LPVRIAP-TAVTQPADSILISIGFKIELNYPF 577
           W+PT ++ Q +    + S  T    +  LP  IA  T + +P    LI+IGFK  LNY F
Sbjct: 790 WIPTQLITQETEAASSASTTTGGTQTMTLPHAIAAATQIAEPDGYSLITIGFKKALNYEF 849

Query: 578 LIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSD 618
           ++ E  +SAQIF +LP  L  PF+   +N  +   + LQ D
Sbjct: 850 VVSEPKSSAQIFAYLPEALNTPFKDVFTNISVLQIVPLQDD 890

 Score = 45.8 bits (107), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 24/65 (36%), Positives = 39/65 (60%)

Query: 676 ISVKQIIPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALID 735
           ISV QI+P+      Y+ S+AE  FP  +++ L + I N +S  Y +     K MAA++D
Sbjct: 879 ISVLQIVPLQDDLFSYLVSVAEVYFPTAEIETLSSLITNTSSSFYTDGMGTAKSMAAMVD 938

Query: 736 STIPI 740
           ++IP+
Sbjct: 939 ASIPL 943

>Smik_7.302 Chr7 (508666..512235) [3570 bp, 1189 aa] {ON} YGR014W
           (REAL)
          Length = 1189

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 43/114 (37%), Positives = 62/114 (54%), Gaps = 6/114 (5%)

Query: 510 SSEQTRDSFAWLPTNIVVQS-SNTDMTNSPETNTNTSGLPVRIAPTAVTQ-PADS--ILI 565
           SS  + D+  W+PT ++ Q+       +S  + T T  LP  IA  A TQ PA     LI
Sbjct: 832 SSVTSSDNNWWIPTELITQAPEAASTASSTASGTQTMTLPHAIA--AATQIPASEGYSLI 889

Query: 566 SIGFKIELNYPFLIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDT 619
           ++GFK  LNY F++ E  +SAQIF +LP  L  PF+   +N  +   + LQ D+
Sbjct: 890 TVGFKRALNYEFVVSEPKSSAQIFGYLPEALNTPFKNVFTNISVLQIVPLQDDS 943

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%)

Query: 676 ISVKQIIPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAALID 735
           ISV QI+P+      Y+ S+AE  FP  +++EL N I N +S  Y +     K MAA++D
Sbjct: 931 ISVLQIVPLQDDSLSYLVSVAEVYFPTAELEELSNLITNTSSTFYTSGTGTAKSMAAMVD 990

Query: 736 STIPI 740
            +IP+
Sbjct: 991 PSIPL 995

>TBLA0G00950 Chr7 complement(232502..239263) [6762 bp, 2253 aa] {ON}
            Anc_5.524 YDR420W
          Length = 2253

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 70/286 (24%), Positives = 115/286 (40%), Gaps = 65/286 (22%)

Query: 520  WLPTNIVVQSSNTDMTNSPETNTNTSGLPVRIAPTAVTQ---PADSILISIGFKIELNYP 576
            WLP+ +VV+++ +   N     + T   P  I P    +   P DS LI +     LNYP
Sbjct: 1556 WLPSTLVVENNPSGSANMQFNPSETFKWPRAITPENQNEKPAPVDSQLILVALDRPLNYP 1615

Query: 577  FLIKESYASAQIFNFLPLILTYPF----------------------EQDSSNYQLDPSIS 614
            FLI+   +SAQ+ N++P IL+Y                        E +S    L P I+
Sbjct: 1616 FLIENLVSSAQVMNYIPFILSYSLIDFSPAAPSSYSLSGTAYDISSEINSGTTTLSPVIA 1675

Query: 615  LQSDTSVISTEYQDYSSIF--SYETTLSNLGLTLYDLSDGETSVLEASPTVASMNKYQRD 672
                  V + +    +SI   +   +L ++     + S+ E     +S T +  +   + 
Sbjct: 1676 TNKKRDVKTWQLNKMNSISQNTVSHSLIDVSFLTANQSNIEIQASSSSSTNSIASLQLQA 1735

Query: 673  TSSISVKQIIPILIPGNLYI-----------TSLAEGLFPGEKVDEL------------- 708
            T + +  QI+P    GN              +SL   L+PG +V ++             
Sbjct: 1736 TDNKTPSQILPTKTSGNEITNSETSDITPTSSSLYPSLYPGIEVKQIIPLLIEDRDYWVA 1795

Query: 709  --------------QNYINNLTSIIYQNPDPRLKDMAALIDSTIPI 740
                          Q YI +L SI+Y NP    ++++  IDS+IPI
Sbjct: 1796 GVQVYVPNNVVDQLQAYIYDLDSILYHNPVYIARELSNFIDSSIPI 1841

>Ecym_7349 Chr7 complement(722484..725873) [3390 bp, 1129 aa] {ON}
           similar to Ashbya gossypii AGR019C
          Length = 1129

 Score = 57.0 bits (136), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/107 (35%), Positives = 57/107 (53%), Gaps = 15/107 (14%)

Query: 520 WLPTNIVVQS--------SNTDMTNSPETNTNTSG---LPVRIAPTAVTQP-ADSILISI 567
           WLPT I+ +S        + TD    P T+  ++    LP  I+      P  +  LI++
Sbjct: 776 WLPTAILTESDADSEPTVTVTDTETKPTTSMASTAIQTLPKFISSANGKIPEGNYTLITV 835

Query: 568 GFKIELNYPFLIKESYASAQIFNFLPLILTYPFEQDSSN---YQLDP 611
           GFK  LNYPF++    +SAQIF+FLP +L YP+    +N   ++L P
Sbjct: 836 GFKRRLNYPFVVSNPVSSAQIFDFLPNVLNYPYGFRCANVSVWRLLP 882

 Score = 45.4 bits (106), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 25/77 (32%), Positives = 43/77 (55%)

Query: 669 YQRDTSSISVKQIIPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLK 728
           Y    +++SV +++P+      Y+ ++A   FP E +DEL   + + TS +Y + D   K
Sbjct: 868 YGFRCANVSVWRLLPLKSGSRDYLVTVAAVFFPTEHLDELARLVADNTSSLYSSYDETGK 927

Query: 729 DMAALIDSTIPIFSTID 745
            MA+LID  IP+   I+
Sbjct: 928 TMASLIDPMIPLTGIIN 944

>KNAG0D03590 Chr4 (657513..660497) [2985 bp, 994 aa] {ON} Anc_4.150
           YGR014W
          Length = 994

 Score = 55.1 bits (131), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 41/111 (36%), Positives = 61/111 (54%), Gaps = 10/111 (9%)

Query: 513 QTRDSFAWLPTNIVVQ------SSNTDMTNSPETNTNTSGLP-VRIAPTAVTQPADSILI 565
           +T DS  W+PT ++ +      +SNT  T SP   + T  +P V +AP  VT      LI
Sbjct: 639 ETTDSDWWIPTRLLTETAAVETASNTVSTLSP---SATKYMPQVIMAPGDVTVAEGYTLI 695

Query: 566 SIGFKIELNYPFLIKESYASAQIFNFLPLILTYPFEQDSSNYQLDPSISLQ 616
           +IGFK  L+Y F++ +  +SAQI +FLP +L  P+    SN  +   + LQ
Sbjct: 696 TIGFKKPLHYEFVVTQPKSSAQIISFLPNLLNQPYGNIFSNISVLQLVPLQ 746

 Score = 41.2 bits (95), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 38/67 (56%)

Query: 674 SSISVKQIIPILIPGNLYITSLAEGLFPGEKVDELQNYINNLTSIIYQNPDPRLKDMAAL 733
           S+ISV Q++P+      Y  ++AE  FP  ++  L   + + +SI+Y      LK +A +
Sbjct: 735 SNISVLQLVPLQDSSISYYVTVAEVYFPTAEITNLSQLVKDTSSILYTEVSESLKTLADM 794

Query: 734 IDSTIPI 740
           ID +IPI
Sbjct: 795 IDPSIPI 801

>ACR165W Chr3 (644229..647648) [3420 bp, 1139 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL020C (SPT23) and
           YIR033W (MGA2)
          Length = 1139

 Score = 33.1 bits (74), Expect = 3.7,   Method: Compositional matrix adjust.
 Identities = 22/64 (34%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 41  EADFQSV-PAISTYDFQGISAISTYDFQGVSAISTYDYSDEGISGIITTSNEEPIYTIYT 99
           EAD  SV P+  T D+  +S +S  +  G S+ S Y Y +  ++  ++    EPI T Y 
Sbjct: 139 EADALSVSPSAGTKDWSALS-VSAKEVAGPSSESYYQYCERLLNQALSFGRTEPIRTTYL 197

Query: 100 NTTD 103
           N  D
Sbjct: 198 NPAD 201

>Suva_2.210 Chr2 complement(358205..360343) [2139 bp, 712 aa] {ON}
           YDR052C (REAL)
          Length = 712

 Score = 32.3 bits (72), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 28/94 (29%), Positives = 48/94 (51%), Gaps = 11/94 (11%)

Query: 578 LIKESYAS--AQIFNFLPLILTYPFEQDSSNYQLDPSISLQSDTSVISTEYQDYSSIFSY 635
           L+K  + S  AQI  F    +T    + S       +I L  DT ++S   ++Y  ++SY
Sbjct: 154 LLKRGFLSLGAQITQFFDTTVTIVITRRSVE-----NIYLLKDTDILSRAKKNYMKVWSY 208

Query: 636 ETT---LSNLGLTLYDLSDGETSVLEASPTVASM 666
           E     L NL + L  LS  +++ L A+PT++++
Sbjct: 209 EKAARFLKNLDVDLDHLSKAKSASL-ATPTLSNL 241

>TPHA0M01260 Chr13 complement(258932..261067) [2136 bp, 711 aa] {ON}
           Anc_3.299 YDR052C
          Length = 711

 Score = 32.0 bits (71), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 30/112 (26%), Positives = 54/112 (48%), Gaps = 11/112 (9%)

Query: 561 DSILISIGFKIELNYPF-LIKESYA--SAQIFNFLPLILTYPFEQDSSNYQLDPSISLQS 617
           D   IS   KI+L     L+++ +A   AQI  F    +T    + S+       I L  
Sbjct: 150 DDTDISKYMKIKLEKKRDLLRKGFAFLGAQITQFFDTSVTIVITRRST-----EKIYLLQ 204

Query: 618 DTSVISTEYQDYSSIFSYETT---LSNLGLTLYDLSDGETSVLEASPTVASM 666
           DT V+S   ++Y  +++YE +   L NL + L  L   + S+L  + +++++
Sbjct: 205 DTDVLSRAKKNYMKVWNYEKSTRFLKNLDVHLDQLEKSKNSLLHTTTSLSNL 256

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.126    0.340 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 62,779,979
Number of extensions: 2599464
Number of successful extensions: 11095
Number of sequences better than 10.0: 169
Number of HSP's gapped: 11159
Number of HSP's successfully gapped: 271
Length of query: 761
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 644
Effective length of database: 40,065,477
Effective search space: 25802167188
Effective search space used: 25802167188
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 70 (31.6 bits)