Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_358.4na 1ON61761730840.0
TPHA0M00120singletonON61954422220.0
NDAI0I02650na 1ON63860820710.0
SAKL0C12122gna 2ON61156720640.0
NCAS0D02350na 1ON63460720620.0
TDEL0G04740singletonON60159320570.0
Skud_5.24na 1ON62761120530.0
YEL065W (SIT1)na 1ON62856120430.0
Smik_5.22na 1ON62856120310.0
Suva_5.2na 1ON62755920260.0
Kwal_23.5241na 2ON59156719990.0
KLTH0A01562gna 2ON61560319780.0
Kwal_23.4853na 3ON60356517770.0
KLTH0G09504gna 3ON62458517660.0
Kpol_416.6singletonON59760316690.0
Kpol_416.5singletonON60759415610.0
TDEL0B00140singletonON63261115510.0
NCAS0A11500singletonON61458914910.0
Kpol_513.33singletonON62655914680.0
TPHA0G03780singletonON61255014650.0
NDAI0A02050singletonON61758414210.0
TPHA0B00180singletonON63360613740.0
KAFR0D00930singletonON61459413570.0
KNAG0J02980singletonON63662513141e-174
CAGL0E04092gna 4ON64559213061e-173
SAKL0G06600gsingletonON62959913051e-173
TBLA0C01040singletonON66960612981e-171
Suva_8.12na 4ON63361612911e-170
KAFR0C02660singletonON59158512791e-169
KAFR0I01560singletonON63260712771e-168
Smik_8.1na 4ON62759812361e-162
KLLA0A10439gsingletonON63461512361e-162
YHL040C (ARN1)na 4ON62758512351e-162
Skud_8.3na 4ON63159612321e-162
KLLA0C19272gsingletonON62361412081e-158
SAKL0G03300gsingletonON61658412031e-158
NDAI0H00140na 4ON63259212001e-157
KLTH0D00506gsingletonON61658811961e-157
TPHA0K02330singletonON63161811731e-153
SAKL0F00792gsingletonON61758911651e-152
ZYRO0G07414gsingletonON70756111641e-150
KLTH0D18150gsingletonON60759811361e-147
Kwal_56.22298singletonON61058610921e-141
TDEL0H00130singletonON62159510891e-140
Kwal_34.15711na 4ON61857610801e-139
KLLA0C00220gsingletonON62457310771e-138
YHL047C (ARN2)singletonON62061110701e-137
KLTH0D00110gsingletonON62058910681e-137
KLTH0B10450gsingletonON62058910681e-137
Kwal_23.2794singletonON61956310671e-137
SAKL0F00110gsingletonON62058710571e-136
SAKL0E00132gsingletonON62053310481e-134
KLTH0A07964gsingletonON61960410431e-133
TBLA0F00470singletonON73259410221e-129
NCAS0I00110na 4ON4524499711e-125
Skud_18.6singletonON6105629761e-124
YCL073C (GEX1)singletonON6155799701e-123
YKR106W (GEX2)singletonON6155799681e-122
KLLA0E14609gsingletonON6396119651e-122
Kwal_14.722singletonON6115829191e-115
KLTH0B00110gsingletonON6276018691e-107
KLLA0D19945gsingletonON6445718481e-104
KLTH0G00198gna 4ON4584397531e-92
Smik_11.370singletonON4404347415e-91
YOL158C (ENB1)singletonON6065786342e-73
Smik_21.4singletonON6055345553e-62
TDEL0H01600singletonON6046035371e-59
Suva_26.1singletonON5344865216e-58
Skud_6.14singletonON6366204741e-50
Smik_6.22singletonON6366164704e-50
Suva_10.9singletonON6375514695e-50
TDEL0A03210singletonON5845883282e-31
NCAS0I00100singletonON1631272513e-24
Smik_11.369singletonON1681452434e-23
Kwal_26.9616singletonON5623381672e-11
Smik_17.11singletonON5443381653e-11
Skud_16.503singletonON5433331502e-09
TBLA0D032708.843ON5501481412e-08
YPR198W (SGE1)singletonON5433351403e-08
KNAG0K01020singletonON5993231376e-08
SAKL0A00726gsingletonON5983791369e-08
KLTH0C10120gsingletonON6513961332e-07
TBLA0D03280singletonON580871243e-06
KLTH0C10142gsingletonON5735321207e-06
TDEL0F039908.272ON6312801207e-06
KLTH0D16962gsingletonON5713421172e-05
KLLA0D19941gsingletonON6114691118e-05
Skud_7.560na 5ON6421711073e-04
NCAS0C03460na 5ON6304021064e-04
SAKL0A08228gsingletonON5693401055e-04
ZYRO0A00330gsingletonON5764371055e-04
Smik_13.2722.473ON5611201020.001
SAKL0H16808g8.272ON6573181020.001
KLTH0B00132gsingletonON5683511010.001
ZYRO0G21868gna 6ON6201801010.001
Ecym_42988.272ON6782811000.002
SAKL0B12716gsingletonON6323371000.002
YKR105C (VBA5)singletonON5823971000.002
Smik_16.81na 5ON6252031000.002
Suva_13.4678.843ON5431461000.002
Suva_13.2652.473ON561127990.002
Skud_13.2442.473ON562115990.003
Kwal_27.102458.843ON515246970.004
Skud_13.258.843ON53773970.004
Kwal_14.1585na 6ON570174970.004
ZYRO0C01430g8.272ON590297970.004
Kpol_543.448.272ON643294970.005
TBLA0F030408.272ON906288970.005
KLTH0G13464g8.272ON593371960.006
SAKL0C05588gsingletonON677276950.007
ABL040W2.473ON567137940.008
KNAG0J002608.843ON550131940.010
NCAS0B002908.843ON54287930.011
YMR088C (VBA1)2.473ON562115930.013
ZYRO0G21890gsingletonON57691920.015
SAKL0F00198gsingletonON537339910.019
TPHA0C047908.843ON55682910.022
SAKL0E02992g2.473ON570132900.026
KLLA0A04631g8.272ON579118900.028
NDAI0K004008.843ON55381890.033
KNAG0G034308.843ON54287870.066
KLTH0H05456gna 6ON568171870.067
Skud_13.4518.843ON53982860.078
KNAG0E025602.473ON578131860.087
KLTH0D05434g2.473ON576145850.12
YML116W (ATR1)8.843ON54277850.13
Suva_13.278.843ON55377840.16
NCAS0A078102.473ON568122840.17
AGR076C8.272ON686147830.19
YGR224W (AZR1)na 5ON613173830.19
TPHA0A017508.272ON636313830.23
Smik_13.4928.843ON54371820.25
Smik_11.368singletonON580491820.28
KNAG0C052505.394ON564183810.34
KNAG0C051905.395ON564184810.37
TDEL0A024902.473ON55490800.39
CAGL0J01375g2.473ON564390800.51
Kwal_26.77552.473ON559140790.55
Kpol_467.242.473ON37043780.59
KAFR0B039408.843ON54779790.62
YCL069W (VBA3)singletonON458308780.68
KAFR0B03930singletonON55588780.72
SAKL0C02178gsingletonON565260780.86
CAGL0B02079gna 5ON624357770.94
NDAI0H022002.473ON571121771.0
KLTH0B10142gsingletonON568350771.1
NCAS0F031005.395ON570191751.7
TDEL0B005508.843ON53784751.8
SAKL0E04246gna 7ON565204742.3
Kwal_26.6686singletonON56965742.3
Suva_15.2915.396ON592197742.3
SAKL0D01386g8.843ON521247742.3
Kwal_26.6669singletonON590234742.6
AFR343C3.84ON571184742.6
YDL245C (HXT15)singletonON56773733.0
YJR158W (HXT16)singletonON56773733.1
Skud_4.5singletonON57355733.3
Kpol_1039.192.242ON573117733.5
ZYRO0G03234g2.473ON562111724.1
Kwal_56.22285singletonON56766714.7
YNR072W (HXT17)singletonON56473715.7
Skud_14.406na 8ON56455715.7
YEL069C (HXT13)na 9ON56455715.9
ZYRO0G00286gsingletonON589159706.2
CAGL0J09944g2.242ON592107706.3
KAFR0F04080singletonON54973706.5
KAFR0E02030singletonON54873706.9
KAFR0F02800singletonON55173707.0
Smik_14.401na 8ON63655707.8
Kwal_55.19582singletonON56765707.8
Smik_5.19na 9ON56755707.8
AFL207C5.394ON53965698.2
ZYRO0C00374gna 10ON56447699.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_358.4
         (617 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON} c...  1192   0.0  
TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON}               860   0.0  
NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON}              802   0.0  
SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} simi...   799   0.0  
NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON}              798   0.0  
TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {O...   796   0.0  
Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)   795   0.0  
YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}  SIT1Ferrioxa...   791   0.0  
Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)   786   0.0  
Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)      785   0.0  
Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL06...   774   0.0  
KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {...   766   0.0  
Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {O...   689   0.0  
KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {...   684   0.0  
Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON} (26742..28...   647   0.0  
Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON} (23208..25...   605   0.0  
TDEL0B00140 Chr2 (25633..27531) [1899 bp, 632 aa] {ON}                602   0.0  
NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa] ...   578   0.0  
Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}...   570   0.0  
TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {O...   568   0.0  
NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {O...   551   0.0  
TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON}      533   0.0  
KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {O...   527   0.0  
KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON}             510   e-174
CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} simila...   507   e-173
SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {...   507   e-173
TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON}              504   e-171
Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON} Y...   501   e-170
KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON}              497   e-169
KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C     496   e-168
Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL0...   480   e-162
KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {...   480   e-162
YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}  AR...   480   e-162
Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL0...   479   e-162
KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]...   469   e-158
SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} simila...   468   e-158
NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON}      466   e-157
KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar ...   465   e-157
TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON}             456   e-153
SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar ...   453   e-152
ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {...   452   e-150
KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]...   442   e-147
Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C ...   425   e-141
TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON}      424   e-140
Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C ...   420   e-139
KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar ...   419   e-138
YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}  ARN...   416   e-137
KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to ...   416   e-137
KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {...   416   e-137
Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C (...   415   e-137
SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to...   411   e-136
SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to...   408   e-134
KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {...   406   e-133
TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON}              398   e-129
NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON}        378   e-125
Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C (R...   380   e-124
YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}  GEX1...   378   e-123
YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}  GEX2Proto...   377   e-122
KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} simi...   376   e-122
Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C - H...   358   e-115
KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON} ...   339   e-107
KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} simi...   331   e-104
KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to...   294   1e-92
Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106...   290   5e-91
YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}  E...   248   2e-73
Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)    218   3e-62
TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {O...   211   1e-59
Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)       205   6e-58
Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON} Y...   187   1e-50
Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON} Y...   185   4e-50
Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON} ...   185   5e-50
TDEL0A03210 Chr1 (574153..575907) [1755 bp, 584 aa] {ON}              130   2e-31
NCAS0I00100 Chr9 complement(4805..5296) [492 bp, 163 aa] {ON}         101   3e-24
Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W...    98   4e-23
Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR19...    69   2e-11
Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON} ...    68   3e-11
Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198...    62   2e-09
TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {O...    59   2e-08
YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasm...    59   3e-08
KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {...    57   6e-08
SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar ...    57   9e-08
KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} simila...    56   2e-07
TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {O...    52   3e-06
KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} simila...    51   7e-06
TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.2...    51   7e-06
KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} simi...    50   2e-05
KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]...    47   8e-05
Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W ...    46   3e-04
NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {O...    45   4e-04
SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {...    45   5e-04
ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar ...    45   5e-04
Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {...    44   0.001
SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]...    44   0.001
KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to...    44   0.001
ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]...    44   0.001
Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}...    43   0.002
SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} simi...    43   0.002
YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON} ...    43   0.002
Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878...    43   0.002
Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {...    43   0.002
Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {...    43   0.002
Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {...    43   0.003
Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116...    42   0.004
Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W (...    42   0.004
Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C...    42   0.004
ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {...    42   0.004
Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON} (96992..9...    42   0.005
TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {O...    42   0.005
KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]...    42   0.006
SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} simila...    41   0.007
ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic ho...    41   0.008
KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.84...    41   0.010
NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843       40   0.011
YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON} ...    40   0.013
ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]...    40   0.015
SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON...    40   0.019
TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa] ...    40   0.022
SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {...    39   0.026
KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {...    39   0.028
NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON}                39   0.033
KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {O...    38   0.066
KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} simila...    38   0.067
Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {...    38   0.078
KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.4...    38   0.087
KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} simila...    37   0.12 
YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidr...    37   0.13 
Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W (...    37   0.16 
NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa] ...    37   0.17 
AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON} S...    37   0.19 
YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma...    37   0.19 
TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {O...    37   0.23 
Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {...    36   0.25 
Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {...    36   0.28 
KNAG0C05250 Chr3 (1024201..1025895) [1695 bp, 564 aa] {ON}             36   0.34 
KNAG0C05190 Chr3 (1014564..1016258) [1695 bp, 564 aa] {ON}             36   0.37 
TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.4...    35   0.39 
CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} simil...    35   0.51 
Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C...    35   0.55 
Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON} (55523..5...    35   0.59 
KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {O...    35   0.62 
YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease ...    35   0.68 
KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {O...    35   0.72 
SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {...    35   0.86 
CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {...    34   0.94 
NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {O...    34   1.0  
KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {...    34   1.1  
NCAS0F03100 Chr6 complement(618654..620366) [1713 bp, 570 aa] {O...    33   1.7  
TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.8...    33   1.8  
SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly...    33   2.3  
Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}...    33   2.3  
Suva_15.291 Chr15 complement(497138..498916) [1779 bp, 592 aa] {...    33   2.3  
SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON} unipro...    33   2.3  
Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}...    33   2.6  
AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}...    33   2.6  
YDL245C Chr4 complement(11657..13360) [1704 bp, 567 aa] {ON}  HX...    33   3.0  
YJR158W Chr10 (732440..734143) [1704 bp, 567 aa] {ON}  HXT16Prot...    33   3.1  
Skud_4.5 Chr4 complement(9302..11023) [1722 bp, 573 aa] {ON} YJR...    33   3.3  
Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON} (63222....    33   3.5  
ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} simila...    32   4.1  
Kwal_56.22285 s56 (26966..28669) [1704 bp, 567 aa] {ON} YNR072W ...    32   4.7  
YNR072W Chr14 (772657..774351) [1695 bp, 564 aa] {ON}  HXT17Hexo...    32   5.7  
Skud_14.406 Chr14 (740510..742204) [1695 bp, 564 aa] {ON} YNR072...    32   5.7  
YEL069C Chr5 complement(21537..23231) [1695 bp, 564 aa] {ON}  HX...    32   5.9  
ZYRO0G00286g Chr7 (18542..20311) [1770 bp, 589 aa] {ON} highly s...    32   6.2  
CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} simil...    32   6.3  
KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {O...    32   6.5  
KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON}               32   6.9  
KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON}               32   7.0  
Smik_14.401 Chr14 (716260..718170) [1911 bp, 636 aa] {ON} YNR072...    32   7.8  
Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W ...    32   7.8  
Smik_5.19 Chr5 complement(25102..26805) [1704 bp, 567 aa] {ON} Y...    32   7.8  
AFL207C Chr6 complement(44349..45968) [1620 bp, 539 aa] {ON} Unc...    31   8.2  
ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar ...    31   9.2  

>Kpol_358.4 s358 complement(9458..11311) [1854 bp, 617 aa] {ON}
           complement(9458..11311) [1854 nt, 618 aa]
          Length = 617

 Score = 1192 bits (3084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 582/617 (94%), Positives = 582/617 (94%)

Query: 1   MTSSSDSKFDGKINETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNN 60
           MTSSSDSKFDGKINETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNN
Sbjct: 1   MTSSSDSKFDGKINETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNN 60

Query: 61  IEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXX 120
           IEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLS       
Sbjct: 61  IEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSTVNAITT 120

Query: 121 XXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGV 180
                GQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGV
Sbjct: 121 VIAAAGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGV 180

Query: 181 ILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLS 240
           ILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLS
Sbjct: 181 ILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLS 240

Query: 241 AIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFG 300
           AIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFG
Sbjct: 241 AIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFG 300

Query: 301 CILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIF 360
           CILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIF
Sbjct: 301 CILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIF 360

Query: 361 FALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKV 420
           FALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKV
Sbjct: 361 FALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKV 420

Query: 421 RRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASV 480
           RRTKPFIIFGVSCWFIAFGLLVHYR            LCLLGFGAGFFTYTTQASIQASV
Sbjct: 421 RRTKPFIIFGVSCWFIAFGLLVHYRGSSSSHSGIVGSLCLLGFGAGFFTYTTQASIQASV 480

Query: 481 KYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTF 540
           KYHSKMAVITALYLAMYNI           IWTNVLPKQISKRIANETLAAEAYGSPFTF
Sbjct: 481 KYHSKMAVITALYLAMYNIGSAVGAAVSGAIWTNVLPKQISKRIANETLAAEAYGSPFTF 540

Query: 541 ILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELENT 600
           ILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELENT
Sbjct: 541 ILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELENT 600

Query: 601 PNSDEQGSFADNDKNVN 617
           PNSDEQGSFADNDKNVN
Sbjct: 601 PNSDEQGSFADNDKNVN 617

>TPHA0M00120 Chr13 (23458..25317) [1860 bp, 619 aa] {ON} 
          Length = 619

 Score =  860 bits (2222), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 410/544 (75%), Positives = 462/544 (84%)

Query: 53  HKDAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLL 112
           H DAGV+NIEVYAEQYSSPI+R  LFFS+FLVAYAYGLDG VRYTYQ+ ATSSY+QHSLL
Sbjct: 49  HVDAGVHNIEVYAEQYSSPIHRFALFFSIFLVAYAYGLDGQVRYTYQSYATSSYAQHSLL 108

Query: 113 SXXXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCF 172
           S            GQICYARASDIFGRMTIL+IG++FY++GTIIESQATNV+RFA GSCF
Sbjct: 109 STVNCITTVIAAAGQICYARASDIFGRMTILVIGVIFYSMGTIIESQATNVSRFAAGSCF 168

Query: 173 YQLGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGM 232
           YQLGYTG++L+LE+IA DFSNLNWRL ASFVPALPFIINTWISGNV+ AV  +WKWGIGM
Sbjct: 169 YQLGYTGIVLTLEVIAADFSNLNWRLLASFVPALPFIINTWISGNVTSAVNGNWKWGIGM 228

Query: 233 WAFIVPLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGL 292
           WAFI+PLSAIPLGCCLLHMR+LA KNA DRL  E      +GW  +IV++  W+LDFIGL
Sbjct: 229 WAFILPLSAIPLGCCLLHMRYLAKKNAGDRLLKEASLIGTLGWKKFIVEILFWRLDFIGL 288

Query: 293 LLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWA 352
           L+LC TFGCIL+PFTLAGGLQ +W+TAHIIVPEVIGWC+ALP+FLLWEIKFS+ PLTPWA
Sbjct: 289 LMLCVTFGCILIPFTLAGGLQSEWQTAHIIVPEVIGWCLALPLFLLWEIKFSRHPLTPWA 348

Query: 353 LIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTL 412
           LIKDRGI FA+ IAFHINF WYMQGDYMYTVLIVSV+ES+KSATRITSLYSFVSVITGT+
Sbjct: 349 LIKDRGIIFAIFIAFHINFCWYMQGDYMYTVLIVSVHESVKSATRITSLYSFVSVITGTI 408

Query: 413 LGLVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTT 472
           LG+ I K+RRTKPFI+FGV CWFIAFGLLVHYR            LCLLGFGAGFFTYTT
Sbjct: 409 LGMFITKIRRTKPFIVFGVVCWFIAFGLLVHYRGDNNSHSGIIGSLCLLGFGAGFFTYTT 468

Query: 473 QASIQASVKYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAE 532
           QASIQAS K HSKMAVITALYLA YNI           IWTN+LPK+ISKR+ NETLAA 
Sbjct: 469 QASIQASAKSHSKMAVITALYLATYNIGSSVGAAVSGAIWTNILPKEISKRLNNETLAAL 528

Query: 533 AYGSPFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVV 592
           AY SP++FI+ YTW TPER AVV++YRYTQ+ILCIVGLCFC+TLL +ALFLRNHKL S V
Sbjct: 529 AYSSPYSFIIDYTWGTPERDAVVLAYRYTQRILCIVGLCFCTTLLISALFLRNHKLVSSV 588

Query: 593 ALSE 596
           ++ +
Sbjct: 589 SIDK 592

>NDAI0I02650 Chr9 (617474..619390) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  802 bits (2071), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 398/608 (65%), Positives = 461/608 (75%), Gaps = 13/608 (2%)

Query: 15  ETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPIYR 74
           E+    Q  E+  Q  +  + S    S        ++  KDAGV NIEVYAEQY  P YR
Sbjct: 4   ESSHSNQGEEEIAQKETYSVHSTDISSGS------EISIKDAGVQNIEVYAEQYKKPYYR 57

Query: 75  VMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARAS 134
           V+LFFSLFLVAYAYGLDG++RYTYQA ATSSYSQHSLLS            GQI +ARAS
Sbjct: 58  VLLFFSLFLVAYAYGLDGNIRYTYQAYATSSYSQHSLLSTVNCIKTVIAAAGQIWFARAS 117

Query: 135 DIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNL 194
           DIFGR+T+LII ++FY VGTIIESQATNV RF  G CFYQ+GYTG +L +E+IA DFSNL
Sbjct: 118 DIFGRLTMLIIAILFYVVGTIIESQATNVARFTAGGCFYQVGYTGAMLIVEVIATDFSNL 177

Query: 195 NWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGCCLLHMRWL 254
           NWRL A FVPALPFIINTWISG+V+ AVG  WKWGIGMWAFI PL+ IPLGCC+LHMR+L
Sbjct: 178 NWRLLALFVPALPFIINTWISGDVTSAVGGDWKWGIGMWAFIFPLACIPLGCCMLHMRYL 237

Query: 255 AHKNAKDRLKSEFRTYRDMGWFAYI-VDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQ 313
           A+KN+KD+L       +D  W  Y  +DV  WKLD IGLLL+   FGC+LVPFTLAGG+ 
Sbjct: 238 ANKNSKDKLAKHVMVPKDKEWKRYFFIDVLFWKLDMIGLLLMVCFFGCVLVPFTLAGGMN 297

Query: 314 DKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIW 373
            +WKTAHIIVPEVIGW V LP+++LWE+KFSK PLTPWAL+KDRG+F AL+IA  INF W
Sbjct: 298 SEWKTAHIIVPEVIGWVVCLPLYILWEMKFSKHPLTPWALLKDRGVFSALIIATMINFCW 357

Query: 374 YMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSC 433
           YMQGDYMYTVL+V+V+ES+KSATRITSLYSFVSV+TGT LGLV+IKVRRTKPFIIFG+S 
Sbjct: 358 YMQGDYMYTVLVVAVHESVKSATRITSLYSFVSVLTGTGLGLVLIKVRRTKPFIIFGISM 417

Query: 434 WFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALY 493
           WF+AFGLL+ YR            LCLLGFGAGFFTYTTQASIQA+ + H K+AVITALY
Sbjct: 418 WFVAFGLLIRYRGDSASHAGIIGSLCLLGFGAGFFTYTTQASIQATTRSHQKLAVITALY 477

Query: 494 LAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPERQA 553
           LA YNI           +WTNVLP +ISK IAN+TLAAEAYGSPFTFI+T TW TP+R A
Sbjct: 478 LAAYNIGSGLGSAVSGAVWTNVLPDRISKAIANQTLAAEAYGSPFTFIITNTWGTPDRMA 537

Query: 554 VVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSEL------ENTPNSDEQG 607
           VV +YR  QKILCI+GLCFC  LL AALFLRNH+LE VVAL+EL      E+ P  D   
Sbjct: 538 VVKAYRDVQKILCIIGLCFCIPLLCAALFLRNHRLEDVVALNELDEKNVKEDDPVVDFLA 597

Query: 608 SFADNDKN 615
            F  + +N
Sbjct: 598 KFIPSLRN 605

>SAKL0C12122g Chr3 (1086281..1088116) [1836 bp, 611 aa] {ON} similar
           to uniprot|P39980 Saccharomyces cerevisiae YEL065W SIT1
           Ferrioxamine B transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 611

 Score =  799 bits (2064), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 395/567 (69%), Positives = 465/567 (82%), Gaps = 2/567 (0%)

Query: 45  DLKNYDLYHKDAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATS 104
            +K  D   KDAGV+NIE+YA+QY SP YRV LFFS+FLVAYAYGLDG++RYT+QA ATS
Sbjct: 22  SIKTSDSKGKDAGVHNIEIYADQYKSPYYRVALFFSIFLVAYAYGLDGNIRYTFQAYATS 81

Query: 105 SYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVT 164
           SYSQHSL+S            GQIC+ARASD+FGR++ILII ++FY VGT+IESQATNV+
Sbjct: 82  SYSQHSLISTVNCIKTVIAAAGQICFARASDVFGRLSILIIAVLFYVVGTVIESQATNVS 141

Query: 165 RFAVGSCFYQLGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQ 224
           RFA G+CFYQLG TG+IL LE+I MDFSNLNWRL ASFVPALPFIINTWISG+V+ A+G 
Sbjct: 142 RFAAGACFYQLGLTGIILILEVIVMDFSNLNWRLVASFVPALPFIINTWISGDVTSAIGT 201

Query: 225 HWKWGIGMWAFIVPLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFL 284
           +W+WGI MWAFI+PLS IPL CC+LHMR+LAHKNA + L SEF+ Y+ M W  Y+V++F 
Sbjct: 202 NWEWGIAMWAFILPLSCIPLVCCMLHMRYLAHKNAPENLMSEFKLYKQMPWSEYLVEIFF 261

Query: 285 WKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFS 344
           WKLDF+GLLLLC +FG +L+PFTLAGGLQ KWK+A IIVPEV+GWC+ALP+FLLWE K++
Sbjct: 262 WKLDFLGLLLLCVSFGLVLIPFTLAGGLQTKWKSASIIVPEVLGWCLALPLFLLWEGKYA 321

Query: 345 KVPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSF 404
           + PLTPW LIKDRGIF AL+IAF INFIWYMQGDYMYTVLIV+V+ESIKSATRI SLYSF
Sbjct: 322 RNPLTPWDLIKDRGIFSALIIAFLINFIWYMQGDYMYTVLIVAVHESIKSATRIVSLYSF 381

Query: 405 VSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFG 464
           VSVITGTLLG VI+KVRRTKPFI+FGV CWF++FGLLVHYR            LCLLGFG
Sbjct: 382 VSVITGTLLGFVIVKVRRTKPFILFGVCCWFLSFGLLVHYRGDSGAHAGIVGSLCLLGFG 441

Query: 465 AGFFTYTTQASIQASVKYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRI 524
           AGFFTYTTQASIQAS   H  MAVITALYLA YNI           IWTNVLP+Q+SKR+
Sbjct: 442 AGFFTYTTQASIQASTGSHQNMAVITALYLATYNIGSAVGNAVSGAIWTNVLPQQLSKRL 501

Query: 525 ANETLAAEAYGSPFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLR 584
           ++  +A+ AYGSPFTFI+TYTW+T ERQAVV +YR+ QKILC VG+CFC  L+ AAL LR
Sbjct: 502 SDPEMASAAYGSPFTFIITYTWETLERQAVVHAYRHVQKILCTVGVCFCVPLVLAALLLR 561

Query: 585 NHKLESVVALSELE--NTPNSDEQGSF 609
           NHKLESVVAL +L+  N  + +E G+F
Sbjct: 562 NHKLESVVALDDLDEKNRVDDNENGNF 588

>NCAS0D02350 Chr4 (439325..441229) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score =  798 bits (2062), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/607 (63%), Positives = 463/607 (76%), Gaps = 6/607 (0%)

Query: 4   SSDSKFDGKINETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEV 63
           SS S  D  I+    Q  T +DS +  +     N            +   KDAGVNNIE+
Sbjct: 2   SSVSTTDQDIHNLSTQAHTQDDSIKKETVSATINS------VSSLSEESVKDAGVNNIEI 55

Query: 64  YAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXX 123
           YAEQY +P  R MLFFSLFLVAYAYGLDG++RYT+QA ATSSYS+HSLLS          
Sbjct: 56  YAEQYQNPFLRAMLFFSLFLVAYAYGLDGNIRYTFQALATSSYSEHSLLSTVNCIKTVIA 115

Query: 124 XXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILS 183
             GQI +ARASDIFGR+TIL + ++FY +GT+IESQATNV RF  G CFYQLGYTG +L 
Sbjct: 116 AAGQIWFARASDIFGRLTILGVSIIFYIIGTVIESQATNVARFTAGGCFYQLGYTGAMLI 175

Query: 184 LELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIP 243
           +E+IA DFSNLNWRL A F+PALPFIINTWISG+V+ AV  +WKWGIGMWAFI PL+ IP
Sbjct: 176 IEIIATDFSNLNWRLLALFIPALPFIINTWISGDVTAAVNGNWKWGIGMWAFIFPLACIP 235

Query: 244 LGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCIL 303
           L CC+LHMR+LAHKNAKDRL   F   +D+    Y +DVF W+LD IGLLL+   FGC+L
Sbjct: 236 LACCMLHMRYLAHKNAKDRLMPSFTIPKDVSRKEYFIDVFFWRLDMIGLLLIVCFFGCVL 295

Query: 304 VPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFAL 363
           +PFTLAGG++++W+TAHIIVPEVIGWCVALP+++LWEIKFS+ PLTPW L+KDRG++ AL
Sbjct: 296 IPFTLAGGMKEQWRTAHIIVPEVIGWCVALPLYILWEIKFSRHPLTPWELLKDRGVYSAL 355

Query: 364 VIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRT 423
           +IAF INF WYMQGDYMYTVLIV+V+ES+K+ATRITSLYSFVSVITGT+LGL ++K+RRT
Sbjct: 356 IIAFLINFCWYMQGDYMYTVLIVAVHESVKAATRITSLYSFVSVITGTILGLFLVKLRRT 415

Query: 424 KPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYH 483
           KPFI+FG+  WFI+FGLL+HYR            LCLLGF AGFFTYTTQ SIQA+ + H
Sbjct: 416 KPFILFGICGWFISFGLLIHYRGDSGAHAGIIGSLCLLGFCAGFFTYTTQTSIQATTRSH 475

Query: 484 SKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILT 543
           +KMAVITALYLA YNI           +WTNVLP +IS+ I+N+TLAAEAYGSPFTFI+T
Sbjct: 476 AKMAVITALYLACYNIGSSFGAAVSGGVWTNVLPDRISRGISNQTLAAEAYGSPFTFIIT 535

Query: 544 YTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELENTPNS 603
           YTW+T ERQAVV +YR TQKILCI+GL FC  LL AAL LR+HKLE VVAL ++      
Sbjct: 536 YTWETAERQAVVKAYRETQKILCIIGLVFCVPLLMAALMLRDHKLEDVVALDQMSEKVVE 595

Query: 604 DEQGSFA 610
           D+   FA
Sbjct: 596 DDDPIFA 602

>TDEL0G04740 Chr7 complement(865319..867124) [1806 bp, 601 aa] {ON} 
          Length = 601

 Score =  796 bits (2057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/593 (64%), Positives = 463/593 (78%), Gaps = 13/593 (2%)

Query: 19  QEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPIYRVMLF 78
           +EQT  ++   NS        D+ +          KDAGV+NIEV+  QY    YR+MLF
Sbjct: 7   KEQTKFETA--NSELSSHTHEDAGE---------EKDAGVHNIEVFTAQYDHIGYRLMLF 55

Query: 79  FSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFG 138
           FS+FL++YAYGLD ++RYT Q  AT+SYSQHSLL+            GQ+C+ARA+DIFG
Sbjct: 56  FSIFLISYAYGLDQNIRYTLQTYATNSYSQHSLLATVNCIIAVIAAPGQVCFARAADIFG 115

Query: 139 RMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWRL 198
           R T+LI+ ++FY +GTIIESQATNV+RFA G+CFY+LG TG++L +E+IAMDFSNLNWRL
Sbjct: 116 RFTVLIVAVIFYVMGTIIESQATNVSRFAAGACFYRLGITGLMLMMEVIAMDFSNLNWRL 175

Query: 199 FASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGCCLLHMRWLAHKN 258
            ASFVPALPFIINTWISGNV  A+G +WKWGIGMWAFI+PLS IPLG C+LHMR+LAHKN
Sbjct: 176 LASFVPALPFIINTWISGNVLTAIGTNWKWGIGMWAFILPLSCIPLGFCMLHMRYLAHKN 235

Query: 259 AKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKT 318
           AKD+L+SEF+ ++ M W+ YIV+VF W+LDF GL+L+C TFGCIL+PFTL GGL +KWKT
Sbjct: 236 AKDQLRSEFKLFKTMSWYEYIVEVFFWRLDFPGLILICVTFGCILIPFTLGGGLNEKWKT 295

Query: 319 AHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYMQGD 378
           A IIVPEVIGW VALP++++WE K+++ PLTPW LIKDRGIF AL+IAFHINFIWYMQGD
Sbjct: 296 AGIIVPEVIGWVVALPLYMIWESKYARHPLTPWKLIKDRGIFSALIIAFHINFIWYMQGD 355

Query: 379 YMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAF 438
           YM+TVL V+VNES  SA RITSLYSFVSVITGTLLGLVI+KVRRTK FI+FG+ CWFI+F
Sbjct: 356 YMFTVLRVAVNESNSSAQRITSLYSFVSVITGTLLGLVIVKVRRTKKFILFGIVCWFISF 415

Query: 439 GLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALYLAMYN 498
           GLLVH+R            LCL+GFGAGFFTYTTQASIQAS K+H  +AVIT+LYLA YN
Sbjct: 416 GLLVHFRGDSSSHSGIIGSLCLMGFGAGFFTYTTQASIQASTKHHENLAVITSLYLATYN 475

Query: 499 IXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPERQAVVVSY 558
           I           IWTNVLPK+I KR+ + TL  +AY  P TFILTYTW+T ERQAVV++Y
Sbjct: 476 IGSAVGAAVSGAIWTNVLPKEIGKRLNDATLTQQAYLEPLTFILTYTWETIERQAVVLAY 535

Query: 559 RYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELE--NTPNSDEQGSF 609
           RYTQK+LCIVGLCFC+ LL +A  LR+H+L  V+AL +L+  N    +E G F
Sbjct: 536 RYTQKVLCIVGLCFCAPLLFSAFLLRDHRLGDVIALEDLDEKNLAEDEESGKF 588

>Skud_5.24 Chr5 (26839..28722) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score =  795 bits (2053), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/611 (62%), Positives = 468/611 (76%), Gaps = 9/611 (1%)

Query: 10  DGKINETVLQEQTTED-----SNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVY 64
           D       L E+ TED       +   + +D N   +      +Y +   D GV+NIE+Y
Sbjct: 2   DPSTASRALPEEFTEDIVPEIPEKEAGTTVDVNPTLTISSPAPSY-IELIDPGVHNIEIY 60

Query: 65  AEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXX 124
           AE Y+ P+YRV LFFSLFL+AYAYGLDG++RYT+QA ATSSYSQHSLLS           
Sbjct: 61  AEIYNRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLSTVNCIKTVIAA 120

Query: 125 XGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSL 184
            GQI +AR SDIFGR +IL+I ++FY +GT+IESQA N+TRFAVG CFYQLG TG+IL L
Sbjct: 121 VGQIFFARLSDIFGRFSILVISVIFYIMGTVIESQAVNITRFAVGGCFYQLGLTGIILIL 180

Query: 185 ELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPL 244
           E+IA DFSNLNWRL A F+PALPFIINTWISGNV+ A+G +WKWGIGMWAFI+PL+ IPL
Sbjct: 181 EVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIGTNWKWGIGMWAFILPLACIPL 240

Query: 245 GCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILV 304
           G C+LHMR+LA K+AKDRLK EF     + W ++ +D+  WKLD IG+LL+ A FGC+LV
Sbjct: 241 GLCMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLLITAFFGCVLV 300

Query: 305 PFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALV 364
           PFTLAGGL+++W+TAHIIVPEVIGW VALP+++LWE+K+S+ PLTPW LIKDRGIFFAL+
Sbjct: 301 PFTLAGGLKEEWRTAHIIVPEVIGWVVALPLYMLWEMKYSRHPLTPWDLIKDRGIFFALL 360

Query: 365 IAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTK 424
           IAF INF WYMQGDYMYTVLIV+V+ESIKSATRITSLYSFVSVI GT+LG ++IKVRRTK
Sbjct: 361 IAFFINFNWYMQGDYMYTVLIVAVHESIKSATRITSLYSFVSVIVGTILGFILIKVRRTK 420

Query: 425 PFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHS 484
           PFI+FG+SCW ++FGLLVHYR            LCLLGFGAG FTY TQASIQAS K H+
Sbjct: 421 PFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQASIQASAKTHA 480

Query: 485 KMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTY 544
           +MA++T+LYLA YNI           +WTN+LP++ISKRI++ TLAA+AYGSPFTFI+TY
Sbjct: 481 RMAIVTSLYLATYNIGSAFGSSVSGAVWTNILPREISKRISDPTLAAQAYGSPFTFIITY 540

Query: 545 TWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELENTPNSD 604
           TW TPER A+V+SYRY QKILCI+GL FC  LLG AL LRNHKL   +A   LE +   +
Sbjct: 541 TWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCALMLRNHKLTDSIA---LEGSDYLE 597

Query: 605 EQGSFADNDKN 615
            + +F   +K 
Sbjct: 598 SKDAFEPKEKE 608

>YEL065W Chr5 (27657..29543) [1887 bp, 628 aa] {ON}
           SIT1Ferrioxamine B transporter, member of the ARN family
           of transporters that specifically recognize
           siderophore-iron chelates; transcription is induced
           during iron deprivation and diauxic shift; potentially
           phosphorylated by Cdc28p
          Length = 628

 Score =  791 bits (2043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/561 (66%), Positives = 448/561 (79%), Gaps = 3/561 (0%)

Query: 55  DAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSX 114
           D GV+NIE+YAE Y+ PIYRV LFFSLFL+AYAYGLDG++RYT+QA ATSSYSQHSLLS 
Sbjct: 51  DPGVHNIEIYAEMYNRPIYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110

Query: 115 XXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQ 174
                      GQI +AR SDIFGR +I+I+ ++FY++GTIIESQA N+TRFAVG CFYQ
Sbjct: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSIIFYSMGTIIESQAVNITRFAVGGCFYQ 170

Query: 175 LGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWA 234
           LG TG+IL LE+IA DFSNLNWRL A F+PALPFIINTWISGNV+ A+  +WKWGIGMWA
Sbjct: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGNVTSAIDANWKWGIGMWA 230

Query: 235 FIVPLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLL 294
           FI+PL+ IPLG C+LHMR+LA K+AKDRLK EF     + W ++ +D+  WKLD IG+LL
Sbjct: 231 FILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290

Query: 295 LCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALI 354
           +   FGC+LVPFTLAGGL+++WKTAHIIVPEVIGW V LP+++LWEIK+S+ PLTPW LI
Sbjct: 291 ITVFFGCVLVPFTLAGGLKEEWKTAHIIVPEVIGWVVVLPLYMLWEIKYSRHPLTPWDLI 350

Query: 355 KDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLG 414
           +DRGIFFAL+IAF INF WYMQGDYMYTVL+V+V+ESIKSATRITSLYSFVSVI GT+LG
Sbjct: 351 QDRGIFFALLIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410

Query: 415 LVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQA 474
            ++IKVRRTKPFIIFG+SCW ++FGLLVHYR            LCLLGFGAG FTY TQA
Sbjct: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470

Query: 475 SIQASVKYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAY 534
           SIQAS K H++MAV+T+LYLA YNI           +WTN+LPK+ISKRI++ TLAA+AY
Sbjct: 471 SIQASAKTHARMAVVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAQAY 530

Query: 535 GSPFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVAL 594
           GSPFTFI TYTW TPER A+V+SYRY QKILCI+GL FC  LLG A  LRNHKL   +A 
Sbjct: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHKLTDSIA- 589

Query: 595 SELENTPNSDEQGSFADNDKN 615
             LE   + + + +F   +K 
Sbjct: 590 --LEGNDHLESKNTFEIEEKE 608

>Smik_5.22 Chr5 (30048..31934) [1887 bp, 628 aa] {ON} YEL065W (REAL)
          Length = 628

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 373/561 (66%), Positives = 446/561 (79%), Gaps = 3/561 (0%)

Query: 55  DAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSX 114
           D GV NIE+YAE YS P+YRV LFFSLFL+AYAYGLDG++RYT+QA ATSSYSQHSLLS 
Sbjct: 51  DPGVYNIEIYAEMYSRPLYRVALFFSLFLIAYAYGLDGNIRYTFQAYATSSYSQHSLLST 110

Query: 115 XXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQ 174
                      GQI +AR SDIFGR +I+I+ ++FY+VGTIIESQA N+TRFAVG CFYQ
Sbjct: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSIMIVSVIFYSVGTIIESQAVNITRFAVGGCFYQ 170

Query: 175 LGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWA 234
           LG TG+IL LE+IA DFSNLNWRL A F+PALPFIINTWISG+V+ A+G +WKWGIGMWA
Sbjct: 171 LGLTGIILILEVIASDFSNLNWRLLALFIPALPFIINTWISGDVTSAIGTNWKWGIGMWA 230

Query: 235 FIVPLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLL 294
           FI+PL+ IPLG C+LHMR+LA K+AKDRLK EF     + W ++ +D+  WKLD IG+LL
Sbjct: 231 FILPLACIPLGICMLHMRYLARKHAKDRLKPEFEALNKLKWKSFCIDIAFWKLDIIGMLL 290

Query: 295 LCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALI 354
           +   FGC+LVPFTLAGGL+++WK+AHIIVPEVIGW V LP+++LWE+K+S+ PLTPW LI
Sbjct: 291 ITVFFGCVLVPFTLAGGLKEEWKSAHIIVPEVIGWVVVLPLYMLWEMKYSRHPLTPWDLI 350

Query: 355 KDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLG 414
           KDRGIFFAL+IAF INF WYMQGDYMYTVL+V+V+ESIKSATRITSLYSFVSVI GT+LG
Sbjct: 351 KDRGIFFALLIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITSLYSFVSVIVGTILG 410

Query: 415 LVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQA 474
            ++IKVRRTKPFIIFG+SCW ++FGLLVHYR            LCLLGFGAG FTY TQA
Sbjct: 411 FILIKVRRTKPFIIFGISCWIVSFGLLVHYRGDSGAHSGIIGSLCLLGFGAGSFTYVTQA 470

Query: 475 SIQASVKYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAY 534
           SIQAS K H++MAV+T+LYLA YNI           +WTN+LPK+ISKRI++ TLAA+AY
Sbjct: 471 SIQASAKTHARMAVVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAQAY 530

Query: 535 GSPFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVAL 594
            +PFTFI TYTW TPER A+V+SYRY QKILCI+GL FC  LLG A  LRNH+L   +A 
Sbjct: 531 SAPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCAFMLRNHELTDSIA- 589

Query: 595 SELENTPNSDEQGSFADNDKN 615
             LE   +   + SF   +K 
Sbjct: 590 --LEGNDHLKSKDSFETEEKQ 608

>Suva_5.2 Chr5 (3340..5223) [1884 bp, 627 aa] {ON} YEL065W (REAL)
          Length = 627

 Score =  785 bits (2026), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/559 (66%), Positives = 444/559 (79%), Gaps = 6/559 (1%)

Query: 55  DAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSX 114
           D GV NIE+YAEQYS P+YR  LFFS+FL+AYAYGLDG +RYT+QA ATSSYSQHSLLS 
Sbjct: 51  DPGVRNIEIYAEQYSRPLYRAGLFFSIFLIAYAYGLDGGIRYTFQAYATSSYSQHSLLST 110

Query: 115 XXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQ 174
                      GQI +AR SDIFGR +IL+I ++FY+VGTIIESQA  +TRFAVG CFYQ
Sbjct: 111 VNCIKTVIAAVGQIFFARLSDIFGRFSILVISVIFYSVGTIIESQAVTITRFAVGGCFYQ 170

Query: 175 LGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWA 234
           LG TGVIL LE+IA DFSNLNWRL A FVPALPFI+NTWISG+V+ A+G +WKWGIGMWA
Sbjct: 171 LGLTGVILILEVIASDFSNLNWRLLALFVPALPFIVNTWISGDVTSAIGTNWKWGIGMWA 230

Query: 235 FIVPLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLL 294
           FI+PL+ IPLG C+LHMR+LA K+AKD+L+ EF T  ++ W ++ +D+  WKLD IGLLL
Sbjct: 231 FILPLACIPLGLCMLHMRYLARKHAKDKLRPEFETLNNLDWKSFSIDIVFWKLDLIGLLL 290

Query: 295 LCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALI 354
           + A FGC+LVPFTLAGGL+++WK AHIIVPEVIGW VALP++++WE+K+S+ PLTPW LI
Sbjct: 291 VTAFFGCVLVPFTLAGGLKEEWKAAHIIVPEVIGWVVALPLYMVWEVKYSRHPLTPWDLI 350

Query: 355 KDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLG 414
           KDRG+ FAL IAF INF WYMQGDYMYTVL+V+V+ESIKSATRIT+LYSFVSVI GT+LG
Sbjct: 351 KDRGVLFALFIAFFINFNWYMQGDYMYTVLVVAVHESIKSATRITALYSFVSVIVGTILG 410

Query: 415 LVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQA 474
            ++IKVRRTKPFI+FG+SCW ++FGLLVHYR            LCLLGFGAG FTY TQA
Sbjct: 411 FILIKVRRTKPFILFGISCWIVSFGLLVHYRGDSGAHAGIIGSLCLLGFGAGSFTYVTQA 470

Query: 475 SIQASVKYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAY 534
           SIQAS   H++MA++T+LYLA YNI           +WTN+LPK+ISKRI++ TLAAEAY
Sbjct: 471 SIQASAGTHARMAIVTSLYLATYNIGSAFGSSVSGAVWTNILPKEISKRISDPTLAAEAY 530

Query: 535 GSPFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVAL 594
           GSPFTFI TYTW TPER A+V+SYRY QKILCI+GL FC  LLG A  LRNHKL   +AL
Sbjct: 531 GSPFTFITTYTWGTPERIALVMSYRYVQKILCIIGLVFCFPLLGCACMLRNHKLTDSIAL 590

Query: 595 SELENTPNSDEQGSFADND 613
                   +D   S  DN+
Sbjct: 591 E------GNDHLESKNDNE 603

>Kwal_23.5241 s23 (1071768..1073543) [1776 bp, 591 aa] {ON} YEL065W
           (SIT1) - Ferrioxamine B permease [contig 8] FULL
          Length = 591

 Score =  774 bits (1999), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 362/567 (63%), Positives = 444/567 (78%), Gaps = 2/567 (0%)

Query: 53  HKDAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLL 112
            KDAGVNNIEVYA+QYS   YR++LFFSLFLVAYAYGLDG VRY +QA AT+SY  HSLL
Sbjct: 22  RKDAGVNNIEVYADQYSHIGYRILLFFSLFLVAYAYGLDGMVRYNFQAYATNSYGSHSLL 81

Query: 113 SXXXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCF 172
           S            GQ+C+ARA+DIFGR++I+I+ ++FY VGTII+SQAT V+++A G+C 
Sbjct: 82  STVNCIKAVIAAAGQLCFARAADIFGRISIIIVSILFYVVGTIIDSQATTVSKYAAGACI 141

Query: 173 YQLGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGM 232
           YQLGYTG+IL LE+IAMDFSNLNWRL ASFVPA+PFIINTWISG+V  AVG +WKWGIGM
Sbjct: 142 YQLGYTGIILILEIIAMDFSNLNWRLLASFVPAIPFIINTWISGDVVSAVGANWKWGIGM 201

Query: 233 WAFIVPLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGL 292
           WAFI PLSA+PL  C+ HMR+LA + A DRL +E   Y+ M W  Y+ +VF W+LD +GL
Sbjct: 202 WAFIFPLSALPLLGCMFHMRYLARRRASDRLVTEVSLYKHMSWSTYLTEVFFWRLDAVGL 261

Query: 293 LLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWA 352
           +++C  FGCIL+PFTLAG L+DKW+TA IIVPEVIGWCVALP+FLLWE+KF+K PL PW 
Sbjct: 262 IMVCVVFGCILIPFTLAGSLKDKWQTAEIIVPEVIGWCVALPLFLLWEMKFAKHPLVPWN 321

Query: 353 LIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTL 412
           +IKDRGI+ AL+IA HINFIWYMQG +MYTVLI++VNES+KSATRITSLYSFVSV+TG  
Sbjct: 322 VIKDRGIWSALIIAIHINFIWYMQGSFMYTVLIIAVNESVKSATRITSLYSFVSVLTGLG 381

Query: 413 LGLVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTT 472
           LG VI  +R+TK FI+FG+ CW ++FGLL+HYR             CLLGFGAGFFTYTT
Sbjct: 382 LGFVIAYIRKTKKFIMFGIGCWVVSFGLLIHYRGDSSSHSGIIGAQCLLGFGAGFFTYTT 441

Query: 473 QASIQASVKYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAE 532
           Q SIQAS K H  MAVITALYL+ YNI           IWTN+LP+++ KRI + T  A 
Sbjct: 442 QTSIQASAKTHQDMAVITALYLSFYNIGSALGSSVSGAIWTNILPRELRKRITDPTTYAL 501

Query: 533 AYGSPFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVV 592
           AYGSPFTFI+TY W TPER+AVV SY+Y QK+LC+VG+CFC+TL+ +ALFLR+H+L   V
Sbjct: 502 AYGSPFTFIITYVWGTPEREAVVKSYQYVQKLLCVVGICFCATLIASALFLRDHRLGDSV 561

Query: 593 ALSELEN--TPNSDEQGSFADNDKNVN 617
           AL + +   + NSD +G   D+ ++ N
Sbjct: 562 ALEDEDEKFSINSDAEGELQDSTESRN 588

>KLTH0A01562g Chr1 complement(138389..140236) [1848 bp, 615 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 615

 Score =  766 bits (1978), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/603 (63%), Positives = 447/603 (74%), Gaps = 3/603 (0%)

Query: 16  TVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPIYRV 75
           ++L        N+     L+ +     +   +      KDAGVNNIEVYA QYS   YRV
Sbjct: 5   SILLHSGKNSRNKLKKMSLEGHPAKDAKDHAEQILARRKDAGVNNIEVYAAQYSHFAYRV 64

Query: 76  MLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASD 135
            LFFSLFLVAYAYGLDG VR + QA ATSSY  HSLL+            GQIC+ARASD
Sbjct: 65  ALFFSLFLVAYAYGLDGMVRSSLQAYATSSYGSHSLLATINCVKAVIAAAGQICFARASD 124

Query: 136 IFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLN 195
           IFGRMTIL + +V YAVGTII+SQATN+TR+A G+C YQLGYTG+IL LE+IAMDFSNLN
Sbjct: 125 IFGRMTILALAVVLYAVGTIIDSQATNITRYAAGACIYQLGYTGIILILEIIAMDFSNLN 184

Query: 196 WRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGCCLLHMRWLA 255
           WRL ASFVPALPFIINTWISGN   A+G +WKWGIGMWAFIVPLS +PL  C+LHMR+LA
Sbjct: 185 WRLMASFVPALPFIINTWISGNALEALGMNWKWGIGMWAFIVPLSCVPLFACILHMRFLA 244

Query: 256 HKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDK 315
           HKNAKD+L+SE   Y+ M W  Y+V+VF W+LD +GLLL+C  FGCILVPFTLAG LQ K
Sbjct: 245 HKNAKDQLESEVLLYKHMPWSQYLVEVFFWRLDLLGLLLVCVVFGCILVPFTLAGSLQSK 304

Query: 316 WKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYM 375
           WK A IIVPEVIGWCVALP+FLLWE K+S+ PL PW+L+KDRGI+ AL+IA HINF+WYM
Sbjct: 305 WKRAEIIVPEVIGWCVALPLFLLWEGKYSRHPLVPWSLVKDRGIWSALIIAIHINFVWYM 364

Query: 376 QGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWF 435
           QGDYMYTVL+V+VNE+ KSA RITSLYSFVSVITG LLG VI+  RRTK FI+FG++CWF
Sbjct: 365 QGDYMYTVLMVAVNETAKSAARITSLYSFVSVITGFLLGGVIVYARRTKKFILFGIACWF 424

Query: 436 IAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALYLA 495
           +AFGLLVHYR            LCLLGFGAGFFTYTTQ SIQAS K H  MAVITALYL+
Sbjct: 425 VAFGLLVHYRGDSSSHSGIVGSLCLLGFGAGFFTYTTQTSIQASTKSHQDMAVITALYLS 484

Query: 496 MYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPERQAVV 555
            YNI           IWTN+LP+++ KRI +      AYGSPF FI  Y W TPER  VV
Sbjct: 485 HYNIGSALGASISGAIWTNILPRELRKRITDVATYTLAYGSPFVFIEEYLWGTPERMEVV 544

Query: 556 VSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELE--NTPNSDE-QGSFADN 612
            +YR  Q+IL IVGLCFC TLL +A FLR+H+LE+ VAL +++  ++  SDE +    DN
Sbjct: 545 AAYRVVQRILSIVGLCFCVTLLLSAFFLRDHRLENAVALEDVDEKSSRKSDELEARIEDN 604

Query: 613 DKN 615
            + 
Sbjct: 605 TET 607

>Kwal_23.4853 s23 complement(895045..896856) [1812 bp, 603 aa] {ON}
           YEL065W (SIT1) - Ferrioxamine B permease [contig 5] FULL
          Length = 603

 Score =  689 bits (1777), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/565 (58%), Positives = 416/565 (73%), Gaps = 1/565 (0%)

Query: 45  DLKNYDLYHKDAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATS 104
           D + +    KDAGV NI+VYA+QY++  YRV LFFSLFLVAY+Y LDG VR   +  AT 
Sbjct: 17  DTQEFLHRRKDAGVKNIKVYADQYNNVFYRVALFFSLFLVAYSYRLDGLVRGKLETYATD 76

Query: 105 SYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVT 164
           SY  HSLLS            G I YARASDIFGRMT+L I ++ Y VGTI+E Q+  V+
Sbjct: 77  SYGHHSLLSTVNCIKTVIGAAGLIAYARASDIFGRMTMLAIAVLLYVVGTIVECQSNTVS 136

Query: 165 RFAVGSCFYQLGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQ 224
           +FA G+  +QLG  G++L L++IAMDFS LNWR+ A +VPALP IINTW+SG++  A+  
Sbjct: 137 KFATGASIFQLGKAGIVLLLQVIAMDFSTLNWRMVALYVPALPIIINTWVSGDIIKAING 196

Query: 225 HWKWGIGMWAFIVPLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFL 284
           +WKWGIGMWAFI+PL+ +PL  CL+HMR+LAHKN KD+L +E+  Y++  W AY+ +VF 
Sbjct: 197 NWKWGIGMWAFILPLACLPLFGCLIHMRYLAHKNCKDQLVNEWELYKNTSWPAYLKEVFF 256

Query: 285 WKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFS 344
           W+LD +GL+L+ A  GC+L+PFTLAGGL DKWK+AHIIVPEVIGWCVA P+F+LWE K++
Sbjct: 257 WRLDILGLILITAGLGCVLIPFTLAGGLSDKWKSAHIIVPEVIGWCVAFPLFVLWEKKYA 316

Query: 345 KVPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSF 404
           + PLTPW L+KDRG+  A++I FHI+F+ YMQ DYMYTVL+V+VNES+KSA RIT+L++F
Sbjct: 317 RHPLTPWRLLKDRGVISAIIIGFHIHFVVYMQADYMYTVLVVAVNESVKSAQRITTLFNF 376

Query: 405 VSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFG 464
           V++ITGTLLG VI  V+RTK FI+FG+  WF+AFGLL+ YR            LCLLGFG
Sbjct: 377 VTIITGTLLGFVIAYVKRTKKFILFGICIWFVAFGLLIRYRGDSSSHSGIVGALCLLGFG 436

Query: 465 AGFFTYTTQASIQASVKYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRI 524
            GFF Y TQ S+ AS   H  MAVIT+LYLA YN+           IWTNVLPKQ+ KRI
Sbjct: 437 GGFFNYATQVSLHASTSSHQDMAVITSLYLASYNVGSAVASAVAGAIWTNVLPKQLHKRI 496

Query: 525 ANETLAAEAYGSPFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLR 584
           ++ ++A  AY SPF FI  Y W +PER AV+ +Y+  QKILC VGLCFC TLL AALFLR
Sbjct: 497 SDASIANIAYSSPFKFIKKYKWGSPERIAVMQAYQVVQKILCTVGLCFCVTLLVAALFLR 556

Query: 585 NHKLESVVALSELENT-PNSDEQGS 608
           + KLESVVAL + E   P+ + Q S
Sbjct: 557 DKKLESVVALEDAEEKEPSINSQHS 581

>KLTH0G09504g Chr7 complement(792202..794076) [1875 bp, 624 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 624

 Score =  684 bits (1766), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 329/585 (56%), Positives = 415/585 (70%), Gaps = 3/585 (0%)

Query: 29  FNSSQLDSNQPDSNQPDLKNYDLY--HKDAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAY 86
           FN    +    D+ +   +  +     KD GV NIEVYA QY    YRV LFFSLFL+AY
Sbjct: 8   FNKGPEEKEAGDAMERSRRADEALRRQKDVGVKNIEVYAAQYDHVAYRVALFFSLFLIAY 67

Query: 87  AYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGRMTILIIG 146
           AY LDG VR   +A AT SY  HSLLS            G + YARASD+FGRM +L I 
Sbjct: 68  AYRLDGLVRSKLEAYATDSYGNHSLLSTVNCIKTVMAAGGMVAYARASDMFGRMEMLAIS 127

Query: 147 LVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWRLFASFVPAL 206
           +V   VGTI+E Q+  V++FA G+C YQLG  G+ L L++IA+DFSNLNWR+ A +VPAL
Sbjct: 128 IVLVVVGTIVECQSDTVSKFATGACLYQLGKAGLALILQVIAVDFSNLNWRMVALYVPAL 187

Query: 207 PFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGCCLLHMRWLAHKNAKDRLKSE 266
           P IINTW+SG+V  A+G  W+WGIGMWAFI+PLS IPL CCL+HMR+LAHK+A ++L  +
Sbjct: 188 PTIINTWVSGDVISAIGSDWEWGIGMWAFIIPLSCIPLFCCLVHMRYLAHKHAPEQLGKQ 247

Query: 267 FRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEV 326
            + Y    W  Y+++VF W+LD +GL+L+    GC+LVPFTLAGGL DKW+TA IIVPEV
Sbjct: 248 RQLYSMASWSEYLIEVFFWRLDSVGLILVVGALGCVLVPFTLAGGLSDKWRTAQIIVPEV 307

Query: 327 IGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIV 386
           IGWCVALP+F+LWE KF++ PLTP +++KDRG+  ALVIAFHI+F  YMQ DYMYTVL++
Sbjct: 308 IGWCVALPLFVLWEAKFARFPLTPRSVLKDRGVIAALVIAFHIHFCVYMQADYMYTVLVI 367

Query: 387 SVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRX 446
           +V+ES+K+A RIT+L++FVS+ITGTLLG VI+ V+RTK FI+FGV  WF+AFGLLVH+R 
Sbjct: 368 AVHESVKAAQRITTLFNFVSIITGTLLGFVIVYVKRTKKFILFGVCVWFVAFGLLVHFRG 427

Query: 447 XXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALYLAMYNIXXXXXXX 506
                      LCLLGFG GFF Y+ Q S+QAS   H  +AV+T+LYLA YNI       
Sbjct: 428 DESSHSGIIGALCLLGFGGGFFNYSAQVSMQASTAAHQDLAVVTSLYLACYNIGSAFASA 487

Query: 507 XXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPERQAVVVSYRYTQKILC 566
               IWTNVLPK+++KRI  + +A  AY SPF FI+ Y W TP+R AVV +Y+  Q+ILC
Sbjct: 488 ISGAIWTNVLPKELNKRITEKQVATLAYSSPFKFIIKYKWGTPQRVAVVHAYQKVQRILC 547

Query: 567 IVGLCFCSTLLGAALFLRNHKLESVVALSELENTPNSDEQGSFAD 611
           IV LCFC TLL AA  LR+ KL  VVAL ELE+  +S+   S  D
Sbjct: 548 IVPLCFCVTLLIAAFLLRDKKLSEVVALGELEHG-HSESASSTGD 591

>Kpol_416.6 s416 (26742..28535) [1794 bp, 597 aa] {ON}
           (26742..28535) [1794 nt, 598 aa]
          Length = 597

 Score =  647 bits (1669), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 322/603 (53%), Positives = 413/603 (68%), Gaps = 13/603 (2%)

Query: 5   SDSKFDGKINETVLQEQTTEDSNQFNSSQLDSNQPD-SNQPDLKNYDLYHKDAGVNNIEV 63
           +D   + K NET+  E   E S+    S + +N  +   +P L+      + AGV N EV
Sbjct: 3   TDKDENIKQNETIHSE---EFSSNITVSSITTNSLNGEKEPHLE------ESAGVYNSEV 53

Query: 64  YAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXX 123
           YA+ YSSP  R ++F  LF + YAYGLD  +R  YQ  ATSSY QHSLLS          
Sbjct: 54  YAKYYSSPTRRSIVFLCLFFICYAYGLDNKLRSPYQTLATSSYKQHSLLSTVNAIKSVIS 113

Query: 124 XXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILS 183
             GQI +ARASD+FGR TILI+ ++FY VGTI+ESQA +V++FA G+C +QLGY GV++ 
Sbjct: 114 AAGQIWFARASDLFGRGTILIVAVMFYVVGTIVESQAVDVSKFAAGACLFQLGYDGVVMM 173

Query: 184 LELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIP 243
           ++++  DFSNLNWR+ A   P LP +INTW+SG+++ AV ++WKWGIGMWAFI PLS IP
Sbjct: 174 VQILVSDFSNLNWRVTAVAFPVLPNVINTWVSGDIASAVDENWKWGIGMWAFIFPLSCIP 233

Query: 244 LGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCIL 303
            G  LLHM++LA KN  D LKS F    D+ W  Y+ ++FLWKLDFIGLLL  A FG +L
Sbjct: 234 FGILLLHMKYLARKN-NDTLKSSFDKPEDITWKQYLTEIFLWKLDFIGLLLAVAFFGLVL 292

Query: 304 VPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFAL 363
           VPFTLAGGL  KWKTA IIVPEV+GW VA P FL WEIKF+K PLTPW  +KDRG+F AL
Sbjct: 293 VPFTLAGGLNKKWKTARIIVPEVLGWVVAFPAFLTWEIKFAKYPLTPWKTVKDRGVFSAL 352

Query: 364 VIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRT 423
           +IA  +   +YMQ  YMYT+L+V+VN++ KSATRI SL++FV+ ++GTLLGLVI+KVRRT
Sbjct: 353 IIAIFLQTAFYMQKTYMYTILLVAVNQTKKSATRINSLFTFVTALSGTLLGLVIVKVRRT 412

Query: 424 KPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYH 483
           K FI FG++ WF++FGLL  Y             LCLLGFG GF  Y T+AS+QAS   H
Sbjct: 413 KEFIFFGIAVWFLSFGLLERYTGGTNAYAGIIAALCLLGFGNGFIKYPTKASMQASALTH 472

Query: 484 SKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILT 543
             MA+IT+L++A+  I           IWTNVLP +I K + N TLA  AY SP  FIL 
Sbjct: 473 EMMAIITSLFMAISTIGTSVGSSVAGAIWTNVLPDKIEKGLNNSTLANFAYNSPTKFILQ 532

Query: 544 YTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELENTPNS 603
           Y W++PERQ VV +Y++ +KIL IVGLCF   LLG A  LRN +LE  VAL ++E  P +
Sbjct: 533 YNWESPERQIVVNAYKHVEKILIIVGLCFLVPLLGGAFLLRNQRLEDAVALDKVE--PKN 590

Query: 604 DEQ 606
           +++
Sbjct: 591 EKK 593

>Kpol_416.5 s416 (23208..25031) [1824 bp, 607 aa] {ON}
           (23208..25031) [1824 nt, 608 aa]
          Length = 607

 Score =  605 bits (1561), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 307/594 (51%), Positives = 407/594 (68%), Gaps = 4/594 (0%)

Query: 15  ETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPIYR 74
           E  ++    E++    S +L S+  +S+     + D      GV+N+E+YA+ YS+P+ R
Sbjct: 2   EINIKHNQKENTEFEYSEELPSSTSESDHIS-SHSDAESDKFGVHNVEIYAKYYSTPVKR 60

Query: 75  VMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARAS 134
            ++FFSLF +AYAYGLD SVR TYQ  ATSSY+QHSLLS             QI +AR++
Sbjct: 61  FLIFFSLFTIAYAYGLDNSVRGTYQTLATSSYNQHSLLSTVSCIKAVISAAAQIWFARSA 120

Query: 135 DIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNL 194
           D+FGR TIL+I +VFY VGT++ESQA +V++FA G+C Y +G++ ++L  E+   DFSNL
Sbjct: 121 DMFGRTTILMISIVFYVVGTVVESQAVDVSKFAAGACLYAVGHSAIVLFSEVYVADFSNL 180

Query: 195 NWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGCCLLHMRWL 254
           NWR+ A+  P LP +INTWISG+++ A+ ++WKWGIGMWAFI PLS IP+G C+LHM++L
Sbjct: 181 NWRVTAAAAPLLPNVINTWISGDITAAIDENWKWGIGMWAFIFPLSCIPMGACILHMKYL 240

Query: 255 AHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQD 314
           A KN KD LK  F+      W  Y+VDVF WKLD +GLLLL A FG IL+PFTLAGG + 
Sbjct: 241 AKKN-KDDLKVAFKKPEHYTWSQYLVDVFFWKLDLVGLLLLVAIFGMILIPFTLAGGEEK 299

Query: 315 KWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIWY 374
            W TA IIVPEV+GW  ALP+FL+WEIKF++ PLTP   +K+RGI  ALV+   + F + 
Sbjct: 300 VWSTARIIVPEVLGWAFALPLFLVWEIKFARYPLTPKDALKNRGIVSALVLVLFLQFAYQ 359

Query: 375 MQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCW 434
           MQ  Y+YTVL+V+V+ES KSATRI  L+SFVSVITG L G V+ KVRRTK FI FG+  W
Sbjct: 360 MQSTYLYTVLLVAVDESKKSATRINKLFSFVSVITGFLSGFVVAKVRRTKEFIFFGIGVW 419

Query: 435 FIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALYL 494
           FI+FGL++ Y              C+LGFG GF  +  +ASIQAS   H  MAV+T+L+L
Sbjct: 420 FISFGLMIRYTGGLDSHVGIIVARCILGFGNGFLKFPARASIQASAYSHEMMAVMTSLFL 479

Query: 495 AMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPERQAV 554
           A+ +I           IWTNVLP +IS+ I NETLA  AYGSP  FIL Y WDTPERQAV
Sbjct: 480 AVSSIGSAFGDAVAGSIWTNVLPGKISEGITNETLADYAYGSPTKFILKYKWDTPERQAV 539

Query: 555 VVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELE--NTPNSDEQ 606
           V +Y+   ++L IVG+C    LL +A FL+N +LE VV+  + +  N+ N+++ 
Sbjct: 540 VEAYKVIGRLLNIVGICLLVPLLISAFFLKNRRLEDVVSFDKFDKMNSENAEDS 593

>TDEL0B00140 Chr2 (25633..27531) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score =  602 bits (1551), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 311/611 (50%), Positives = 419/611 (68%), Gaps = 6/611 (0%)

Query: 1   MTSSSDSKFDGKINETVLQE--QTTEDSNQFNSSQLDSNQPDS--NQPDLKNYDLYHKDA 56
           M S  ++     ++ + L+E  +  +     ++S  +SN PD+  ++ D      Y K +
Sbjct: 1   MASLDETSTATPVDISDLEEGLKALDSGKDGHTSDSNSNVPDAYEHESDCVGDKKYIKGS 60

Query: 57  GVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXX 116
           GV NIE+Y +QY  PIY+VML+FS+FLVAY Y LD  VR+TYQ Q TS +   + L    
Sbjct: 61  GVINIELYKQQYHKPIYKVMLYFSIFLVAYVYSLDSLVRFTYQYQTTSKFRDKNQLRTVN 120

Query: 117 XXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLG 176
                    GQ  +AR SDIFGR T+L   ++ Y +GTII+ +AT++++F+ G+  YQLG
Sbjct: 121 CIKTVMGTAGQFGFARCSDIFGRTTVLNFSIILYIIGTIIQCKATDISKFSAGTILYQLG 180

Query: 177 YTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFI 236
             G+ + L +IA DFS+LNWRLFASFVPALPF+IN WI G ++  +G  W+WGIGM+AFI
Sbjct: 181 LIGIQIMLGVIASDFSDLNWRLFASFVPALPFVINIWICGFITQLIGDRWQWGIGMFAFI 240

Query: 237 VPLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLC 296
           +P + IPL  CLLHMR+LA+KN + ++++EFR YR + +  YIVD+F W+LD +G  LLC
Sbjct: 241 MPCACIPLAFCLLHMRYLAYKNCRGKVQNEFRMYRVLTFRDYIVDIFFWRLDLVGFGLLC 300

Query: 297 ATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKD 356
           A FGCIL+P  LAGG  + W+   IIVPEV+GW V LPIFL WE K +K PL  W  I+D
Sbjct: 301 ALFGCILIPLVLAGGSSNHWRNFRIIVPEVVGWVVVLPIFLTWEAKGAKHPLLTWDFIED 360

Query: 357 RGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLV 416
           RGI  AL+IAF+INF++++ GDY++TVL++++++S+ ++TRITS YSFV +I GTL+GLV
Sbjct: 361 RGILAALIIAFYINFVYHLLGDYLFTVLMITLDQSVLASTRITSSYSFVCIICGTLIGLV 420

Query: 417 IIKVRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASI 476
           II+ RRTKPFIIFG+ CWF+A GLLVH+             LCLLG GAGFFTYTTQASI
Sbjct: 421 IIRARRTKPFIIFGIGCWFLALGLLVHFFGNRPFMPGVTGSLCLLGLGAGFFTYTTQASI 480

Query: 477 QASVKYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGS 536
           QA++K H+KMAV+TALYL++Y+I           IWTN+LP++I  R  N + A  AY S
Sbjct: 481 QAAIKTHAKMAVVTALYLSIYSIGSAVGSAISGAIWTNLLPRKIF-RTMNHSDATAAYDS 539

Query: 537 PFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSE 596
           P  FIL   W +P R  +  +Y Y QK+LC+V LCFC  LL AALFLRNHKL+S VAL  
Sbjct: 540 PQLFILNNPWGSPARNGLNEAYSYVQKMLCVVALCFCVPLLAAALFLRNHKLQSTVALEN 599

Query: 597 L-ENTPNSDEQ 606
           + E     DE+
Sbjct: 600 VDEKQVKEDER 610

>NCAS0A11500 Chr1 complement(2274436..2276280) [1845 bp, 614 aa]
           {ON} 
          Length = 614

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/589 (49%), Positives = 393/589 (66%), Gaps = 8/589 (1%)

Query: 30  NSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYG 89
            +S +  N+  S+         Y +++GV+N E+Y + YS PI R+M+F SLFL+A+AYG
Sbjct: 30  KASAIKINELSSSAASSTIGSEYIENSGVHNAEIYCKYYSHPIKRIMVFSSLFLIAFAYG 89

Query: 90  LDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGRMTILIIGLVF 149
           LD SVR TYQ  ATSSYSQHSLLS             Q+ +AR++D+FGR TIL I ++F
Sbjct: 90  LDNSVRTTYQTMATSSYSQHSLLSTVTCIKKVISAAAQLWFARSADMFGRPTILTISIIF 149

Query: 150 YAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWRLFASFVPALPFI 209
           Y +GTIIE +A +V+R+A G+C + LG+ G++L  EL   DFSNLNWR+ A+    LP +
Sbjct: 150 YVIGTIIECRAFDVSRYAAGACIFSLGHAGIVLVSELYVADFSNLNWRVTAAAAQVLPNV 209

Query: 210 INTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRT 269
           I TWISGN++GA+ ++W+WGIGMWAFI PLS +PL  C++HMR+LA KN  + LK  F+ 
Sbjct: 210 ITTWISGNITGAIDKNWEWGIGMWAFIFPLSCVPLIICIIHMRYLARKN-NENLKVVFQK 268

Query: 270 YRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGW 329
              M W  Y +D+F WKLD IGL+LL A F  ILVPFTLAG L   WK+  IIVPEV+GW
Sbjct: 269 PNYMTWKEYCIDIFFWKLDIIGLILLVAFFSLILVPFTLAGSLT--WKSPKIIVPEVLGW 326

Query: 330 CVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVN 389
            +A+P++L+WE+K+++ PLTPW  IKDRGI+  L+I     F +YMQ  YM TVL+V+V 
Sbjct: 327 VLAIPLYLIWELKYARYPLTPWNSIKDRGIWAPLIINLFQEFAYYMQNTYMLTVLLVAVG 386

Query: 390 ESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRXXXX 449
           +S KSATRI   YSFV V+T   LG V+ KVRRTK FI  G+  WF+AFGLL HY     
Sbjct: 387 QSKKSATRIIKFYSFVGVLTAFFLGFVVAKVRRTKEFIALGIGIWFVAFGLLEHYEGGLG 446

Query: 450 XXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALYLAMYNIXXXXXXXXXX 509
                   +C+LGFG GF  +  +ASIQA+   H+ M + T+L+ A+ +I          
Sbjct: 447 ARAGIIAAICILGFGNGFLKFPCRASIQAAANSHAMMGIATSLFQAVGSIGTAFGSAVAG 506

Query: 510 XIWTNVLPKQISKRIANE-TLAAEAYGSPFTFILTYTWDTPERQAVVVSYRYTQKILCIV 568
            IW+NVLP +I+KRI N  TLA  AYGSP  FI  Y W+T ERQAVV +Y+  ++++ IV
Sbjct: 507 GIWSNVLPGEINKRITNNSTLATYAYGSPTKFIKQYGWETTERQAVVSAYKVVERLMAIV 566

Query: 569 GLCFCSTLLGAALFLRNHKLESVVALSELENTPNSDEQGSFADNDKNVN 617
           GLC    +L A++FLRN +LE VV+  +L+ T   DE+ +  D+++ V 
Sbjct: 567 GLCLLVPMLVASIFLRNRRLEDVVSFDKLDET--FDEKST--DDEEVVR 611

>Kpol_513.33 s513 complement(95274..97154) [1881 bp, 626 aa] {ON}
           complement(95274..97154) [1881 nt, 627 aa]
          Length = 626

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 279/559 (49%), Positives = 373/559 (66%), Gaps = 4/559 (0%)

Query: 57  GVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXX 116
             +N  +Y + YS+P+   +L+FSLFL+AYAY L   VR TYQ  ATSSYS+HSLL+   
Sbjct: 38  AAHNARIYVKYYSTPLRVTILYFSLFLLAYAYNLHKDVRGTYQTLATSSYSKHSLLATVQ 97

Query: 117 XXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLG 176
                    GQI YARASDIFGR  ILI+ ++FY +GT+IESQAT+++++A GSC Y LG
Sbjct: 98  CINQVISAAGQIWYARASDIFGRTPILILSILFYFIGTLIESQATDISKYAAGSCIYALG 157

Query: 177 YTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFI 236
           Y G +L  +++  D+S L WRL +S V  LP IINTW+ GN++  VG  W+WG GMWAFI
Sbjct: 158 YAGSVLVTQVLVSDYSTLKWRLVSSTVLFLPNIINTWVGGNITEDVGNRWQWGFGMWAFI 217

Query: 237 VPLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLC 296
            PL++IPL CCL HM++LA KN +D +K      R + W  ++ D+F WKLD +GL+LL 
Sbjct: 218 FPLASIPLLCCLAHMKYLAIKNKED-VKLTISKPRSISWARHLYDIFFWKLDMLGLILLV 276

Query: 297 ATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKD 356
           A F  ILVP TLA GL + W +A  IVPEV+GW +ALP+FL WE+KF+  P+TP  LIKD
Sbjct: 277 AFFALILVPLTLAKGLHEGWGSAKFIVPEVLGWALALPLFLTWELKFASNPITPLDLIKD 336

Query: 357 RGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLV 416
           RGI+  + ++  + F++ +   Y+YTVL+V+VNES KSATRITSL++FVSV+T   LG V
Sbjct: 337 RGIYGGIGVSLFLEFVYDIGSTYLYTVLVVAVNESTKSATRITSLFTFVSVLTAFFLGFV 396

Query: 417 IIKVRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASI 476
           ++KVRRTK FIIFG++ W+IA+GL  HYR            +C+ GFG GF  +  + S 
Sbjct: 397 VVKVRRTKEFIIFGIAMWYIAYGLFEHYRGGAESHAGIIAAVCVHGFGNGFIKFPVRVST 456

Query: 477 QASVKYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGS 536
           QAS K H ++A+ T+LYLA  +I           +WTN+LP QI   I N TLA  AY S
Sbjct: 457 QASAKTHDRLAIATSLYLAAGDIGMAFGSATAGAMWTNILPAQIDMVIQNSTLAKIAYES 516

Query: 537 PFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSE 596
           P  FI T+ WD+PERQA+VV+YRY Q++L IV LC    LL ++ FLRN  L   VA  +
Sbjct: 517 PIKFIRTHKWDSPERQALVVAYRYIQRLLMIVALCLIIPLLLSSFFLRNRALTDTVAFEQ 576

Query: 597 LE---NTPNSDEQGSFADN 612
            +    + +SD + S  DN
Sbjct: 577 TDIPKESDSSDLENSKIDN 595

>TPHA0G03780 Chr7 complement(800134..801972) [1839 bp, 612 aa] {ON} 
          Length = 612

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/550 (51%), Positives = 365/550 (66%), Gaps = 1/550 (0%)

Query: 57  GVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXX 116
           GV+N ++Y + Y+ P  R+M+FFSLFL+ YAYGLD   R TY   ATSSY +HSL+S   
Sbjct: 48  GVHNAKIYGKYYTEPYQRIMIFFSLFLICYAYGLDKKTRTTYVTLATSSYKEHSLMSTVT 107

Query: 117 XXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLG 176
                    GQI +ARASDIFGR  I  + ++FY +GT+IESQAT ++R+A G C Y LG
Sbjct: 108 CITKVISAAGQIWFARASDIFGRKLIFGLSVIFYVIGTVIESQATEISRYAGGECLYGLG 167

Query: 177 YTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFI 236
           + G++L+ EL A DFSNLNWR+ A+  P LP IINTW+SGN++  V ++WKWGIGMWAFI
Sbjct: 168 HAGIVLTTELYAADFSNLNWRVVAAAAPMLPNIINTWVSGNITADVDENWKWGIGMWAFI 227

Query: 237 VPLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLC 296
            P+S +PL  CLLHMR+ A KN  + LK  F    +M +  Y+VDVF WK D IGL+LL 
Sbjct: 228 FPISCLPLIGCLLHMRYKAQKN-NEELKPVFVKPSNMSYKEYLVDVFFWKSDIIGLILLV 286

Query: 297 ATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKD 356
             FG +LVP TLAGGL  KW  A IIVPEV+GW +ALP+++ WE KF+K P+     ++D
Sbjct: 287 GVFGLVLVPITLAGGLNKKWNEAQIIVPEVLGWTLALPLYVFWENKFAKYPIIKLETVRD 346

Query: 357 RGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLV 416
            GI+ AL I+  I+F +YM   Y+ T L+V+VNES KSATRI SL +FV+VITG  LGL 
Sbjct: 347 SGIWSALSISLFIDFCFYMHETYLVTFLLVAVNESKKSATRINSLSTFVTVITGFFLGLA 406

Query: 417 IIKVRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASI 476
           I+++RRTK  I+FG   WF+A GL + Y             +CLLGFG GF  +  +ASI
Sbjct: 407 IVRIRRTKISIVFGTLVWFVAHGLFIEYNGGLRSHSGLIGAICLLGFGNGFIRFPVRASI 466

Query: 477 QASVKYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGS 536
           Q SV  H K+A++T+L+LA+ +I           IW+NVLP QI  RI+N T+AA AY S
Sbjct: 467 QVSVGTHEKLAIVTSLFLAVGSIGTAIGSAVAGAIWSNVLPGQIESRISNATIAASAYSS 526

Query: 537 PFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSE 596
           P TFI  Y W T  R AVV +Y Y  KIL I GL     LL +ALFLR+ KLESV+A  E
Sbjct: 527 PTTFIKKYKWGTEYRTAVVSAYGYVWKILNITGLVLVLPLLISALFLRDRKLESVLAFDE 586

Query: 597 LENTPNSDEQ 606
           + +T    E 
Sbjct: 587 VTDTEGYSEN 596

>NDAI0A02050 Chr1 complement(456678..458531) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  551 bits (1421), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/584 (47%), Positives = 381/584 (65%), Gaps = 11/584 (1%)

Query: 18  LQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPIYRVML 77
           L  +TT+D  + +  ++DS    S +    NYD      GV NIEVY+E YS+   R++ 
Sbjct: 11  LDPKTTKD--EIHEQEIDS--VSSTEESQINYD-----TGVINIEVYSEYYSTTQRRLLF 61

Query: 78  FFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIF 137
           FFS+FL  Y Y LD  VR T+Q +ATSSY  HSL+S            GQI YARA+DIF
Sbjct: 62  FFSIFLTTYCYTLDKRVRSTFQTEATSSYKNHSLMSTVTCITTVISAAGQIAYARAADIF 121

Query: 138 GRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWR 197
           GR +++   + FY +GT++ESQATN+TR+AVG+CFY LG+  ++L+LE++A DFSNLN+R
Sbjct: 122 GRTSLVFTAIFFYVIGTVVESQATNITRYAVGACFYSLGHAAIVLALEVLAADFSNLNYR 181

Query: 198 LFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGCCLLHMRWLA-H 256
           + AS  P LP +INTWISGN++  +G HW+WGIGMWA I P+  IPL  CL HMR+LA +
Sbjct: 182 ILASAAPMLPNVINTWISGNITSDIGDHWQWGIGMWAIIFPVCCIPLLFCLFHMRYLAQY 241

Query: 257 KNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKW 316
           K+ +  L+S      +M    Y +DVF W+LD +GLLL    F C+L+PFTLA    DKW
Sbjct: 242 KHNRRELRSFSTIPPNMTRMEYFIDVFFWRLDILGLLLGVIFFACVLIPFTLAAKATDKW 301

Query: 317 KTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYMQ 376
           K+A IIVPEVIGW VALP+++ WE KF+K PLTPW L+KDRG++  L+IA  ++F +Y+Q
Sbjct: 302 KSASIIVPEVIGWLVALPLYIFWEWKFAKFPLTPWNLVKDRGVYGGLLIALFLDFAYYVQ 361

Query: 377 GDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGL-VIIKVRRTKPFIIFGVSCWF 435
             Y YTVL+VS + ++ +ATR  ++++FV VIT  LLG+ V  K+RRTK FI FG+S + 
Sbjct: 362 STYKYTVLLVSFDTTVLAATRTNNMFTFVGVITANLLGIFVAKKLRRTKGFIFFGISMYI 421

Query: 436 IAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALYLA 495
           ++ GLL  YR             CLLGFG GF  +  +ASIQA+   H  +A+IT+L+LA
Sbjct: 422 VSTGLLYRYRIGAHAKVGTIVACCLLGFGNGFLKFPARASIQAAAYTHKNLAIITSLFLA 481

Query: 496 MYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPERQAVV 555
           + +I           IW+N +  ++SK I+N+T  + AY SP  FI +Y W++PER  +V
Sbjct: 482 LGSIGEGFGSSVAGAIWSNRMEVELSKYISNQTAVSLAYESPTKFIKSYKWESPERIGLV 541

Query: 556 VSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELEN 599
            +Y +   IL IV +C C  L   AL LR+ +L  VVA  +L+ 
Sbjct: 542 QAYSHVTNILYIVTICLCIPLYVFALLLRDRELADVVAFEQLDG 585

>TPHA0B00180 Chr2 complement(29722..31623) [1902 bp, 633 aa] {ON} 
          Length = 633

 Score =  533 bits (1374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/606 (44%), Positives = 383/606 (63%), Gaps = 13/606 (2%)

Query: 10  DGKINETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYS 69
           D +I   +L ++   +SN   S ++ +N+    +P + +        GV N+E+YA+ Y+
Sbjct: 23  DYQIRNKILSDKDATESNA--SEEITTNKL---KPAVSS-------TGVYNMEIYAKYYA 70

Query: 70  SPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQIC 129
           +P  + +++FSLF++ YAYGLDG+VR TYQ  ATSS+++HSL S            GQI 
Sbjct: 71  NPFQKFLIYFSLFVIYYAYGLDGNVRPTYQTLATSSFNRHSLNSTVTCINRVTSSAGQIW 130

Query: 130 YARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAM 189
           +ARASDIF R   ++I ++FY VGTII SQAT+V ++AVG+C Y +G+ G++L  E+   
Sbjct: 131 FARASDIFSREFSMVISILFYVVGTIISSQATSVAKYAVGACIYGIGHAGIVLLCEIYMA 190

Query: 190 DFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGCCLL 249
           DFSNLNWR+ A   P LP IINTW+SGN++  +G  W+WG+GMWA I P S IPL  C+ 
Sbjct: 191 DFSNLNWRVVAENAPMLPAIINTWVSGNITSDLGSKWQWGLGMWAIIFPASCIPLFVCIY 250

Query: 250 HMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLA 309
           HMR++A KN  ++++  F    ++ W  Y++D+F+WKLDFIGL+LL A F  ILVPFT +
Sbjct: 251 HMRYMAKKN-NEKIRKIFEKPSEIAWKKYLIDIFIWKLDFIGLVLLVAVFALILVPFTTS 309

Query: 310 GGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHI 369
           GGL  +W +A+ IVPEV+GW VALPIF +WE KFS+ P+    LI DRGI+ AL I+F I
Sbjct: 310 GGLHREWNSANFIVPEVVGWVVALPIFSVWEWKFSRYPILRLDLISDRGIYSALSISFFI 369

Query: 370 NFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIF 429
            F  Y+   Y+YT L+V+V+++ KS TRI SL SFV+VIT   LGL I+K+RRT+ FI+ 
Sbjct: 370 QFCLYVNDTYLYTFLLVAVDQTTKSGTRINSLMSFVNVITACCLGLFIVKIRRTQIFIVI 429

Query: 430 GVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVI 489
           G   WF+ +GL VHY              CL GFG GF     +AS+QAS   H  +A++
Sbjct: 430 GCVSWFVVYGLYVHYNGGLGSRSGIITASCLSGFGYGFIKSPLKASLQASSNSHQNLAIV 489

Query: 490 TALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTP 549
           TAL+LA+ NI           IW+N+LP ++ K I N TLA  A+ SP  FI  Y W T 
Sbjct: 490 TALFLAIGNIGTAFGAAVAGAIWSNLLPHRLEKSIGNVTLADSAFDSPIKFIKQYKWHTA 549

Query: 550 ERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELENTPNSDEQGSF 609
            RQ +V SY    +IL IV L     +L ++  LR+ KL + VA  + + +P   E+ + 
Sbjct: 550 VRQHLVSSYGSVWRILNIVCLVLVIPMLVSSFLLRDRKLSNSVAYDQRDFSPTDCEEENI 609

Query: 610 ADNDKN 615
             + ++
Sbjct: 610 GQDRRS 615

>KAFR0D00930 Chr4 complement(195566..197410) [1845 bp, 614 aa] {ON} 
          Length = 614

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/594 (45%), Positives = 376/594 (63%), Gaps = 7/594 (1%)

Query: 14  NETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPIY 73
            E  + ++TT  S+   +    S +   +  D   YD     AGV NIE+YAE Y+S   
Sbjct: 11  KEEAVAKETTVVSHDAAAKNDFSIETREDGDDAIVYD-----AGVRNIEIYAEYYTSKFS 65

Query: 74  RVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARA 133
           R M FF LFLVAYAYGLD  VR T+   ATSSY +H+L+S            GQI +AR+
Sbjct: 66  RFMYFFFLFLVAYAYGLDTRVRTTFATDATSSYKKHTLMSTVTCIKTIISAAGQIGFARS 125

Query: 134 SDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSN 193
            DIFGR +I +  ++ YAVGTI+ESQAT ++++A G   Y LG++G++L  E++  DFSN
Sbjct: 126 CDIFGRTSIFVFSIILYAVGTIVESQATTISKYAGGVVLYSLGHSGIVLVSEVLIADFSN 185

Query: 194 LNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGCCLLHMRW 253
           LNWR+ A+  P LP +INTWISGN+   +G HWKWGIG+WA + P+  IPL   LLHM++
Sbjct: 186 LNWRVVAAAAPMLPNVINTWISGNIVADLGDHWKWGIGLWAIVFPVCCIPLLFILLHMKY 245

Query: 254 LA-HKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGL 312
           LA +K+ +  LK  +   + M    Y+++   W++D +GL+LL ATFG IL+PFTLA   
Sbjct: 246 LAQYKDKRPELKRIWTLPKGMTKVQYLIETLFWRVDVVGLILLAATFGLILIPFTLAEKK 305

Query: 313 QDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFI 372
             +WK A  IVPEV+GW V+LP++ +WE  F++ PLTP A +KDRGI+ AL+++  I+F+
Sbjct: 306 NYQWKKASYIVPEVLGWAVSLPLYCIWEKFFARFPLTPLATVKDRGIYGALLVSLFIDFV 365

Query: 373 WYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVS 432
           +YMQ  Y+YTVL V+ N +  +ATRI +LYSFV VIT   LG V++++++ K FI+FG++
Sbjct: 366 YYMQHTYLYTVLYVAFNNTTSAATRINNLYSFVGVITSFFLGFVVVRLKKVKKFILFGIA 425

Query: 433 CWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITAL 492
            W IA+GL + YR            +C+LGFG GF     +ASIQASV  H KMAVIT+L
Sbjct: 426 VWIIAYGLFIRYRTGQASYVGSIAAICVLGFGNGFLKIPARASIQASVGSHQKMAVITSL 485

Query: 493 YLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPERQ 552
           +LA+ +I           IW N +  +I KR++N T AA AY SP  F+  Y W T  R 
Sbjct: 486 FLALADIGEAFGSAVAGAIWGNRMEAEIYKRVSNTTAAALAYDSPTKFVKKYKWGTATRM 545

Query: 553 AVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSEL-ENTPNSDE 605
            VV +YR    IL +VG+C C  LL  +  LR+ KLE V++   +  N+ + DE
Sbjct: 546 EVVAAYREVTLILYVVGICLCVPLLLCSFLLRDRKLEEVISYDMMGSNSESKDE 599

>KNAG0J02980 Chr10 (571855..573765) [1911 bp, 636 aa] {ON} 
          Length = 636

 Score =  510 bits (1314), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 281/625 (44%), Positives = 383/625 (61%), Gaps = 22/625 (3%)

Query: 1   MTSSSDSKF--DGKINETVLQE-----QTTEDSNQF-NSSQLDSNQPDSNQPDLKNYDLY 52
           M+++ +  F  D + N T+++      +T++ +N F N  Q +++Q DS   + +     
Sbjct: 1   MSNTIEKAFGPDQEKNVTIVRSNNSATETSDGTNSFVNKEQYEAHQ-DSTTDEHETGK-- 57

Query: 53  HKDAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLL 112
            K   +   E+ ++ Y     + +L FS F+  Y YGLDG++RY Y   ATSSYS+HSLL
Sbjct: 58  KKTLTIRKTELLSKSYDKWYLQAILLFSAFVCGYGYGLDGNIRYIYTGYATSSYSEHSLL 117

Query: 113 SXXXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCF 172
           S             QI YAR SDI+GRM++L++ +V YAVGTII+ QA +V R+A GS F
Sbjct: 118 STINVINAVVSAASQIVYARLSDIYGRMSLLVVAIVLYAVGTIIQCQAYDVQRYAAGSIF 177

Query: 173 YQLGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVG--QHWKWGI 230
           Y  GY GVIL L LI  DFS+L WRLF  FVP  PFIINTWISGN++      +HW W I
Sbjct: 178 YNAGYVGVILILLLILSDFSSLRWRLFYQFVPTWPFIINTWISGNITQKANPLKHWSWDI 237

Query: 231 GMWAFIVPLSAIPLGCCLLHMRWLAHKNAK-DRLKSEFRTYRDMGWFAYIVDVFLWKLDF 289
           GMWAFI PLS +P+ CC++HM W    + +   L+ E   ++  GW   +  +F WKLD 
Sbjct: 238 GMWAFIFPLSCVPILCCMIHMHWRVRNDPEWKELQGEKTYFQIHGWKVTLKTLF-WKLDV 296

Query: 290 IGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLT 349
           +G+LL+ A  GCILVP TLAGG+  KW  ++II P V+G+ V +PIF  WE +++  PL 
Sbjct: 297 VGVLLMVACLGCILVPLTLAGGVSSKWNHSNIIGPFVLGF-VLIPIFSYWEARWATNPLV 355

Query: 350 PWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVIT 409
           P+ L+KDRG++ AL I+F I+FI+YM  DY+YTVLIV+V+ES+KSATRI+SL SFVS + 
Sbjct: 356 PYKLVKDRGVWAALGISFLIDFIFYMAVDYLYTVLIVAVHESVKSATRISSLSSFVSTVA 415

Query: 410 GTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFT 469
             ++ L + +V R KP II G S W +A GLL H+R            LC+ G G   FT
Sbjct: 416 SPIVALALTRVTRMKPVIIVGCSLWLLAMGLLYHFRGGRESHSGIIGALCVWGLGTTLFT 475

Query: 470 YTTQASIQASVKYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETL 529
           Y    S+QA+   H  MA +TAL   +Y I           IWT  L KQ+ KRI N  L
Sbjct: 476 YPVTVSVQAATN-HDNMATVTALNYTLYRIGSAVGAAVSGAIWTQTLYKQLLKRIGNSEL 534

Query: 530 AAEAYGSPFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLE 589
           A +AY SP+TFI TYTW TPER+A+V +YRY Q++  IV + FC+ L+  +L LR+ KL 
Sbjct: 535 ATKAYASPYTFITTYTWGTPEREAMVQAYRYVQRLETIVAVVFCAPLIMFSLCLRDAKLT 594

Query: 590 SVVA---LSELE--NTPNSDEQGSF 609
             VA   +SE E     + D  G F
Sbjct: 595 DEVAHEDISEGEYIEKASGDPIGEF 619

>CAGL0E04092g Chr5 (394380..396317) [1938 bp, 645 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040c ARN1
           or uniprot|P38724 Saccharomyces cerevisiae YHL047c TAF1
          Length = 645

 Score =  507 bits (1306), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 273/592 (46%), Positives = 360/592 (60%), Gaps = 15/592 (2%)

Query: 27  NQFNS-SQLDSNQPDSNQPDLKNYDLYHKDAGVNNI-----EVYAEQYSSPIYRVMLFFS 80
           N+F+   Q+ + Q + ++   +  +      GV NI     E+ AE Y    Y  +L F+
Sbjct: 38  NEFSKVDQISTAQSEMDEKMAEQTEQQRTMTGVKNIIIRKTEIMAEVYDKWYYHAILLFT 97

Query: 81  LFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGRM 140
            F+  Y YGLDG+ RY Y   ATSSY+QHSLLS             QI YAR SD++GR 
Sbjct: 98  AFVCGYGYGLDGNTRYIYTGYATSSYAQHSLLSTINVINAVISAASQIVYARLSDVYGRF 157

Query: 141 TILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWRLFA 200
            +  + +V Y+VGTII+SQA +V R+A GS FY  GY GVIL L LI  DFS+L WRL  
Sbjct: 158 ALFCVSIVLYSVGTIIQSQAYDVQRYAAGSIFYNTGYVGVILVLLLILSDFSSLRWRLVY 217

Query: 201 SFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAFIVPLSAIPLGCCLLHMRWLAHKN 258
            FVP  PFIINTWISGNV+      ++W W IGMWAFI PLS +PL C ++HM WLA K 
Sbjct: 218 QFVPTWPFIINTWISGNVTSRANPLKNWSWDIGMWAFIFPLSCVPLLCVMIHMWWLARKT 277

Query: 259 AK-DRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWK 317
            +   L  E   Y+  G    IV++F WK+D +G+ ++  + GCILVP TLAGG + KW 
Sbjct: 278 EEWQELSKEKTFYQKHGLKDTIVELF-WKIDAMGVFIMTISLGCILVPLTLAGGTKSKWN 336

Query: 318 TAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYMQG 377
            +H+I P V+G+ V +PI +LWE KF++ P+ P+ L+KDRG++ +  I+F I+FI+YM  
Sbjct: 337 NSHVIGPFVLGF-VLIPILVLWEYKFARDPIIPYKLVKDRGVWASFAISFLIDFIYYMAA 395

Query: 378 DYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIA 437
           DY+YTVLIV VNES+KSATRI+SL +FVS +   +  L+I +  R KPFII G   W +A
Sbjct: 396 DYLYTVLIVGVNESVKSATRISSLSTFVSTVGSPIFSLLITRFSRLKPFIICGCGLWMLA 455

Query: 438 FGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALYLAMY 497
            GLL HYR            LC+ G G   FTY    S+QA+   H  MA +TAL    Y
Sbjct: 456 MGLLYHYRGGAESHSGIIGALCVWGVGTTLFTYPVNVSVQAATS-HEHMATVTALNYTFY 514

Query: 498 NIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPERQAVVVS 557
            I           IWT  L KQ+ KR+ +  LA EAY SP+ FI+TYTWDTPERQAVV +
Sbjct: 515 RIGSAVGAAVSGAIWTQTLYKQLLKRVGDAALATEAYASPYKFIVTYTWDTPERQAVVQA 574

Query: 558 YRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVA---LSELENTPNSDEQ 606
           YRY Q++  IV L FC+ LL  +L LR+ +L   VA   ++E E     D+ 
Sbjct: 575 YRYVQRLETIVALVFCAPLLIFSLCLRDARLTDKVAHDNIAEGEYVDAKDDD 626

>SAKL0G06600g Chr7 complement(549492..551381) [1890 bp, 629 aa] {ON}
           similar to uniprot|P39980 Saccharomyces cerevisiae
           YEL065W SIT1 Ferrioxamine B transporter member of the
           ARN family of transporters that specifically recognize
           siderophore-iron chelates transcription is induced
           during iron deprivation and diauxic shift potentially
           phosphorylated by Cdc28p
          Length = 629

 Score =  507 bits (1305), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 260/599 (43%), Positives = 370/599 (61%), Gaps = 15/599 (2%)

Query: 20  EQTTEDSNQFNSSQLD----SNQPDSNQPDLKNYDLY-----HKDAGVNNIEVYAEQYSS 70
           E  + +SN    + ++    SN    + PD  NYD +      K  GV  +E+  +QY+ 
Sbjct: 13  ESVSSNSNSHIGTDVEKYQYSNTHGDSIPD--NYDSHFEEEEEKSYGVQKVEILNKQYNH 70

Query: 71  PIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICY 130
              +  +FFSLFL+ + + LD  VR +  A AT+SY QHSLLS            G   Y
Sbjct: 71  LWGKSAIFFSLFLMGFVFRLDSMVRRSMNAYATNSYKQHSLLSTVNVVRSVAAACGLPLY 130

Query: 131 ARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMD 190
           +R SD+FGR+ ++++ ++ Y  GTII +QA +VTR+A G   YQ G  G+ +  ++IA D
Sbjct: 131 SRLSDVFGRIELIVVSVLLYVAGTIICTQAYDVTRYAAGMILYQFGLCGLAILFKVIAAD 190

Query: 191 FSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKW-GIGMWAFIVPLSAIPLGCCLL 249
           FSNLNWR+F + + A PFIINTW+SG++  A+G +W W GIG+WA  +P++ IPL  C +
Sbjct: 191 FSNLNWRVFCTLISAAPFIINTWVSGDIVEAIGDNWSWPGIGVWAICLPVATIPLVLCFI 250

Query: 250 HMRWLAHKNAK-DRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTL 308
           HM++LA K+   ++L+     Y+ +G+  ++V+VF WKLD  G+L L    G IL P TL
Sbjct: 251 HMQYLAKKSGDLNQLRGMQTEYKRLGFKKFVVEVFFWKLDIFGVLSLMIILGLILTPLTL 310

Query: 309 AGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFH 368
           AGG   +W+TA +IVP ++G+C  +P+F  WE + +  P+ P  + +DRG++ AL I   
Sbjct: 311 AGGETAEWRTAKVIVPLILGFC-WIPVFAFWENRIATHPIAPTDMFRDRGVYCALGIGIL 369

Query: 369 INFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFII 428
           I+F WYMQGDY+YT+L+V+++ES+KSATRI SLYSF ++ITG  +GL I KVR+ K FI+
Sbjct: 370 IDFCWYMQGDYLYTILVVAIHESVKSATRINSLYSFSTIITGLCVGLAISKVRKMKCFIV 429

Query: 429 FGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAV 488
           FGV  W +AFG+++ YR              LLGFG  FFT+  QAS+QA V  H +MA 
Sbjct: 430 FGVCMWLVAFGIMIKYRGGSQSHGGMIASQVLLGFGGAFFTHPVQASLQAYVN-HERMAT 488

Query: 489 ITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDT 548
           IT LY   Y I           IWT VLP +I KR  N+TLA  AY +P +FI  YTW T
Sbjct: 489 ITTLYAISYYIGSAVGSSVSGAIWTQVLPNEIGKRFTNKTLARLAYSAPLSFIKKYTWGT 548

Query: 549 PERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELENTPNSDEQG 607
           P R  +V +YR+ QK+L IVG+CFC  +LG ALFLR+  L S   + + E+    +  G
Sbjct: 549 PLRMELVEAYRHVQKLLIIVGICFCVPILGFALFLRDPVLISAQNIVDAEDKEVKEYYG 607

>TBLA0C01040 Chr3 (208261..210270) [2010 bp, 669 aa] {ON} 
          Length = 669

 Score =  504 bits (1298), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 276/606 (45%), Positives = 358/606 (59%), Gaps = 14/606 (2%)

Query: 13  INETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAG--VNNIEVYAEQYSS 70
           INE   +  T E SN    S  D     S   D    D         +   E+    Y  
Sbjct: 52  INE---KYNTIETSNSSGFSSKDEKYLASENIDEIPSDGEKTSTSRIIRETEIMKSVYDK 108

Query: 71  PIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICY 130
             Y V+L FS F+  Y YGLDG++RY Y   ATSSY++HSLLS             QI Y
Sbjct: 109 WYYHVILLFSAFVCGYGYGLDGNIRYIYTGYATSSYAEHSLLSTINVINAVASAASQIVY 168

Query: 131 ARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMD 190
           ARASD+FGR+++ I+ +VFYAVGTII+ QA +V R+  GS FY +GY GVIL L LI  D
Sbjct: 169 ARASDVFGRLSLFIVSVVFYAVGTIIQCQAYDVQRYCAGSFFYNIGYVGVILVLLLILSD 228

Query: 191 FSNLNWRLFASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAFIVPLSAIPLGCCL 248
           FS+L WRLF  F P  P+IINTWISGN++ A    +HW W IGMWAFI PLS+IP+  CL
Sbjct: 229 FSSLKWRLFYQFAPTWPYIINTWISGNITSAANPLKHWSWDIGMWAFIFPLSSIPIILCL 288

Query: 249 LHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTL 308
           +HMRW+A K  + +L  + ++Y     F   +    W+LD IG+LL+ A+ GCILVP TL
Sbjct: 289 IHMRWMASKTKEWKLLKQEKSYIQQHTFVSAITDLFWRLDVIGVLLMGASLGCILVPLTL 348

Query: 309 AGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFH 368
           AGG   KW   +II P  +G+ V +PIF  WE KFSK PL P  L+KDR ++ ++ I+F 
Sbjct: 349 AGGTSSKWNHGNIIAPFALGF-VLIPIFTFWEWKFSKSPLIPSKLVKDRAVWSSMAISFL 407

Query: 369 INFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFII 428
           I+FI+YM  DY+YTVLIV VNES+KSATRI+SL SFVS +   +  L+I +  R KPFI+
Sbjct: 408 IDFIFYMAVDYLYTVLIVGVNESVKSATRISSLSSFVSTVGSPIFALLITRFTRLKPFIV 467

Query: 429 FGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAV 488
            G + W ++ GLL HYR            LC+ G G   FTY    S+QA+V  H+ MA 
Sbjct: 468 AGCALWMLSMGLLYHYRGGASSHNGIIASLCVWGVGTTLFTYPINVSVQAAVS-HADMAT 526

Query: 489 ITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDT 548
           +TAL   MY I           IWT  L KQ+ KR+ + TLA  AY SP++FI+ YTW T
Sbjct: 527 VTALNYTMYRIGSAVGAAVSGAIWTQTLYKQLHKRMGDATLATAAYSSPYSFIVNYTWGT 586

Query: 549 PERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELE-----NTPNS 603
             R  +V +YRY Q++  IV L F   LL  +L LR+ +L   VA  ++E     N  +S
Sbjct: 587 TVRDQMVEAYRYVQRLETIVALVFTVPLLLFSLTLRDARLTDNVASDDIEEGQHINKTDS 646

Query: 604 DEQGSF 609
           D    F
Sbjct: 647 DPIADF 652

>Suva_8.12 Chr8 complement(20611..22512) [1902 bp, 633 aa] {ON}
           YHL040C (REAL)
          Length = 633

 Score =  501 bits (1291), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 268/616 (43%), Positives = 370/616 (60%), Gaps = 23/616 (3%)

Query: 1   MTSSSDSKFDGKINETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNN 60
           M    + K DG +N T     +  DS+ F+S    S + D+ + +        K   +  
Sbjct: 19  MNKEHELKSDGHVNTT-----SDSDSHAFDSIPQLSGKYDALRQN--------KSLVIKQ 65

Query: 61  IEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXX 120
            E+  E Y    ++ +L  S F+  Y YGLDG++RY Y   ATSSYS+HSLLS       
Sbjct: 66  TEIIGEAYKKWYFQAILLISAFVCGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINA 125

Query: 121 XXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGV 180
                 QI YAR SD+FGR+ + I  ++ Y VGTII+SQA +V R+A GS FY  GY GV
Sbjct: 126 VVSAASQIIYARLSDVFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGSIFYNAGYVGV 185

Query: 181 ILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAFIVP 238
           IL L +I  DFS+L WRL   F P  PFIINTWI+GN++      ++W W IGMWAFI P
Sbjct: 186 ILILLIILSDFSSLKWRLLYQFAPTWPFIINTWIAGNITSKANPVENWSWDIGMWAFIFP 245

Query: 239 LSAIPLGCCLLHMRWLAHKNAK-DRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCA 297
           LS IP+  C+LHM+W+A K  +   LK E   Y++ G F  +++   WKLD IG+LL+  
Sbjct: 246 LSCIPIVLCMLHMQWIARKTPEWHALKDEKSYYQEHG-FVKVLEQLFWKLDVIGVLLMGC 304

Query: 298 TFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDR 357
           + GCILVP TLAGG++  W  + +I P V+G+ V +PI  +WE + ++ P+ P+ L+KDR
Sbjct: 305 SLGCILVPLTLAGGVKTTWNDSRLIGPFVLGF-VLIPILWVWEYRVARDPIIPYKLVKDR 363

Query: 358 GIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVI 417
           G++ ++ I+F I+FI+YM  DY+YTV++V+VNESIKSATRI++L SFVSV+     GL++
Sbjct: 364 GVWSSMGISFLIDFIYYMAADYLYTVMLVAVNESIKSATRISTLSSFVSVVASPFFGLIM 423

Query: 418 IKVRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQ 477
            +  R KPFI+FG   W +A GLL  YR            LC+ G G   FTY    S+Q
Sbjct: 424 TRCTRLKPFIMFGCCLWMLAMGLLYRYRGGRESHSGIIGALCVWGLGTTLFTYPVTVSVQ 483

Query: 478 ASVKYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSP 537
           ++V  H  +A +TAL   +Y I           IWT  L KQI KR+ + TLA  AY SP
Sbjct: 484 SAVS-HENLATVTALNYTLYRIGSAVGAAVSGAIWTQTLYKQILKRMGDVTLATAAYTSP 542

Query: 538 FTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSEL 597
           +TFI TYTW TP+R A+V +Y+Y Q++  IV L FC+ L+  +L LR+ KL   VA+  +
Sbjct: 543 YTFIETYTWGTPQRVALVNAYKYVQRLETIVALVFCAPLIAFSLCLRDPKLTDTVAVENI 602

Query: 598 ENTPNSDEQGSFADND 613
           E     D +    DND
Sbjct: 603 EEGEYVDTK----DND 614

>KAFR0C02660 Chr3 (516832..518607) [1776 bp, 591 aa] {ON} 
          Length = 591

 Score =  497 bits (1279), Expect = e-169,   Method: Compositional matrix adjust.
 Identities = 245/585 (41%), Positives = 365/585 (62%), Gaps = 9/585 (1%)

Query: 35  DSNQPDSNQPDLKNYDLYHKD---AGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLD 91
           + N+ +     L+ +D+   D    GV NIE+Y+E Y++P+ R++LF S+FLV Y+Y LD
Sbjct: 13  EENKVNETSYSLEAHDVPEDDYYNVGVTNIEIYSEFYNTPMKRIILFSSIFLVCYSYSLD 72

Query: 92  GSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYA 151
            ++R T++  AT+S+S+HSL+S            G++ +AR++DIFGR +I  I LVFY 
Sbjct: 73  STLRKTFKTDATNSFSEHSLVSFVNCFSAIVSAIGELFFARSADIFGRTSIFYICLVFYV 132

Query: 152 VGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIIN 211
           VGTII + +  +++FA G C Y  G +G+ + ++L+  DFS+LNWRL A  +P LP +IN
Sbjct: 133 VGTIIVATSKGISQFAAGYCIYSFGESGIDMVMQLLVSDFSHLNWRLVAGVIPMLPNVIN 192

Query: 212 TWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYR 271
            W SG +      +W+WGIGM+A IVP++ IPL  CL HMR++A KN K+ LK  + +  
Sbjct: 193 AWASGTIVSDFSDNWQWGIGMFAIIVPVACIPLAVCLFHMRYMAKKNKKNELKRPWHSNN 252

Query: 272 DMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCV 331
           ++ W  +I +   W+LD +GL+ L A+ GCILVPFTL      KW  A  IVPEVIGW V
Sbjct: 253 ELSWAQFIRETLFWRLDLVGLITLGASLGCILVPFTLTKKAGKKWAKASTIVPEVIGWAV 312

Query: 332 ALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNES 391
            LP++++WE  ++K PLTP  LI+DRG++ ALV  F   FI+ M+ +YM TVL V+ N +
Sbjct: 313 GLPLYIVWEKFYAKYPLTPLRLIRDRGVYAALVAVFLYEFIYVMEANYMVTVLQVAFNNT 372

Query: 392 IKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXX 451
             +ATRI + Y FVSV+T  +LG  ++ +R+TK  I+FG + +F+++GL + YR      
Sbjct: 373 SAAATRINNSYEFVSVLTAFILGFFVVFIRKTKRLILFGGTLFFVSYGLFIRYRGGHGCY 432

Query: 452 XXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALYLAMYNIXXXXXXXXXXXI 511
                 LC+ GF  GF  Y T+ S+QAS   H +MA+ITAL+ A+ ++           I
Sbjct: 433 AGSIAALCVFGFANGFIKYPTRTSLQASAGSHKRMAMITALFTAIGSVGKAMAAAIAGAI 492

Query: 512 WTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLC 571
           W+ ++P  +S RI+N  +AA+AY SP T I TY W++  R  ++ +YRY  K+L IV +C
Sbjct: 493 WSGLMPGALSSRISNSKVAAKAYSSPLTVIKTYGWNSTIRNEMIEAYRYVTKVLYIVAIC 552

Query: 572 FCSTLLGAALFLRNHKLESVVALSELENTPNSDEQGSFADNDKNV 616
            C  LL A+  LR+ +LE+ VA     + P      S  D +K V
Sbjct: 553 LCVPLLIASFLLRDRRLENKVAYDSDSDDP------SVLDEEKKV 591

>KAFR0I01560 Chr9 (328940..330838) [1899 bp, 632 aa] {ON}  YHL040C
          Length = 632

 Score =  496 bits (1277), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 265/607 (43%), Positives = 368/607 (60%), Gaps = 17/607 (2%)

Query: 14  NETVLQEQTTEDSNQFNSSQLDSNQPDSNQPD--LKNYDLYHKDAGVNNIEVYAEQYSSP 71
           +E ++++ T    +   SS  D    D N+ D  L+N    +K   +   E+ +  Y+  
Sbjct: 7   SEIIVEKNTAAIVSSKKSS--DEEPMDYNEVDEELQNVLQTNKSIVIKKAEIISASYAKW 64

Query: 72  IYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYA 131
             +++  F  FL  Y YGLD ++RY Y   ATSSYS+HSLLS             QI YA
Sbjct: 65  YEKLIFLFCAFLCGYGYGLDSNIRYIYTGYATSSYSEHSLLSTVTVINAVVSAASQIVYA 124

Query: 132 RASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDF 191
           R SD FGR  + ++ +V Y++GTII+ QA +V R+A GS FY  GY GVIL L LI  D 
Sbjct: 125 RLSDAFGRFRLFVVAIVLYSMGTIIQCQAYDVQRYAAGSIFYNAGYVGVILVLLLILSDM 184

Query: 192 SNLNWRLFASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAFIVPLSAIPLGCCLL 249
           S L WRLF  FVP  P+IINTWISGN++ A    ++W W +GMWAFI PLS +P+  C++
Sbjct: 185 STLRWRLFYQFVPTWPYIINTWISGNITSAANPIENWSWDVGMWAFIFPLSCLPILACMI 244

Query: 250 HMRWLAHKNAK-DRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTL 308
           HM+W A K  +   LK++   Y+  G    +V +F WK+D IG+LL+ A+ GCILVP TL
Sbjct: 245 HMQWRARKTQEWKDLKTQKTYYQQHGLMKSLVSLF-WKIDIIGVLLMAASLGCILVPLTL 303

Query: 309 AGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFH 368
           AGG   KW+ + II   V+G+ V +PIF +WE KF+  P+ P+ L+KDRG++ +L I+F 
Sbjct: 304 AGGTSSKWRDSRIIGVFVLGF-VLIPIFFIWEKKFATDPIVPYKLVKDRGVWASLGISFL 362

Query: 369 INFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFII 428
           I+FI+YM  DY+YTVLIV+VNES+ +ATRI+SLYSFVS +    + L + +  R KPFII
Sbjct: 363 IDFIYYMAADYLYTVLIVAVNESVSAATRISSLYSFVSTVASPFVSLALTRFTRLKPFII 422

Query: 429 FGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAV 488
           FG   WF+A GLL H+R            LC+ G G+ FFTY    S+QA+V  H +MA 
Sbjct: 423 FGCCLWFLAMGLLYHFRGGASSHSGIIGGLCVWGLGSTFFTYPVTVSVQAAVS-HEQMAT 481

Query: 489 ITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDT 548
           ++AL    Y I           IWT  L K++   + + TLA  AYGSP+TFI+TYTW T
Sbjct: 482 VSALNYTFYRIGSAVGAAVSGAIWTQKLYKKLLSLMGDATLATAAYGSPYTFIVTYTWGT 541

Query: 549 PERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELENTPNSDEQGS 608
           PER+A+V +YRY Q++  +V L FC  L+  +L LR+ +L   VA  ++ +       G 
Sbjct: 542 PEREAMVEAYRYIQRLETVVALVFCVPLVAFSLCLRDSRLTDNVAHDDMSS-------GE 594

Query: 609 FADNDKN 615
           F D   +
Sbjct: 595 FIDTKSD 601

>Smik_8.1 Chr8 complement(2797..4680) [1884 bp, 627 aa] {ON} YHL040C
           (REAL)
          Length = 627

 Score =  480 bits (1236), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 256/598 (42%), Positives = 359/598 (60%), Gaps = 14/598 (2%)

Query: 23  TEDSNQFNS-SQLDSNQPDSNQPDL-KNYDLYHKDAG--VNNIEVYAEQYSSPIYRVMLF 78
           T+  ++ N+ +   SN      P L + YD   ++    +   E++   Y+    +V L 
Sbjct: 19  TDVEHELNAETHTGSNSISFGLPQLSEKYDALRQNRSLIIQQTEIFGAAYNKWYLQVFLL 78

Query: 79  FSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFG 138
            S F+  Y YGLDG++RY Y   ATSSYS+HSLLS             QI YAR SD+FG
Sbjct: 79  LSAFICGYGYGLDGNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIIYARLSDVFG 138

Query: 139 RMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWRL 198
           R+ + I  ++ Y VGTII+SQA +V R+A G+ FY  GY GVIL L +I  DFS+L WRL
Sbjct: 139 RLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLIILSDFSSLKWRL 198

Query: 199 FASFVPALPFIINTWISGNVSGAVGQ--HWKWGIGMWAFIVPLSAIPLGCCLLHMRWLAH 256
              F P  PFIINTWI+GN++       +W W +GMWAFI PLS IP+  C+LHM+W A 
Sbjct: 199 LYQFAPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAFIFPLSCIPIVLCMLHMQWRAK 258

Query: 257 KNAK-DRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDK 315
           K  +   LK +   Y++ G F  I+    W LD IG+LL+  + GCILVP TLAGG++  
Sbjct: 259 KTPEWHTLKGQKSYYQEHG-FIKIIKQLFWMLDIIGVLLMGCSLGCILVPLTLAGGVKTT 317

Query: 316 WKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYM 375
           W  + +I P V+G+ V +P+  +WE +F++ P+ P+ L+KDR ++ ++ I+F I+FI+YM
Sbjct: 318 WNDSRLIGPFVLGF-VLIPVLWIWEYRFARDPILPYKLVKDRAVWSSMGISFLIDFIYYM 376

Query: 376 QGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWF 435
             DY+YTV+IV+VNES+KSATRI++L SFVS +      L++ +  R KPFI+FG S W 
Sbjct: 377 AADYLYTVMIVAVNESVKSATRISTLSSFVSTVASPFFALLVTRCTRLKPFIMFGCSLWM 436

Query: 436 IAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALYLA 495
           +A GLL H+R            L + G G   FTY    S+Q++V  H  MA +TAL   
Sbjct: 437 VAMGLLYHFRGGSQSHSGIIGALGVWGVGTTLFTYPVTVSVQSAVS-HENMATVTALNYT 495

Query: 496 MYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPERQAVV 555
           +Y I           IWT  L KQI KR+ +  LA  AY SP+TFI TYTW TP+R A++
Sbjct: 496 LYRIGSAVGSAVSGAIWTQTLYKQILKRMGDVALATAAYDSPYTFIETYTWGTPQRVALM 555

Query: 556 VSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELENTPNSDEQGSFADND 613
            +Y+Y Q++  IV L FC  L+  +L LR+ KL + VA+  +E+    D +    DND
Sbjct: 556 NAYKYVQRLETIVALVFCVPLIALSLCLRDPKLTNAVAVEYIEDGEYVDTK----DND 609

>KLLA0A10439g Chr1 complement(913342..915246) [1905 bp, 634 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 634

 Score =  480 bits (1236), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 265/615 (43%), Positives = 355/615 (57%), Gaps = 19/615 (3%)

Query: 10  DGKINETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDL-----YHKDAGVNNIEVY 64
           + K+ ++   +  T      N + +  ++  +   DL  Y +       K   +   E+ 
Sbjct: 11  EDKVLKSTYSDDETNVIKSVNGAGVGVDEKQAGPTDLNEYGIPDYLKSSKSLTIRKTEIL 70

Query: 65  AEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXX 124
           AEQYSS  +RV+L FS FL  Y YGLDG++R  Y   AT+SYS HSLLS           
Sbjct: 71  AEQYSSWQWRVVLLFSAFLCGYGYGLDGNLRSFYTTWATNSYSTHSLLSTIGVVNAVMGA 130

Query: 125 XGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSL 184
             QI YAR SD++GR T+ +  +VFY VGTIIESQA +V R+A G+ FY +GY GVIL +
Sbjct: 131 ASQIVYARLSDVYGRFTLFVTAIVFYVVGTIIESQAHDVQRYAAGAVFYNIGYVGVILIV 190

Query: 185 ELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAFIVPLSAI 242
            LI  DFS+L WRLF SFVP  PFIINTWISGN+       Q+W W I MWAFI PLS +
Sbjct: 191 LLILSDFSSLKWRLFYSFVPTWPFIINTWISGNIVDVAKPEQNWSWDIAMWAFIFPLSCL 250

Query: 243 PLGCCLLHMRWLAHK-NAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGC 301
           PL  C+LHM+W A +  A   L S+   Y+  G    +V +F WKLD IG+  +    GC
Sbjct: 251 PLLGCMLHMKWRARQTEAWKELSSQKTYYQTHGLVQSLVQLF-WKLDVIGVFFMIIILGC 309

Query: 302 ILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFF 361
           ILVP TLAGG+ +KW   HII P ++G+ V +P F+ WE K+++ P+ P+ L++DRGI+ 
Sbjct: 310 ILVPLTLAGGISNKWNNPHIIAPFILGF-VLIPFFIAWESKWAREPIAPFKLLRDRGIWA 368

Query: 362 ALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVR 421
           AL IAF INFI+ M   Y+YT+L+V+VNES+ SATRI+S+ +F S +      L I +  
Sbjct: 369 ALCIAFLINFIFTMAAGYLYTILMVAVNESVTSATRISSVSTFTSTVFSPFFALFITRFT 428

Query: 422 RTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVK 481
           R KPFII G S W +A G+L H+R            L + G G   FTY    S+Q SV 
Sbjct: 429 RLKPFIIAGCSLWMVAMGILFHFRSGQNSDKGIIGALVVWGLGTTMFTYPVTVSLQ-SVT 487

Query: 482 YHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRI-ANETLAAEAYGSPFTF 540
            H  MA +TAL   MY I           IWT +L KQ+ + +  + TLAA  YGSP T+
Sbjct: 488 SHENMATVTALSYTMYRIGSAVGSAVSGAIWTQLLYKQLLQHLDGDATLAASFYGSPLTY 547

Query: 541 ILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELENT 600
           I  Y W TP R  VV +YRY QK   +V L F + L   +L LR+  L + VA   +   
Sbjct: 548 IAQYPWGTPVRDGVVQAYRYVQKYEVLVALVFTAPLFVFSLCLRDPPLTNEVAHENI--- 604

Query: 601 PNSDEQGSFADNDKN 615
               +QG + D + +
Sbjct: 605 ----KQGEYVDVEDD 615

>YHL040C Chr8 complement(19088..20971) [1884 bp, 627 aa] {ON}
           ARN1Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to ferrirubin, ferrirhodin, and related
           siderophores
          Length = 627

 Score =  480 bits (1235), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 253/585 (43%), Positives = 352/585 (60%), Gaps = 13/585 (2%)

Query: 35  DSNQPDSNQPDL-KNYDLYHKDAG--VNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLD 91
           DSN      P L + Y+   ++    +   E+    Y+    + +L  S F+  Y YGLD
Sbjct: 32  DSNSDSYGLPQLSEKYNALRQNRSLIIQQTEIIGSAYNKWYLQAILLLSAFICGYGYGLD 91

Query: 92  GSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYA 151
           G++RY Y   ATSSYS+HSLLS             QI YAR SD+FGR+ + I  ++ Y 
Sbjct: 92  GNIRYIYTGYATSSYSEHSLLSTINVINAVVSAASQIIYARLSDVFGRLYLFISAVILYV 151

Query: 152 VGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIIN 211
           VGTII+SQA +V R+A G+ FY  GY GVIL L +I  DFS+L WRL   FVP  PFIIN
Sbjct: 152 VGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLIILSDFSSLKWRLLYQFVPTWPFIIN 211

Query: 212 TWISGNVSGAVGQ--HWKWGIGMWAFIVPLSAIPLGCCLLHMRWLAHKNAK-DRLKSEFR 268
           TWI+GN++       +W W +GMWAFI PLS +P+  C+LHM+W A K  +   LK +  
Sbjct: 212 TWIAGNITSRANPVVNWSWDVGMWAFIFPLSCVPIVLCMLHMQWRARKTPEWHALKGQKS 271

Query: 269 TYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIG 328
            Y++ G F  I+    W LD +G+LL+  + GCILVP TLAGG++  W  + +I P V+G
Sbjct: 272 YYQEHG-FIKILKQLFWMLDVVGVLLMGCSLGCILVPLTLAGGVKTTWNDSRLIGPFVLG 330

Query: 329 WCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSV 388
           + V +PI  +WE +F++ P+ P+ L+KDR ++ ++ I+F I+FI+YM  DY+YTV+IV+V
Sbjct: 331 F-VLIPILWIWEYRFARDPILPYRLVKDRAVWSSMGISFLIDFIYYMAADYLYTVMIVAV 389

Query: 389 NESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRXXX 448
           NES+KSATRI +L SFVS +      L++ +  R KPFI+FG + W +A GLL H+R   
Sbjct: 390 NESVKSATRIATLSSFVSTVASPFFALLVTRCTRLKPFIMFGCALWMVAMGLLYHFRGGS 449

Query: 449 XXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALYLAMYNIXXXXXXXXX 508
                    LC+ G G   FTY    S+Q++V  H  MA +TAL   +Y I         
Sbjct: 450 QSHSGIIGALCVWGVGTTLFTYPVTVSVQSAVS-HENMATVTALNYTLYRIGSAVGSAVS 508

Query: 509 XXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPERQAVVVSYRYTQKILCIV 568
             IWT  L KQI KR+ +  LA  AY SP+TFI TYTW TP+R A++ +Y+Y Q++  IV
Sbjct: 509 GAIWTQTLYKQILKRMGDVALATTAYESPYTFIETYTWGTPQRNALMNAYKYVQRLETIV 568

Query: 569 GLCFCSTLLGAALFLRNHKLESVVALSELENTPNSDEQGSFADND 613
            L FC  L+  +L LR+ KL   VA+  +E+    D +    DND
Sbjct: 569 ALVFCVPLIAFSLCLRDPKLTDTVAVEYIEDGEYVDTK----DND 609

>Skud_8.3 Chr8 complement(7094..8989) [1896 bp, 631 aa] {ON} YHL040C
           (REAL)
          Length = 631

 Score =  479 bits (1232), Expect = e-162,   Method: Compositional matrix adjust.
 Identities = 257/596 (43%), Positives = 356/596 (59%), Gaps = 12/596 (2%)

Query: 19  QEQTTEDSNQFNSSQLDSNQPDSNQPDLK-NYDLYHKDAG--VNNIEVYAEQYSSPIYRV 75
           QE   E     +SS   S   D   P +   YD   ++    +   E+    Y+    + 
Sbjct: 23  QELNPEAHTDSHSS---SYARDDTLPQMSGKYDALRQNRSLIIKQTEIIGTAYNKWYLQA 79

Query: 76  MLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASD 135
           +L FS F+  Y YGLDG++RY Y   ATSSYS+HSLLS             QI YAR SD
Sbjct: 80  ILLFSAFVCGYGYGLDGNIRYIYTGYATSSYSKHSLLSTINVINAVVSAASQIIYARLSD 139

Query: 136 IFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLN 195
           +FGR+ + I  ++ Y VGTII+SQA +V R+A G+ FY  GY GVIL L +I  DFS+L 
Sbjct: 140 VFGRLYLFISAVILYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVILILLIILSDFSSLK 199

Query: 196 WRLFASFVPALPFIINTWISGNVSGAVGQ--HWKWGIGMWAFIVPLSAIPLGCCLLHMRW 253
           WRL   F P  PFIINTWI+GN++       +W W +GMWAFI PLS IP+  C+LHM+W
Sbjct: 200 WRLLYQFAPTWPFIINTWIAGNITSRANPVVNWSWDVGMWAFIFPLSCIPIVLCMLHMQW 259

Query: 254 LAHKNAK-DRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGL 312
            A K  +   LK +   Y++ G    I++   WKLD IG+LL+  + GCILVP TLAGG+
Sbjct: 260 RAGKTPEWQELKGQKSYYQEHG-LMKILEQLFWKLDVIGVLLMGCSLGCILVPLTLAGGV 318

Query: 313 QDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFI 372
           +  W  + +I P V+G+ V +PI  +WE  +++ P+ P+ L+KDRG++ ++ I+F I+FI
Sbjct: 319 KTTWNDSRLIGPFVLGF-VLIPILWVWEYSYARDPILPYKLVKDRGVWSSMGISFLIDFI 377

Query: 373 WYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVS 432
           +YM  DY+YTV+IV+VNESIKSATRI++L SFVSV+     GL++ +  R KPFI+ G S
Sbjct: 378 YYMAADYLYTVMIVAVNESIKSATRISTLSSFVSVVASPFFGLLMTRCTRLKPFIMSGCS 437

Query: 433 CWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITAL 492
            W +A GLL  +R            LC+ G G   FTY    S+Q++V  H  +A +TAL
Sbjct: 438 LWMLAMGLLYRFRGGSESHSGIIGALCVWGVGTTLFTYPVTVSVQSAVS-HENLATVTAL 496

Query: 493 YLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPERQ 552
              MY I           IWT  L KQI KR+ +  LAA AY SP+ FI TYTW TP+R 
Sbjct: 497 NYTMYRIGSAVGSAVSGAIWTQTLYKQILKRMGDVALAASAYDSPYVFIETYTWGTPQRV 556

Query: 553 AVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELENTPNSDEQGS 608
           A++ +Y+Y Q++  IV L FC  L+  +L LR+ +L   VA+  +++    D + S
Sbjct: 557 ALMGAYKYVQRLETIVALVFCVPLIALSLCLRDPRLTDTVAVENIKDGEYVDTKDS 612

>KLLA0C19272g Chr3 complement(1717903..1719774) [1872 bp, 623 aa]
           {ON} similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter or YHL040C uniprot|P38731
           Saccharomyces cerevisiae YHL040C ARN1 Transporter,
           member of the ARN family of transporters that
           specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C,
          Length = 623

 Score =  469 bits (1208), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 264/614 (42%), Positives = 369/614 (60%), Gaps = 19/614 (3%)

Query: 13  INETVLQEQT----TEDSNQFNSSQLDSNQPDS-NQPDLKNYDLYHKDAGVNNIEVYAEQ 67
           + E V+ +Q     T  +N+F+  +    QP+  N+  L +   + +   +   E+ A+Q
Sbjct: 3   VKEEVVGKQAVSSHTVAANEFDLDE--KQQPEVLNEYGLPDKLRFTRSLVLRKTEILAQQ 60

Query: 68  YSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQ 127
           Y +  ++ +L FS+FL +Y YGLDGSVR  Y   AT+SYS HSLLS             Q
Sbjct: 61  YDTWYWKAVLLFSVFLCSYGYGLDGSVRSVYTTYATNSYSTHSLLSTISIINLVIGASAQ 120

Query: 128 ICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELI 187
           + +AR SD+FGR+T+LI+  VFY+VGTII+SQA +V R+A G+ FY +G  GV+L + LI
Sbjct: 121 VFFARLSDVFGRLTLLIVATVFYSVGTIIQSQAYDVQRYAAGAVFYNVGLVGVVLQVILI 180

Query: 188 AMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAFIVPLSAIPLG 245
             DFS+L WRLF +FVP+ PFIIN W+SGNV  A    ++W W IGMWAFI PL+ +PL 
Sbjct: 181 LSDFSSLRWRLFYTFVPSWPFIINMWVSGNVVNAANPLENWSWSIGMWAFIFPLTCLPLV 240

Query: 246 CCLLHMRWLAHKNAKDR-LKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILV 304
           CC+LHMR+ A K    R L+ E   Y+  G    ++ +F WKLD +G+LLL  T GCILV
Sbjct: 241 CCILHMRYRASKTEAWRHLQLEKTYYQSHGLLQTLIQLF-WKLDVVGVLLLTVTLGCILV 299

Query: 305 PFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALV 364
           P TLAGG+  KW   H+I P V+G+ V LPIF++WE K++  P+ P+ L+KDRG++ AL 
Sbjct: 300 PLTLAGGVSQKWNNPHVIAPFVLGF-VLLPIFVVWESKWALDPIAPFELLKDRGVWSALT 358

Query: 365 IAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTK 424
           I F I F++ M   Y+YT+L+++V+ES  SATRITS+YSF + +      LV+ + +R K
Sbjct: 359 IQFLIYFVYQMAVGYLYTILVIAVDESTTSATRITSVYSFTAAVASPFFALVVTRSKRLK 418

Query: 425 PFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHS 484
           P+II G S W +A G+L H+R            L L G  +  FTY    S+Q S+  H 
Sbjct: 419 PYIITGCSLWMVAMGILYHFRSGKDSDKGIIGGLVLWGLTSTLFTYPVTVSLQ-SITSHE 477

Query: 485 KMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRI-ANETLAAEAYGSPFTFILT 543
            MA +TAL   +Y I           IWT +L K++ K +  + TLA  AYGSPF FIL 
Sbjct: 478 NMASVTALNYTIYRIGGAVASAASGAIWTQLLYKKLLKEMNGDATLATAAYGSPFDFILD 537

Query: 544 YTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELE----- 598
           Y W TP R A+V SYRY QK   +V L F   +   ++FLR+  L    A   L+     
Sbjct: 538 YPWGTPMRDAMVESYRYVQKYEVLVALIFTVPMFILSMFLRDPPLTDDQAQENLKEGEYI 597

Query: 599 NTPNSDEQGSFADN 612
           NT + D   ++ D+
Sbjct: 598 NTEHDDPILAWMDD 611

>SAKL0G03300g Chr7 (268199..270049) [1851 bp, 616 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score =  468 bits (1203), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 262/584 (44%), Positives = 359/584 (61%), Gaps = 15/584 (2%)

Query: 20  EQTTEDSNQFNSSQLDSNQPDSNQPD-LKNYDLYHKDAGVNNIEVYAEQYSSPIYRVMLF 78
           E T  D+ +   ++L+    +   PD LK+     K   +   E+ A QY +  YR +L 
Sbjct: 15  EHTPSDNEKQTYNELN----EYGIPDKLKS----TKSLVIRKTEILAAQYDTWFYRSILL 66

Query: 79  FSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFG 138
           FS FL  Y YGLDGSVRY Y   AT+SY++HSLLS             QI YAR +D+FG
Sbjct: 67  FSAFLCGYGYGLDGSVRYIYTGYATNSYAEHSLLSTIAVINAVISAAAQIVYARLADVFG 126

Query: 139 RMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWRL 198
           R+ + I  ++FY VGTII+SQA +V R+A G+ FY  GY GV+L L LI  DFS+L WRL
Sbjct: 127 RLYLFITAVIFYVVGTIIQSQAYDVQRYAAGAVFYNTGYVGVVLVLLLILSDFSSLKWRL 186

Query: 199 FASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAFIVPLSAIPLGCCLLHMRWLAH 256
           F  FVP  PFIINTWI+G+++      ++W W I MWAFI PLSA+P+ CC+LHMR  A 
Sbjct: 187 FYQFVPTWPFIINTWIAGDITSRANPQENWSWDISMWAFIFPLSALPIICCMLHMRIKAR 246

Query: 257 KNAKDRLKSEFRT-YRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDK 315
           K  + ++ SE ++ Y+  G+   +V +F WKLD IG+L++  + GCILVP TLAGG   K
Sbjct: 247 KTPEWQVLSEEKSFYQTHGFIQTLVQLF-WKLDVIGVLIMTVSLGCILVPLTLAGGYSSK 305

Query: 316 WKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYM 375
           W+ + II P V+G+ V +P+++ WE K++K P+ P+ L+KDRG++ AL I+F I+FI+YM
Sbjct: 306 WQNSQIIGPIVLGF-VLIPMYIYWESKWAKEPMAPFKLLKDRGVWAALGISFLIDFIFYM 364

Query: 376 QGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWF 435
             DY+Y VL++ VN+S+KSA+RI+SL SFVS +      L+I +  R KP+II G S W 
Sbjct: 365 AADYLYAVLLIGVNQSVKSASRISSLSSFVSTVASPFFALIITRSTRLKPYIITGCSLWM 424

Query: 436 IAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALYLA 495
           +A GLL H+R            LC+ G G   FTY    S+Q SV  H  MA +TAL   
Sbjct: 425 LAMGLLYHFRGGSESYSGIVGALCVWGIGTTMFTYPVNVSVQ-SVTSHENMATVTALNYT 483

Query: 496 MYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPERQAVV 555
           +Y I           IWT  L K +  R+ +  LA  AY  P++FI+T+TW+TPER A+V
Sbjct: 484 LYRIGAAVGAAVSGAIWTQTLYKDLLNRLDDAALAMSAYSEPYSFIITHTWNTPERDAMV 543

Query: 556 VSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELEN 599
            SYRY Q++  IV L F   LL  + FLR+  L   VA   +E 
Sbjct: 544 QSYRYVQRLETIVALVFTVPLLVFSFFLRDPPLTDKVAQDNIEE 587

>NDAI0H00140 Chr8 complement(10247..12145) [1899 bp, 632 aa] {ON} 
          Length = 632

 Score =  466 bits (1200), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 258/592 (43%), Positives = 345/592 (58%), Gaps = 21/592 (3%)

Query: 30  NSSQLDSNQPDSN----QPDLKNYDLYHKDAGVNNIEVYAEQYSSPIYRVMLFFSLFLVA 85
               +++N+ D +     P  K      K   +   EV A  Y    Y V+L  S F+  
Sbjct: 28  KEKDIETNETDDDITIRSPPPK------KSLVIKQTEVMASVYDKWYYHVVLLVSAFICG 81

Query: 86  YAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGRMTILII 145
           Y YGLDG++RY Y   ATSSY++HSLLS             QI Y+R SD FGR  + +I
Sbjct: 82  YGYGLDGNIRYIYTGYATSSYAEHSLLSTVTVINAVVSAASQIVYSRLSDFFGRFILFVI 141

Query: 146 GLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWRLFASFVPA 205
            +V Y VGTII+SQA +V R+A G+ FY  GY GV+L L LI  DFS+L WRLF  F P 
Sbjct: 142 AIVLYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGVLLILLLILSDFSSLKWRLFYQFAPT 201

Query: 206 LPFIINTWISGNVSGAVGQ--HWKWGIGMWAFIVPLSAIPLGCCLLHMRWLAHKNAKDRL 263
            PFIINTWISGN++ A     HW W +GMWAFI PLS IP+  C++HM+W A K  + + 
Sbjct: 202 WPFIINTWISGNITLAANPLVHWSWDVGMWAFIFPLSCIPMLLCMIHMQWKASKTEEWKE 261

Query: 264 KSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIV 323
             + ++Y +       +    W+LD IG+LL+ A  GCILVP TLAGG++ KW    II 
Sbjct: 262 LKKEKSYYEKHGLLLTLKELFWRLDIIGVLLMVAWLGCILVPLTLAGGVKSKWNDGRIIG 321

Query: 324 PEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTV 383
           P V+G+ V +PIF  WE  F++ PL P+ALIKDRG++ ++ I+F I+FI+YM  DY+YTV
Sbjct: 322 PFVLGF-VLVPIFAAWEYFFARDPLIPYALIKDRGVWASMGISFLIDFIFYMASDYLYTV 380

Query: 384 LIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLLVH 443
           LIV+V+ES+KSATRI+SL SFVS +      L++ +  R KPFI+ G S W ++ GLL H
Sbjct: 381 LIVAVHESVKSATRISSLSSFVSTVASPFFALLLTRCSRLKPFIMVGCSLWMLSMGLLYH 440

Query: 444 YRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALYLAMYNIXXXX 503
           +R            LC+ G G   FTY    S+Q++   H  MA +TA+    Y +    
Sbjct: 441 FRGGEQSHSGIIGALCVWGIGTTLFTYPVNVSVQSATS-HENMATVTAINYTCYRLGSAI 499

Query: 504 XXXXXXXIWTNVLPKQISKRI-----ANE--TLAAEAYGSPFTFILTYTWDTPERQAVVV 556
                  IWT  L   I KR+     A E  T+A EAY SP+TFI  YTW TP R AVV 
Sbjct: 500 GAAVSGAIWTQKLYPDILKRVTEVVGATEAVTIATEAYSSPYTFITKYTWGTPVRDAVVE 559

Query: 557 SYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELENTPNSDEQGS 608
           SYRY Q++  IV L FC  L+  +L LR+ KL   +A   ++      ++ S
Sbjct: 560 SYRYIQRLETIVALVFCVPLIIFSLCLRDAKLTDEIAHENIKEGEYVSKEDS 611

>KLTH0D00506g Chr4 (47320..49170) [1851 bp, 616 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 616

 Score =  465 bits (1196), Expect = e-157,   Method: Compositional matrix adjust.
 Identities = 262/588 (44%), Positives = 366/588 (62%), Gaps = 12/588 (2%)

Query: 20  EQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNI-----EVYAEQYSSPIYR 74
           E+ T    Q ++  ++++  DS++ +L  Y L  K     +I     E+ A QY S  YR
Sbjct: 4   EKETATGVQSSAYPIEADDKDSHR-ELNEYGLPDKLRVTRHIVIKKTEILAAQYDSWYYR 62

Query: 75  VMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARAS 134
           V+L F+ F+  Y YGLDG++RY Y   AT++YS+HSLLS             Q+ YAR +
Sbjct: 63  VILLFAAFICGYGYGLDGNIRYIYTGYATNAYSEHSLLSTIGVVNNVIGAASQLVYARLA 122

Query: 135 DIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNL 194
           D FGR+++ I  +VFYAVGTII+SQA +V R+A G+ FY +GY GVIL L L+  DFS+L
Sbjct: 123 DTFGRLSLFITAIVFYAVGTIIQSQAYDVQRYAAGAVFYNIGYVGVILVLLLMLSDFSSL 182

Query: 195 NWRLFASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAFIVPLSAIPLGCCLLHMR 252
            WRL  + VP  PFIINTWISGN++ A     +W W IGMWAFI PLS +PL  C++HMR
Sbjct: 183 RWRLLYTIVPTWPFIINTWISGNITSAAKPETNWSWDIGMWAFIFPLSCVPLIACMIHMR 242

Query: 253 WLAHKNAK-DRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGG 311
             A K  +   LK E   ++  G +  +V++F WKLD +G+LLL AT GCILVP TLAGG
Sbjct: 243 IKARKTPEWIALKQEKSYFQTNGLWDTLVELF-WKLDVVGVLLLIATLGCILVPLTLAGG 301

Query: 312 LQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINF 371
              KW   HII P V+G+ V +PI + WE+++++ PL P+ LIKDRG++ AL I+F   F
Sbjct: 302 YNSKWNNPHIIGPFVLGF-VLVPILMFWEMRWARDPLVPYGLIKDRGVWSALAISFLNYF 360

Query: 372 IWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGV 431
           I+ +   Y+Y +L+V+V+ES+KSATRI+SL SFVSV+   +  L I + ++ KP+I+ G 
Sbjct: 361 IFALAAGYLYAILLVAVDESVKSATRISSLSSFVSVVWSPIFSLFITRQKKLKPYIVLGC 420

Query: 432 SCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITA 491
           + W +  GLL HYR            LC+ G G+  +TY    S+Q++   H  +A +TA
Sbjct: 421 AMWMVGIGLLYHYRGGSYAHSGIIGALCVWGAGSTMWTYPVNISVQSATS-HENLATVTA 479

Query: 492 LYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPER 551
           L   +Y I           IWT  L KQ+ KR+ +  LAA AY SP+TFI++Y W TP+R
Sbjct: 480 LNYTLYRIGGAVGTAVSGAIWTQTLYKQLLKRLGDADLAAAAYASPYTFIVSYAWGTPQR 539

Query: 552 QAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELEN 599
           +AVV +YR+ Q+   IV L FC+ L+  A+ LR+  L   VA S LE 
Sbjct: 540 EAVVGAYRHVQRYETIVALVFCAPLVIFAMCLRDPDLTDEVAHSGLEK 587

>TPHA0K02330 Chr11 (506158..508053) [1896 bp, 631 aa] {ON} 
          Length = 631

 Score =  456 bits (1173), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 256/618 (41%), Positives = 356/618 (57%), Gaps = 22/618 (3%)

Query: 3   SSSDSK--FDGK--INETVLQEQTTEDSNQFNSSQLDSNQPDSNQ-PDLKNYDLYHKDAG 57
           SSSD+K  +  K  +NE + + QT  D  + N         D N  P      +      
Sbjct: 2   SSSDAKDTYSEKHSVNENIAEFQTDSDGEKKNIQNQSFQDIDENDVPKTAKRAMV----- 56

Query: 58  VNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXX 117
           +   E+ A QY+   + + L F+ F+  Y YGLDG++RY Y   ATSSY++HSLLS    
Sbjct: 57  IRKTEIMAAQYNKWYHHLFLLFTAFICGYGYGLDGNIRYIYTGYATSSYAEHSLLSTVTV 116

Query: 118 XXXXXXXXGQICYARASDIFGRMTIL-IIGLVFYAVGTIIESQATNVTRFAVGSCFYQLG 176
                    QI       +FGR+ I+ ++ +V Y+VGTII+SQA +V R+A G+ FY  G
Sbjct: 117 INAVVSAVSQIYTPDFQIVFGRLYIIFLVAIVLYSVGTIIQSQAYDVQRYAAGAIFYNAG 176

Query: 177 YTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWA 234
           Y+GV+  L +I  DFS+L WRL   F P  PFIINTWISGN++ A    ++W W IGM A
Sbjct: 177 YSGVLFILLIILSDFSSLKWRLAYQFAPTWPFIINTWISGNITSAANPIENWSWDIGMRA 236

Query: 235 FIVPLSAIPLGCCLLHMRWLAHKNA--KDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGL 292
           FI+PLS +P   C++HM W A K    K+ LK +       G +  +V++F W+LD  GL
Sbjct: 237 FIIPLSCLPFIACMIHMEWKARKTPEWKELLKEKTFYEEHNGLWGTLVELF-WRLDVAGL 295

Query: 293 LLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWA 352
           +L+ ++ GCILVP TLAGG   KW   ++I P ++G+ V +P F LWE  F++ PL P  
Sbjct: 296 ILMGSSLGCILVPLTLAGGTSSKWNHGNVIGPFILGF-VLIPFFALWEKFFARDPLLPAK 354

Query: 353 LIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTL 412
           L+KDRG++ A+ I+F I+FI+YM  DY+YTVLIV+V+ES+KSATRI+SL SFVS +    
Sbjct: 355 LVKDRGVWSAMGISFLIDFIYYMAADYLYTVLIVAVDESVKSATRISSLSSFVSTVASPF 414

Query: 413 LGLVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTT 472
             L + +  R KP+I+ G S W +A GLL ++R            LC+ G G   FTY  
Sbjct: 415 FALYLTRCSRLKPWIMLGCSLWMLAMGLLYYFRGGRESHSGIIGALCVWGVGTTLFTYPV 474

Query: 473 QASIQASVKYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAE 532
             S+QA+V  H  MA +TA    +Y I           IWT  L KQ+ K + +  LA  
Sbjct: 475 TVSVQAAVS-HENMATVTAANYTLYRIGSAIGAAVSGAIWTQTLYKQLYKHLQDIALATA 533

Query: 533 AYGSPFTFILTYTWDT-PERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESV 591
           AY SP+TF   Y W T PER+AVV +YRY Q++  +V L FC  L+  +L LR+ +L   
Sbjct: 534 AYSSPYTFTTNYAWGTPPEREAVVQAYRYVQRLETVVALVFCVPLIAFSLCLRDARLTDE 593

Query: 592 VA---LSELENTPNSDEQ 606
           VA   ++E E    SD  
Sbjct: 594 VAHGNIAEGEIIVKSDSD 611

>SAKL0F00792g Chr6 (70444..72297) [1854 bp, 617 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 617

 Score =  453 bits (1165), Expect = e-152,   Method: Compositional matrix adjust.
 Identities = 247/589 (41%), Positives = 347/589 (58%), Gaps = 15/589 (2%)

Query: 20  EQTTEDSNQFNSSQLDSNQP------DSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPIY 73
             + +D  ++    +D  +P      D N PD        K   +   E+ A QY S  Y
Sbjct: 6   SSSAQDVVEYKDIVIDCEKPLTNGDSDGNVPDRLRVT---KSLVIRKTEILAAQYDSWYY 62

Query: 74  RVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARA 133
           RV+L FS F+  + YGLD ++RY Y   ATSSY+QHSLLS             QI YAR 
Sbjct: 63  RVILLFSAFICGFGYGLDSNIRYIYTGYATSSYAQHSLLSTVAIINNLLSAASQIFYARL 122

Query: 134 SDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSN 193
           SD+FGR+++ ++ +VFY +GTII+SQA +V ++A G+ FY +GY G+ L L LI  D S+
Sbjct: 123 SDVFGRLSLFVVSMVFYVIGTIIQSQAYDVQKYAAGAVFYNIGYVGLFLILVLILSDCSS 182

Query: 194 LNWRLFASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAFIVPLSAIPLGCCLLHM 251
           L WRLF  + P  PFII TWISGN+       ++W WGIGMWAFI PL+ +P+  C+LHM
Sbjct: 183 LKWRLFYQYAPTWPFIIITWISGNIISRANPIENWSWGIGMWAFIFPLTCLPILFCMLHM 242

Query: 252 RWLAHKNAK-DRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAG 310
           R+ A K  +   L S+   ++  G    +V +F WKLD +G+ ++  + GCILVP TLAG
Sbjct: 243 RFKARKTPEWQDLSSQKSFFQTHGIVQALVQLF-WKLDVVGIFIMTISLGCILVPLTLAG 301

Query: 311 GLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHIN 370
           G   KW+ + II P V+G+ V +P+F+ WE K++K PL P+ L+KDRGI+ ++   F ++
Sbjct: 302 GSSSKWQNSEIIGPLVLGF-VLVPVFIYWESKWAKDPLAPFELLKDRGIWASMCFNFLMD 360

Query: 371 FIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFG 430
           F++ M   Y+Y VLIV+V+ES KSATRITSL SFVS +    +G  + +  R KP+I+ G
Sbjct: 361 FVYCMAAGYLYPVLIVAVDESTKSATRITSLASFVSTVASPFMGYAVSRSTRLKPYIVSG 420

Query: 431 VSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVIT 490
              WF+A GLL HYR            L LLG G     Y    S Q S+  H  MA +T
Sbjct: 421 CGMWFLATGLLYHYRSGLESHSGIIGGLVLLGLGCTLSIYPINVSAQ-SLTSHENMASVT 479

Query: 491 ALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPE 550
           AL   +Y I           IWT  L   + KR+ + TLA  AY +P++F+LTY WDTP 
Sbjct: 480 ALNYTVYRIGGAVGVAVSGAIWTQTLYNDLLKRLGDATLAMSAYSAPYSFVLTYGWDTPV 539

Query: 551 RQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELEN 599
           RQAVV +YR  Q++  ++ L F + LL ++LFLR+  L   V    +++
Sbjct: 540 RQAVVEAYREVQRLEVLIALIFTAPLLLSSLFLRDPPLTDQVGQENIKD 588

>ZYRO0G07414g Chr7 complement(583978..586101) [2124 bp, 707 aa] {ON}
           similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 707

 Score =  452 bits (1164), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 241/561 (42%), Positives = 346/561 (61%), Gaps = 13/561 (2%)

Query: 58  VNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXX 117
           +   E+ A +Y    +R++L F  F+  Y YGLD ++R+ Y +  T+S+S+HSLLS    
Sbjct: 79  IRQSELLAAEYDWWPFRILLLFCAFICGYGYGLDSNIRFIYTSYVTNSFSEHSLLSTVNV 138

Query: 118 XXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGY 177
                    QI YAR +D+FGR+T+ I  +VFY++GT+I+SQ+ N+  +A GS FY LGY
Sbjct: 139 INAVISAASQIVYARLADVFGRLTLFITAVVFYSMGTVIQSQSYNIETYAAGSIFYNLGY 198

Query: 178 TGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAF 235
            GV+L L LI  DFS+L WRLF  F P  PFIINTWISGN++      ++W W IGMWAF
Sbjct: 199 VGVVLVLLLILSDFSSLKWRLFYQFAPTWPFIINTWISGNITSRANPQENWSWDIGMWAF 258

Query: 236 IVPLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRTY-RDMGWFAYIVDVFLWKLDFIGLLL 294
           I PLS +PL CC+LHM W A +  + ++ +E +TY +  G  ++I ++F WKLD IG  +
Sbjct: 259 IFPLSCVPLICCMLHMWWKARRTEEWKILNEEKTYFKTHGLVSFIKELF-WKLDTIGTFI 317

Query: 295 LCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALI 354
           +  + GCILVP TLAGG   KW  + II P V+G  V LP+ +++E+K+++ P+ PW LI
Sbjct: 318 MTVSLGCILVPLTLAGGTSSKWDDSQIIGPLVLG-VVLLPMLIVYELKWAREPILPWKLI 376

Query: 355 KDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLG 414
           KDR ++ ++ I+F  +FI+YM  DY+YTV+IV+V+ES+KSATRI+SL +FVS +      
Sbjct: 377 KDRAVWASMSISFLYDFIFYMAYDYLYTVMIVAVDESVKSATRISSLSAFVSTVFSPFFA 436

Query: 415 LVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQA 474
           L I +V R KP+II G   W +A GLL H+R            LC+ G G   FTY    
Sbjct: 437 LYITRVTRLKPYIIAGCGLWMVAMGLLYHFRGGKSSHSGIIGGLCVWGVGTTMFTYPVNV 496

Query: 475 SIQASVKYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAY 534
           S+Q++   H  MA +T+L   +Y I           IWT  L  +I KR+ +  +A+ AY
Sbjct: 497 SVQSATS-HENMATVTSLNYTLYRIGSAVGIAVSGCIWTQNLYHEIFKRVKDAKIASYAY 555

Query: 535 GSPFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVAL 594
             P+ FI  YTW TP RQ VV +Y + QK+  +VGL FC+ LL  +L LR+ +L   +A 
Sbjct: 556 EQPYNFIAEYTWGTPIRQQVVEAYMHVQKLETLVGLVFCAPLLLFSLCLRDPELTDEIAH 615

Query: 595 SELENTPNSDEQGSFADNDKN 615
           ++L        +G +   DK+
Sbjct: 616 NDL-------GEGEYIARDKD 629

>KLTH0D18150g Chr4 complement(1502817..1504640) [1824 bp, 607 aa]
           {ON} similar to uniprot|P38731 Saccharomyces cerevisiae
           YHL040C ARN1 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to ferrirubin ferrirhodin and related siderophores
          Length = 607

 Score =  442 bits (1136), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 246/598 (41%), Positives = 340/598 (56%), Gaps = 26/598 (4%)

Query: 34  LDSNQPDSNQPDLKN---YDLYHKDAG----------VNNIEVYAEQYSSPIYRVMLFFS 80
           +  +   S   DLKN    D+     G          +   E+ A QY    +  ++ FS
Sbjct: 1   MSKDNASSAHADLKNEVYVDVEKVTPGCTLKTTKSLVIRKTEIMAAQYDRWYHHAIILFS 60

Query: 81  LFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGRM 140
            F+  Y YGLDGSVRY Y + A SSYS H L+S             QI +AR SD+FGR+
Sbjct: 61  AFICGYGYGLDGSVRYVYTSYAVSSYSDHPLISTITVVTAIISAASQIVFARLSDVFGRL 120

Query: 141 TILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWRLFA 200
           ++ I  L+FYAVGTII+SQAT+V ++A G+ F+  GY G++L L LI  DFS+L WRL  
Sbjct: 121 SLFITALLFYAVGTIIQSQATDVQKYAAGAIFWSTGYVGLLLILILILSDFSSLRWRLVY 180

Query: 201 SFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAFIVPLSAIPLGCCLLHMRWLAHKN 258
            F P+ P+IINTW +G V+      +HW W I MWAFIVPLSA+P+  C+LHMR+ A K 
Sbjct: 181 QFAPSWPYIINTWFAGTVTARANPQEHWSWDIAMWAFIVPLSALPMIFCMLHMRFKARKT 240

Query: 259 AK-DRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWK 317
            +   +K E   ++  G    +V++F WKLD +G+LL+  + GCIL P TLAGG++ KW 
Sbjct: 241 EQWAAIKDEKSFFQSHGLIRTLVELF-WKLDIVGVLLMTISVGCILAPLTLAGGVKSKWS 299

Query: 318 TAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYMQG 377
             H+I P V+G+ V LP+F++WE K +K P+ P+ LIKDR ++ AL   F I FI+    
Sbjct: 300 NPHLIGPLVLGF-VLLPLFMIWESKAAKYPVVPYGLIKDRAVWGALGCQFLIGFIYNAVA 358

Query: 378 DYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIA 437
            Y+YT+LIV+VNES+KSAT I+SL SFVS +  T   L I +  + K +II G   W +A
Sbjct: 359 GYIYTILIVAVNESVKSATVISSLSSFVSTVASTFFSLYITRCTKLKGYIIGGCGIWMLA 418

Query: 438 FGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALYLAMY 497
            GL  HYR            + + G G     Y T  S+Q++   H  MA +TAL   +Y
Sbjct: 419 MGLFYHYRGGEFAHSGIVGAMVIWGLGDTLLIYPTTISVQSATS-HDNMATVTALNYTLY 477

Query: 498 NIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPERQAVVVS 557
            I           IW+  L K +  R+ +   A+ AY +PF FILTYTW TPER A+V +
Sbjct: 478 RIGLATGAAVSGAIWSQTLYKALLSRLQSVEQASAAYSTPFEFILTYTWGTPERNAMVDA 537

Query: 558 YRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELENTPNSDEQGSFADNDKN 615
           YR+ Q+   IV L F   LL   L LR+  L   VA  ++++       G F D + +
Sbjct: 538 YRHVQRYESIVALVFTVPLLFFGLCLRDPPLTDKVAQEDIDD-------GEFLDKNHD 588

>Kwal_56.22298 s56 (31819..33651) [1833 bp, 610 aa] {ON} YHL040C
           (ARN1) - Product of gene unknown [contig 187] FULL
          Length = 610

 Score =  425 bits (1092), Expect = e-141,   Method: Compositional matrix adjust.
 Identities = 236/586 (40%), Positives = 331/586 (56%), Gaps = 14/586 (2%)

Query: 23  TEDSNQFNSSQLDSNQPDS------NQPDLKNYDLYHKDAGVNNIEVYAEQYSSPIYRVM 76
           T D   FN   L   + ++      N P  K      K   +   E+ A  Y    + V 
Sbjct: 2   TFDKEGFNVETLADEEKNNLGVSQHNDPIKKLQST--KSLNIRKTELMASCYDRWYHHVF 59

Query: 77  LFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDI 136
           L F+ FL  Y YGLDG++R  Y + A +SY+ H L+S             QI +AR SD+
Sbjct: 60  LLFAAFLCGYGYGLDGNIRSVYTSYAAASYAAHPLISTLSVVTGVMSAASQIFFARLSDV 119

Query: 137 FGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNW 196
           FGR+++ +  + FY VGTII+SQA ++ R+AVGS F+ +GY G++L L LI  DFS+L W
Sbjct: 120 FGRLSLFVTAIAFYVVGTIIQSQAYDIQRYAVGSVFWSIGYVGILLMLILIVSDFSSLRW 179

Query: 197 RLFASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAFIVPLSAIPLGCCLLHMRWL 254
           RL   F P+ P IINTWI+G ++      + W W IGMWAFI+PL+ +P+  C+LHMR+ 
Sbjct: 180 RLLYQFAPSWPGIINTWIAGTITARSNPQEKWSWNIGMWAFIIPLTCLPMILCMLHMRFK 239

Query: 255 AHKNAK-DRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQ 313
           A +  +   L++E   Y+  G    ++++F WK+D +G+LL+ A+ GC+L P TLAGG  
Sbjct: 240 ARRTEQWAELRNERSYYQTHGLIKTLIELF-WKVDVVGILLMTASIGCVLAPLTLAGGTG 298

Query: 314 DKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIW 373
            KW+   +I P V+G+ V LPIFL+WE K+++ P+ P+ LIKDR ++ +L   F I FI+
Sbjct: 299 SKWQNPRVISPFVLGF-VLLPIFLIWEKKWARDPIIPYDLIKDRAVWASLNSQFLIGFIY 357

Query: 374 YMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSC 433
            M   Y+Y +LIV VNESIKSAT IT L SFV+        L I +  R K +I+ G   
Sbjct: 358 MMAAGYIYNILIVGVNESIKSATTITILSSFVATAASPPFCLWITRCTRMKGYIVAGCGL 417

Query: 434 WFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALY 493
           W +A GL  HYR            + + G G     Y    S+Q++   H  MA++TAL 
Sbjct: 418 WMLAMGLFYHYRGGEFAHGGIVAAMVVWGLGDVLLIYPITVSVQSATS-HDNMAMVTALN 476

Query: 494 LAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPERQA 553
              Y I           IWT  L K++ KR+ + TLA  AY  PF FI TYTW TPER+A
Sbjct: 477 YTTYRIGLSTGSAISGAIWTQTLYKELFKRLGDATLAVSAYSDPFKFITTYTWGTPEREA 536

Query: 554 VVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELEN 599
           VV +YR+ Q+   IV L F   LL   LFLR+  L   VA   +++
Sbjct: 537 VVQAYRHVQRYETIVALVFTVPLLIFVLFLRDPPLTDEVAHGSIKD 582

>TDEL0H00130 Chr8 complement(10267..12132) [1866 bp, 621 aa] {ON} 
          Length = 621

 Score =  424 bits (1089), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 235/595 (39%), Positives = 335/595 (56%), Gaps = 18/595 (3%)

Query: 3   SSSDSKF-DGKINETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNI 61
           S+SD  F  G +NE    ++ T D         +   PD  +          K   +   
Sbjct: 9   SASDKGFHSGSVNEA---KKITVDEKMVAEPLDEYGMPDKLK--------VTKSLVIRKA 57

Query: 62  EVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXX 121
           E+ A+QY +   + +  FS FL ++ YGLDG++R  Y   A +SYS HSL+S        
Sbjct: 58  ELMAKQYDTWFLKSLFLFSAFLCSFGYGLDGNIRGIYMTYAMNSYSTHSLISTVGVISMV 117

Query: 122 XXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVI 181
                Q+ YA  SD+FGR+++ I+ +VFY VGTII+SQA +V R+A GS FY +G  GV+
Sbjct: 118 ISAVAQVIYAGLSDVFGRLSLFIVSIVFYVVGTIIQSQAYDVQRYAAGSVFYSVGLVGVM 177

Query: 182 LSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNV--SGAVGQHWKWGIGMWAFIVPL 239
           L + L+  D S+L WRLF +FVPA P II TW+SGNV  +     +W W I MWAFI PL
Sbjct: 178 LQVILVLSDNSSLKWRLFYTFVPAWPSIITTWVSGNVIETANPEDNWSWNIAMWAFIFPL 237

Query: 240 SAIPLGCCLLHMRWLAHKNAK-DRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCAT 298
           S IPL  C+LHMRW      +   L++E   Y+  G    +V +F WKLD +G++LL   
Sbjct: 238 SCIPLIACMLHMRWKVRNEPEWKELQTEKTYYQSHGLIQTVVQLF-WKLDVVGIILLTVG 296

Query: 299 FGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRG 358
            GCILVP TLAGG+  +W++A +I P V+G+ V + IF+ WE K +  P+ P+ ++KDRG
Sbjct: 297 TGCILVPLTLAGGVSTQWQSAKLIAPFVLGF-VLIAIFIYWESKLALAPIAPFKMLKDRG 355

Query: 359 IFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVII 418
           I+  L I F I F++ M   Y+YT+L+V+V+E+  SATRITSLYSFVS I   +LG ++ 
Sbjct: 356 IWAPLWIMFLIAFVYQMAAGYLYTILMVAVDETDLSATRITSLYSFVSAIFAPVLGFIVA 415

Query: 419 KVRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQA 478
           +  R KP+++ G S +F+  GL   YR            + + G  +  F Y    SIQ 
Sbjct: 416 RSSRLKPYMVLGCSLYFVTMGLFYRYRVGKDAHQGVIGAMVVWGICSCLFDYPVTVSIQ- 474

Query: 479 SVKYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPF 538
           SV  H  MA +TAL   +++I           IWT +L  ++ + I +  LA  AY SP 
Sbjct: 475 SVTSHENMATVTALSYTIFSIGGAVAASVSGAIWTQLLYPKLLEYIGDADLAEAAYSSPL 534

Query: 539 TFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVA 593
           TF L Y W TP R A+V +Y++ QK   ++ L F + +      LR+  L   VA
Sbjct: 535 TFYLDYPWGTPIRDAMVEAYKHVQKYEVLIALVFTAPMFILTFCLRDPSLTDDVA 589

>Kwal_34.15711 s34 (21213..23069) [1857 bp, 618 aa] {ON} YHL047C
           (ARN2) - 1:1 [contig 275] FULL
          Length = 618

 Score =  420 bits (1080), Expect = e-139,   Method: Compositional matrix adjust.
 Identities = 221/576 (38%), Positives = 325/576 (56%), Gaps = 4/576 (0%)

Query: 15  ETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPIYR 74
            + LQ+  +E   + N ++   ++  ++Q  L +     K   +   E+ A QY +   +
Sbjct: 10  SSALQDDHSEIDGKTNVAEKQCDKDATHQHGLTDKLQMTKRIVIRKTELMANQYDNWFLK 69

Query: 75  VMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARAS 134
            +  FS F+ A++YGLD  +R  Y   A +SYS HSLLS             QI +A  S
Sbjct: 70  SLFLFSAFICAFSYGLDSIIRNIYMTYAMNSYSTHSLLSTVSVISLTISAVAQIFFAGLS 129

Query: 135 DIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNL 194
           D+FGR+++ I+ ++FY VGTII+SQA +V R+A GS FY +G  G +  + LI  D S+L
Sbjct: 130 DVFGRLSMFIVAIMFYVVGTIIQSQAYDVQRYAAGSIFYYIGLVGSMFEITLILSDCSSL 189

Query: 195 NWRLFASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAFIVPLSAIPLGCCLLHMR 252
            WRLF SFVPA P ++  WISGNV       ++W WGI MWAFI P S +P+  CLLHMR
Sbjct: 190 KWRLFYSFVPAWPALVTVWISGNVVSVANPLENWSWGIAMWAFIFPASCLPIIGCLLHMR 249

Query: 253 WLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGL 312
           W    N +     E +TY         +    WKLD +G+LL   + GCILVP TLAGG 
Sbjct: 250 WKLRNNPEWIELQEEKTYFQTHGLVQTLKQLFWKLDVVGVLLFSISTGCILVPLTLAGGA 309

Query: 313 QDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFI 372
             +W++A +I P V+G+ + +P+F+ WE K + VPL P+ ++KDRGI+  LVI F I +I
Sbjct: 310 STQWRSAKVIAPFVLGFLL-VPVFIYWESKLALVPLAPFKMLKDRGIWAPLVITFLICYI 368

Query: 373 WYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVS 432
           + M   Y+YT+L+V+ NES  SATRITSLYSFV+ +   ++G+ + +  R KPF +FG S
Sbjct: 369 YMMAAGYLYTILVVAGNESPLSATRITSLYSFVAAVFSPVVGIFVARFTRLKPFAVFGCS 428

Query: 433 CWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITAL 492
            +F+   L  H+R            + + G  + FF Y    S+Q +V  H  MA +TA 
Sbjct: 429 LYFVTMALFYHFRGGTDTGKGVIGAMVIWGITSCFFNYPINISMQ-TVTSHENMATVTAF 487

Query: 493 YLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPERQ 552
            L ++ I           IWT  L  ++ K + +  +A EAY  P +F+L + W T  R+
Sbjct: 488 GLTIFRIGGAVGAAVSGAIWTQSLYPRLLKTLGDPNMAIEAYSMPLSFVLKHEWGTSARE 547

Query: 553 AVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKL 588
            +V +YRY Q+   +VGL F + +     FLR+  L
Sbjct: 548 GMVEAYRYVQRYEVLVGLIFVAPMFLLTFFLRDPPL 583

>KLLA0C00220g Chr3 (13632..15506) [1875 bp, 624 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 624

 Score =  419 bits (1077), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 224/573 (39%), Positives = 330/573 (57%), Gaps = 10/573 (1%)

Query: 19  QEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPIYRVMLF 78
           +E   E  N+ +       Q       +K      K   +   E+ A QY++   +V+  
Sbjct: 22  KEGAAEKINEMDEDSKKGVQFSGVCDGMKQ----TKSLVIRKTEIMASQYNTWYSQVLFL 77

Query: 79  FSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFG 138
              FL AY Y LD S+RY Y   AT+SY+ HSLLS             Q+ +A  SD+FG
Sbjct: 78  SCAFLCAYGYSLDSSIRYVYMTYATNSYNTHSLLSTISIINMMISAVAQLFFAGLSDVFG 137

Query: 139 RMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWRL 198
           R+ ++I+ ++FY VGT+I+SQA ++ R+A GS FY +G  GV+L + L   D S+L WRL
Sbjct: 138 RLRLMIVAILFYVVGTVIQSQAYDIQRYAAGSVFYNIGVVGVMLQVSLFLADNSSLKWRL 197

Query: 199 FASFVPALPFIINTWISGNVSGAVGQ--HWKWGIGMWAFIVPLSAIPLGCCLLHMRWLAH 256
             SFVPA P IIN W+SGN+  A     +W W I MWAFI+PLS +PL CC++HMRW A 
Sbjct: 198 LYSFVPAWPAIINMWVSGNIVKAANPLVNWSWNIAMWAFILPLSCVPLLCCVVHMRWKAS 257

Query: 257 KNAK-DRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDK 315
           K  +   L+SE   Y+  G+   IV+VF WK+D +GLLLL A+ GCILVP T+AGG+ ++
Sbjct: 258 KTPEWQELESELTFYQKHGFVHTIVEVF-WKVDIVGLLLLTASMGCILVPLTIAGGISEQ 316

Query: 316 WKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYM 375
           W    II P V+G    +P+ + WE  ++KVP  P+ L+KDRGI+  + I F + FI+ M
Sbjct: 317 WNNGKIIGPLVLG-VFLVPLTIYWESNWAKVPFAPFLLLKDRGIWAPMSIMFLVCFIYQM 375

Query: 376 QGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWF 435
              Y+YT+L+VS+N++  SATRI +LYSFV+ I   + G V+ +  R K F++ G   +F
Sbjct: 376 AAGYLYTILLVSMNQTELSATRIMNLYSFVAGIYSPIFGFVVARTGRLKSFMLVGCCLYF 435

Query: 436 IAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALYLA 495
           +  GL   YR            + + G  +  +TY    S Q SV  H  MA +TA+ L 
Sbjct: 436 LVMGLFYRYRGGLGAESGIIGAMVVWGIASCMYTYPVTTSAQ-SVTSHENMATVTAMLLT 494

Query: 496 MYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPERQAVV 555
           ++ I           IWTN+L  ++ + + +  LA+ AY +P TFI+++ W+T  R A++
Sbjct: 495 IFRIGGAVGASVSGAIWTNLLYPKLLQNLGDVELASAAYTAPLTFIVSHPWNTEVRTAMI 554

Query: 556 VSYRYTQKILCIVGLCFCSTLLGAALFLRNHKL 588
            +YR+ QK   +VGL F + +L     LR+ +L
Sbjct: 555 DAYRHVQKYEVLVGLIFVAPMLVLTFCLRDPEL 587

>YHL047C Chr8 complement(8351..10213) [1863 bp, 620 aa] {ON}
           ARN2Transporter, member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates; responsible for uptake of
           iron bound to the siderophore triacetylfusarinine C
          Length = 620

 Score =  416 bits (1070), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 233/611 (38%), Positives = 339/611 (55%), Gaps = 14/611 (2%)

Query: 12  KINETVLQEQTTEDSNQFNSSQL--DSNQPDSNQP--DLKNYDLYHKDAGVNNIEVYAEQ 67
           ++ E     QT   + + N ++L  D    D + P  ++K+     K   +   E+ A++
Sbjct: 3   EVPEDNRSSQTKRKNTEKNCNELMVDEKMDDDSSPRDEMKDKLKGTKSLIIRKSELMAKK 62

Query: 68  YSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQ 127
           Y +   + +  FS F+  +AYGLD S+R TY   A +SYS HSL+S             Q
Sbjct: 63  YDTWQLKAIFLFSAFICTFAYGLDSSIRGTYMTYAMNSYSAHSLISTVSVIVLMISAVSQ 122

Query: 128 ICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELI 187
           + +   SDIFGR+T+ ++ +V Y VGTII+SQA +V R+A G+ FY +G  GV+L + L+
Sbjct: 123 VIFGGLSDIFGRLTLFLVSIVLYIVGTIIQSQAYDVQRYAAGAVFYYVGLVGVMLQVVLM 182

Query: 188 AMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAFIVPLSAIPLG 245
             D S+L WRLF + +P+ P II TW+SG+V  A    ++W W I MWAFI PL  IPL 
Sbjct: 183 LSDNSSLKWRLFYTLIPSWPSIITTWVSGSVVEAANPLENWSWNIAMWAFIFPLCCIPLI 242

Query: 246 CCLLHMRWLAHKNAK-DRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILV 304
            C+LHMRW    + +   L+ E   Y+  G    +V +F WKLD +G+LL  A  GCILV
Sbjct: 243 LCMLHMRWKVRNDVEWKELQDEKSYYQTHGLVQMLVQLF-WKLDVVGVLLFTAGVGCILV 301

Query: 305 PFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALV 364
           P TLAGG+   W+ + II P V+G+ V +P F+ WE + + VP  P+ L+KDRG++  L 
Sbjct: 302 PLTLAGGVSTNWRNSKIIGPFVLGF-VLVPGFIYWESRLALVPFAPFKLLKDRGVWAPLG 360

Query: 365 IAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTK 424
           I F I F++ M   Y+YT+L+V+V+ES  SATRI +LYSFV+ +    LGL++ +  R K
Sbjct: 361 IMFFICFVYQMAAGYLYTILVVAVDESASSATRIINLYSFVTAVVAPFLGLIVTRSSRLK 420

Query: 425 PFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHS 484
            +IIFG S +FI  GL   YR            + + G  +  F Y T  SIQ SV  H 
Sbjct: 421 SYIIFGGSLYFITMGLFYRYRSGQDADGGIIAGMVIWGLSSCLFDYPTIVSIQ-SVTSHE 479

Query: 485 KMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTY 544
            MA +TAL   ++ I           IWT  L  ++   + +  LA  AYGSP TFIL+ 
Sbjct: 480 NMATVTALNYTVFRIGGAVAAAISGAIWTQSLYPKLLHYMGDADLATAAYGSPLTFILSN 539

Query: 545 TWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELENTPNSD 604
            W TP R A+V +YR+ QK   IV L F + +      +R+ +L    A    +  P+ +
Sbjct: 540 PWGTPVRSAMVEAYRHVQKYEVIVALVFSAPMFLLTFCVRDPRLTEDFA----QKLPDRE 595

Query: 605 EQGSFADNDKN 615
              +  D+  N
Sbjct: 596 YVQTKEDDPIN 606

>KLTH0D00110g Chr4 (796..2658) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score =  416 bits (1068), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 220/589 (37%), Positives = 326/589 (55%), Gaps = 18/589 (3%)

Query: 2   TSSSDSKFDGKINETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNI 61
           + S+ ++  GK N    +++ + DS               N+P+L +     K   +   
Sbjct: 13  SESTPNENYGKANVVQTEKEFSHDSK--------------NEPELGDKLQITKRIVIRKA 58

Query: 62  EVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXX 121
           E+ A QY   + + M  FS F+ A++YGLD  +R  Y   A + Y  HSLLS        
Sbjct: 59  ELMANQYDGWLLKSMFLFSAFICAFSYGLDSIIRSIYMTYAMNDYQTHSLLSTVSVISLT 118

Query: 122 XXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVI 181
                QI +A  SD+FGR+++ I+ ++FY VGT+I+SQA +V R+A GS FY +G  G +
Sbjct: 119 ISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTVIQSQAYDVQRYAAGSIFYYIGLVGSM 178

Query: 182 LSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAFIVPL 239
             + L+  D S+L WRL  +FVPA P ++  WISGNV       ++W WGI MWAFI P 
Sbjct: 179 FQVTLMLSDCSSLKWRLLYNFVPAWPALVTVWISGNVVHVANPEKNWSWGIAMWAFIFPA 238

Query: 240 SAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATF 299
           + +P+  CLLHMRW    N++ +   E +TY         +    WKLD +G+LL   + 
Sbjct: 239 TCLPIIGCLLHMRWKLRNNSEWKELQEEKTYFQTHGLVQTLKQLFWKLDVVGVLLFSVST 298

Query: 300 GCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGI 359
           GCIL+P T+AGG    W++A +I P V+G  + +P F+ WE K + VPL P+ ++KDRGI
Sbjct: 299 GCILIPLTIAGGASTHWRSAKVIAPLVLG-SLLVPFFIYWESKLALVPLAPFKMLKDRGI 357

Query: 360 FFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIK 419
           +  L+I F I FI+ M   Y+YT+L+V+ NES  SATRITSLYSFV+ +   ++G+ + +
Sbjct: 358 WAPLLITFLICFIYMMAAGYLYTILLVAGNESSLSATRITSLYSFVAAVFSPVVGIFVAR 417

Query: 420 VRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQAS 479
             R KPF +FG S +F+   L  H+R            + + G  + FF Y    S+Q +
Sbjct: 418 FSRLKPFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVVWGITSCFFNYPINISMQ-T 476

Query: 480 VKYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFT 539
           V  H  MA +TA  L ++ I           IWT  L  ++ K + + TLA EAY  P +
Sbjct: 477 VTSHENMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRLLKALGDPTLALEAYNMPLS 536

Query: 540 FILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKL 588
           F+L + W TP R A++ +YRY QK   +VGL F + +     FLR+  L
Sbjct: 537 FMLKHEWGTPARDAMIEAYRYVQKYEVLVGLIFVAPMFLLTFFLRDPPL 585

>KLTH0B10450g Chr2 complement(885429..887291) [1863 bp, 620 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 620

 Score =  416 bits (1068), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 220/589 (37%), Positives = 326/589 (55%), Gaps = 18/589 (3%)

Query: 2   TSSSDSKFDGKINETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNI 61
           + S+ ++  GK N    +++ + DS               N+P+L +     K   +   
Sbjct: 13  SESTPNENYGKANVVQTEKEFSHDSK--------------NEPELGDKLQITKRIVIRKA 58

Query: 62  EVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXX 121
           E+ A QY   + + M  FS F+ A++YGLD  +R  Y   A + Y  HSLLS        
Sbjct: 59  ELMANQYDGWLLKSMFLFSAFICAFSYGLDSIIRSIYMTYAMNDYQTHSLLSTVSVISLT 118

Query: 122 XXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVI 181
                QI +A  SD+FGR+++ I+ ++FY VGT+I+SQA +V R+A GS FY +G  G +
Sbjct: 119 ISAVAQIFFAGLSDVFGRLSMFIVAIMFYVVGTVIQSQAYDVQRYAAGSIFYYIGLVGSM 178

Query: 182 LSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAFIVPL 239
             + L+  D S+L WRL  +FVPA P ++  WISGNV       ++W WGI MWAFI P 
Sbjct: 179 FQVTLMLSDCSSLKWRLLYNFVPAWPALVTVWISGNVVHVANPEKNWSWGIAMWAFIFPA 238

Query: 240 SAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATF 299
           + +P+  CLLHMRW    N++ +   E +TY         +    WKLD +G+LL   + 
Sbjct: 239 TCLPIIGCLLHMRWKLRNNSEWKELQEEKTYFQTHGLVQTLKQLFWKLDVVGVLLFSVST 298

Query: 300 GCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGI 359
           GCIL+P T+AGG    W++A +I P V+G  + +P F+ WE K + VPL P+ ++KDRGI
Sbjct: 299 GCILIPLTIAGGASTHWRSAKVIAPLVLG-SLLVPFFIYWESKLALVPLAPFKMLKDRGI 357

Query: 360 FFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIK 419
           +  L+I F I FI+ M   Y+YT+L+V+ NES  SATRITSLYSFV+ +   ++G+ + +
Sbjct: 358 WAPLLITFLICFIYMMAAGYLYTILLVAGNESSLSATRITSLYSFVAAVFSPVVGIFVAR 417

Query: 420 VRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQAS 479
             R KPF +FG S +F+   L  H+R            + + G  + FF Y    S+Q +
Sbjct: 418 FSRLKPFAVFGCSLYFVTMALFYHFRGGTDTGKGVIGAMVVWGITSCFFNYPINISMQ-T 476

Query: 480 VKYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFT 539
           V  H  MA +TA  L ++ I           IWT  L  ++ K + + TLA EAY  P +
Sbjct: 477 VTSHENMATVTAFGLTIFRIGGAVGAAVSGAIWTQSLYPRLLKALGDPTLALEAYNMPLS 536

Query: 540 FILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKL 588
           F+L + W TP R A++ +YRY QK   +VGL F + +     FLR+  L
Sbjct: 537 FMLKHEWGTPARDAMIEAYRYVQKYEVLVGLIFVAPMFLLTFFLRDPPL 585

>Kwal_23.2794 s23 (15194..17053) [1860 bp, 619 aa] {ON} YHL047C
           (ARN2) - Triacetylfusarinine C transporter [contig 246]
           FULL
          Length = 619

 Score =  415 bits (1067), Expect = e-137,   Method: Compositional matrix adjust.
 Identities = 222/563 (39%), Positives = 319/563 (56%), Gaps = 13/563 (2%)

Query: 58  VNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXX 117
           +   E+ A+QY S   + +   + F+ ++AYGLD  +R  Y   A   Y++HSLLS    
Sbjct: 53  IRKSELMAKQYDSWFSKSVFLLAAFICSFAYGLDSIIRDIYMTYAMDDYAEHSLLSTVNV 112

Query: 118 XXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGY 177
                   GQI +A  SD+FGR+++ ++ ++FY VGTII+SQA +V R+  GS FY +G 
Sbjct: 113 VSLMISAVGQIFFAGLSDVFGRLSLFVVAIIFYVVGTIIQSQAYDVGRYVAGSIFYNIGL 172

Query: 178 TGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNV--SGAVGQHWKWGIGMWAF 235
            G I  + +I  D S+L WRLF +FVPA P  +  WISGNV       ++W WGIGMW F
Sbjct: 173 VGAIFQVTIILSDCSSLKWRLFYNFVPAWPAFVTVWISGNVIHIANPSENWSWGIGMWGF 232

Query: 236 IVPLSAIPLGCCLLHMRWLAHKNAK-DRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLL 294
           I P S +PL  C+LHMRW    + +   L+ E   ++  G    +V +F WKLD  G+LL
Sbjct: 233 IFPASCLPLIACMLHMRWKVKNDREWKELQEEKSYFQTHGVVQSLVQLF-WKLDVAGVLL 291

Query: 295 LCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALI 354
           L A  GCILVP T+AGG+  +W++A +I P V+G+ + +P+FL WE + + VPL P+ ++
Sbjct: 292 LTACTGCILVPLTIAGGVSAQWRSAKVIAPFVLGFAL-VPVFLYWESRIALVPLAPFKML 350

Query: 355 KDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLG 414
           KDRGI+  L I F I FI+ M   Y+YTVL+V+ NES  SATRITSLYSFV+ I   +LG
Sbjct: 351 KDRGIWAPLAIMFLICFIYQMAAGYLYTVLLVAANESDLSATRITSLYSFVAAIFSPILG 410

Query: 415 LVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQA 474
           +++ +  R KP+ + G S +F+  GL  HYR            + + G  +  + Y    
Sbjct: 411 VLVARSTRLKPYTLVGCSLYFVTMGLFYHYRGGEDAGKGIIGAMVVWGISSCLYDYPISI 470

Query: 475 SIQASVKYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAY 534
           S+Q +V  H  MA +TAL L ++ I           IWT  L  ++ K + +  +AA+AY
Sbjct: 471 SMQ-TVTSHEMMATVTALNLTIFRIGGAVGAAVSGAIWTQALYPKLLKLLGDPEMAAKAY 529

Query: 535 GSPFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVAL 594
             P TFI  Y W T  R A V +YRY QK   +VGL F + +     FLR+  L      
Sbjct: 530 DEPLTFIPDYEWGTSVRDATVEAYRYVQKYEVLVGLIFVAPMFVLTFFLRDPSLTE---- 585

Query: 595 SELENTPNSDEQGSFADNDKNVN 617
              E   N ++     +ND  +N
Sbjct: 586 ---EYGQNLEDDEYVKENDDPIN 605

>SAKL0F00110g Chr6 (1456..3318) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score =  411 bits (1057), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 220/587 (37%), Positives = 330/587 (56%), Gaps = 18/587 (3%)

Query: 4   SSDSKFDGKINETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEV 63
           S+ S+ +GK N    +EQ +++++              N+ +L +     K   +   E+
Sbjct: 15  STSSETNGKTNVVETEEQFSKEAD--------------NEHELADKFHVTKRIVIRKSEL 60

Query: 64  YAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXX 123
            A QY + + + +  FS F+ +++YGLD  +R  Y   A ++Y  HSLLS          
Sbjct: 61  MANQYDNWVLKSLFLFSAFICSFSYGLDSIIRNIYMTYAMNNYETHSLLSTVNVISMTIS 120

Query: 124 XXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILS 183
              QI +A  SD+FGR++I I+ +VFY VGTII+SQA +V R+A GS FY +G  G +  
Sbjct: 121 AVAQIFFAGLSDVFGRLSIFIVTIVFYVVGTIIQSQAYDVQRYAAGSIFYNIGLVGAMFQ 180

Query: 184 LELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAFIVPLSA 241
           + L+  D S+L WRLF +FVPA P ++  WISG+V       Q+W WGI MWAFI P + 
Sbjct: 181 VTLMLSDSSSLKWRLFYNFVPAWPAVVTVWISGDVINVANPKQNWSWGIAMWAFIFPATC 240

Query: 242 IPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGC 301
           +P+  CLLHMRW    + + +   E +TY         +    WKLD +G+LL   + GC
Sbjct: 241 LPIIGCLLHMRWKLKNDPEWKDLQEKKTYFQTHGLVQTLKQLFWKLDAVGVLLFSVSTGC 300

Query: 302 ILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFF 361
           ILVP T+AGG+  +W++A II P V+G  + L +F+ WE K + VPL P+ ++KDRGI+ 
Sbjct: 301 ILVPLTIAGGVSTQWRSAKIIAPIVLGSVLVL-VFIYWESKLALVPLAPFKMLKDRGIWA 359

Query: 362 ALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVR 421
            L++ F + F++ M  DY+YT+L+V+ NES  SATRITSLYSFV+ +     G+++ +  
Sbjct: 360 PLLLMFLVCFVYVMPADYLYTILLVAGNESSLSATRITSLYSFVTAVLSAAAGILVTRFP 419

Query: 422 RTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVK 481
           R KPF  FG + +F+   L   +R            + + G  + FF Y    S+Q +V 
Sbjct: 420 RLKPFAFFGCALYFVTMALFYCFRGGEDTGKGVIGAMVVWGVASCFFDYPINISMQ-TVT 478

Query: 482 YHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFI 541
            H  MA +TAL LA++ I           IWT  L  ++ K + +  +A EAY  P +F+
Sbjct: 479 SHENMATVTALGLAIFRIGGAVGAAVSGAIWTQTLYPRLLKTLGDPDMAIEAYDMPLSFM 538

Query: 542 LTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKL 588
           L + W TP R+A+V SYRY QK   +VGL F + +      LR+  L
Sbjct: 539 LEHEWGTPVREAMVDSYRYVQKYEVLVGLVFVAPMFLLTFCLRDPPL 585

>SAKL0E00132g Chr5 (3269..5131) [1863 bp, 620 aa] {ON} similar to
           uniprot|P38724 Saccharomyces cerevisiae YHL047C ARN2
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to the siderophore
           triacetylfusarinine C
          Length = 620

 Score =  408 bits (1048), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 212/533 (39%), Positives = 303/533 (56%), Gaps = 4/533 (0%)

Query: 58  VNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXX 117
           +   E+ A QY +   + +  FS F+ A++YGLD  +R  Y   A + Y  HSLLS    
Sbjct: 55  IRKSELMANQYDNWFLKSLFLFSAFICAFSYGLDSIIRSVYMTYAMNDYQTHSLLSTVSV 114

Query: 118 XXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGY 177
                    QI +A  SD+FGR++I I+ + FY VGTII+SQA +V R+A GS FY +G 
Sbjct: 115 ISLTISAVAQIFFAGLSDVFGRLSIFIVAIAFYVVGTIIQSQAYDVQRYAAGSIFYNIGL 174

Query: 178 TGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAF 235
            G +  + L+  D S+L WRLF +FVPA P ++  WISGNV       Q+W WGI MWAF
Sbjct: 175 VGAMFQVTLMLSDSSSLKWRLFYNFVPAWPALVTVWISGNVIHLANPKQNWSWGIAMWAF 234

Query: 236 IVPLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLL 295
           I P + +P+  CLLHMRW    + + +   E +TY         +    WKLD +G+LL 
Sbjct: 235 IFPAACLPIIGCLLHMRWKLRNDPEWKDLQEEKTYFQTHGLVQTLKQLFWKLDVVGVLLF 294

Query: 296 CATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIK 355
             + GCIL+P T+AGG    W++A +I P V+G  V +P F+ WE K + VPL P+ ++K
Sbjct: 295 SVSTGCILIPLTVAGGASTHWRSAKVIAPIVLG-SVLVPAFIYWESKLALVPLAPFKMLK 353

Query: 356 DRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGL 415
           DRGI+  L+I F I FI+ M   Y+YT+L+V+ NES  SATRITSLYSFV+ +   ++G+
Sbjct: 354 DRGIWAPLLITFLICFIYMMAAGYLYTILLVAGNESSLSATRITSLYSFVAAVFSPVVGI 413

Query: 416 VIIKVRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQAS 475
            + +  R KPF +FG S +F+   L  H+R            + + G  + FF Y    S
Sbjct: 414 FVARFSRLKPFAVFGCSLYFVTMALFYHFRGGVDTGKGVIGAMVIWGITSCFFNYPINIS 473

Query: 476 IQASVKYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYG 535
           +Q +V  H  MA +TAL L ++ I           IWT  L  ++ K + + T+A EAY 
Sbjct: 474 MQ-TVTSHENMATVTALGLTIFRIGGAVGAAVSGAIWTQTLYPRLLKALGDPTMATEAYN 532

Query: 536 SPFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKL 588
            P +F+L + W T  R A+V SYRY Q+   +VGL F + +      LR+  L
Sbjct: 533 MPLSFMLKHEWGTAARDAMVDSYRYVQRYEVLVGLIFVAPMFVLTFLLRDPPL 585

>KLTH0A07964g Chr1 complement(670591..672450) [1860 bp, 619 aa] {ON}
           similar to uniprot|P38724 Saccharomyces cerevisiae
           YHL047C ARN2 Transporter member of the ARN family of
           transporters that specifically recognize
           siderophore-iron chelates responsible for uptake of iron
           bound to the siderophore triacetylfusarinine C
          Length = 619

 Score =  406 bits (1043), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 222/604 (36%), Positives = 328/604 (54%), Gaps = 14/604 (2%)

Query: 17  VLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPIYRVM 76
           V+      D       +L S   D  Q     +++      +   E+ A+QY S   + +
Sbjct: 13  VIHASNEVDGKNIVVEKLFSKNADMEQESPDTFEVTESIV-IRKAELMAKQYDSWFLKSL 71

Query: 77  LFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDI 136
             F++F+ ++AYGLD  +R  Y   A ++Y  HSLLS            GQI +AR SD+
Sbjct: 72  FLFTVFICSFAYGLDSIIRDIYMTYAMNAYETHSLLSTVNVISMVISAVGQIFFARLSDV 131

Query: 137 FGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNW 196
           FGR+++ I+ +V Y VGT+I+SQA +V R+A GS FY +G  G +  + LI  D S L W
Sbjct: 132 FGRLSLFIVSIVLYVVGTVIQSQAYDVQRYAAGSVFYNVGLVGAMFQVTLILSDCSTLKW 191

Query: 197 RLFASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAFIVPLSAIPLGCCLLHMRWL 254
           RLF +FVPA P II  WISGNV       ++W WGI MWAFI P+S IP   C+LHMRW 
Sbjct: 192 RLFYNFVPAWPAIITVWISGNVVHVANPLENWSWGIAMWAFIFPVSCIPFIACILHMRWK 251

Query: 255 AHKNAKDR-LKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQ 313
              + + R L+ E   Y+  G     V +F W+LD +G++LL    GCI VP T+AGG+ 
Sbjct: 252 VRNSHEWRELQEEKSFYQTHGLVQTFVQLF-WRLDVVGVILLSVFTGCICVPLTVAGGVS 310

Query: 314 DKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIW 373
            +W++  +I P V+G+ + +P F+ WE + ++ PL P+ ++KDRGI+  L I F I FI+
Sbjct: 311 TEWRSGKVIAPFVLGFSL-IPAFVYWESRLARFPLAPFLMLKDRGIWAPLWIYFLIAFIY 369

Query: 374 YMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSC 433
            M  +Y+YT+L+V+ NES  SA RITSLYSFV+ I   ++GL++ +  R KP+ + G S 
Sbjct: 370 EMAAEYLYTILLVAANESDLSAIRITSLYSFVAAIFSPIVGLLVARSSRLKPYTVVGCSL 429

Query: 434 WFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALY 493
           +F+  GL  HYR            + + G  +  + Y    SIQ +V  H  +A ++AL 
Sbjct: 430 YFVTMGLFYHYRGGNDAGKGVIGAMVVWGITSCLYDYPISVSIQ-TVTSHENLANVSALS 488

Query: 494 LAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPERQA 553
             ++ I           IWT  L  ++ K + +  +A  A+ SP  FI  Y W TP R+A
Sbjct: 489 STIFRIGGAVGAAVSGAIWTQTLYPKLLKALGDAGMAEAAFNSPLDFITDYDWGTPVREA 548

Query: 554 VVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELENTPNSDEQGSFADND 613
            V +++Y QK   +VGL F   +     FLR+  L       E     N +E     +ND
Sbjct: 549 TVEAFQYVQKYEVLVGLIFVVPMFVMTFFLRDPPLN-----EEFGQNLNGEEY--VKEND 601

Query: 614 KNVN 617
             +N
Sbjct: 602 DPIN 605

>TBLA0F00470 Chr6 (123691..125889) [2199 bp, 732 aa] {ON} 
          Length = 732

 Score =  398 bits (1022), Expect = e-129,   Method: Compositional matrix adjust.
 Identities = 229/594 (38%), Positives = 332/594 (55%), Gaps = 21/594 (3%)

Query: 3   SSSDSKFDGKINETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIE 62
           SS++ +   +IN   ++++  E  N    +  +   P  +      Y+ +     +  IE
Sbjct: 48  SSNNYRNSSEINH--IEQKNNEKFNTIEHTSTEGTNPKYDT----TYEEFDSKRIIKEIE 101

Query: 63  VYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXX 122
           +    Y +  +  +L F  F+ +Y Y LD  VR  Y+  A SSY +HSL+S         
Sbjct: 102 IMKSVYDTWYFHALLLFGAFICSYGYSLDSRVRRVYKTYAASSYKKHSLVSTINVIDSVA 161

Query: 123 XXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVIL 182
               Q+ Y+RASDIFGR+++L++ ++ Y VGTII+SQA ++ R+  GS FY LGY GV L
Sbjct: 162 SATSQVVYSRASDIFGRLSLLLVAIICYVVGTIIQSQAYDIQRYCAGSFFYNLGYVGVSL 221

Query: 183 SLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAFIVPLS 240
            + LI  D+S+L WR F   + A P IIN WISG +       +HW W IGMWAFI PLS
Sbjct: 222 LMTLILSDYSSLKWRFFYQAILAWPNIINDWISGIIVDRANPIKHWSWDIGMWAFIFPLS 281

Query: 241 AIPLGCCLLHMRWLAHKNAK-DRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATF 299
            IP+ CCL+HM+WLA +  +  +LK     ++  G+   ++D+F W+ D +G++LL A  
Sbjct: 282 CIPILCCLIHMQWLASQTDEWKQLKKGKSYFKYYGYKDSLIDMF-WRFDVVGVILLAAFI 340

Query: 300 GCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGI 359
           G IL+P TLAGG + +W    +I P VIG CV +P F +WE  F+K P+ PW LIKDR I
Sbjct: 341 GLILIPLTLAGGTKSRWSEGKLIAPFVIG-CVMVPCFAIWEKWFAKHPIMPWRLIKDRSI 399

Query: 360 FFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIK 419
           + AL ++    F++ +  DYMY++L+V+V+ESIKSAT I  ++SFVS +           
Sbjct: 400 WAALTLSLVYKFVFAVAQDYMYSLLLVAVDESIKSATTIGLIHSFVSSVGSPFFSYGTTF 459

Query: 420 VRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLG-----FGAGFFTYTTQA 474
           V R KPFI  G   + ++ GLL +YR            LC++G     F     T  TQA
Sbjct: 460 VGRLKPFIFLGTLLYMLSLGLLYYYRGGKWAHSGIIGALCVVGGLQLLFFITPLTVITQA 519

Query: 475 SIQASVKYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAY 534
           S+ +     + MA +TAL L   NI           IWT  L K++ KR+ N+TLA +AY
Sbjct: 520 SVSS-----ADMANVTALILTFDNIGTGIGAAVSGAIWTQTLYKELFKRMKNKTLAKKAY 574

Query: 535 GSPFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKL 588
            SP +FI  Y+W TP R  +V SYR  Q+   IV + FC+ L+     LR+  L
Sbjct: 575 SSPLSFIANYSWGTPVRNIMVESYRSVQRYEIIVAISFCAPLVLLTFALRDINL 628

>NCAS0I00110 Chr9 complement(5312..6670) [1359 bp, 452 aa] {ON} 
          Length = 452

 Score =  378 bits (971), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 199/449 (44%), Positives = 281/449 (62%), Gaps = 7/449 (1%)

Query: 15  ETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPIYR 74
           E   +   +   N   + +++S Q D  Q  + ++ +  +   +   E+ +  Y    + 
Sbjct: 8   EVHEKNHLSSKGNDIFTKEIES-QNDDTQSSVPDFAV-KRSLVIKKTEIMSAVYDKWYHH 65

Query: 75  VMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARAS 134
           V+L FS F+  YAYGL+ ++RY Y   ATSSY++HSLLS             QI Y+R S
Sbjct: 66  VILLFSAFVCGYAYGLECNIRYIYTGYATSSYAEHSLLSTVNVINAVVSAASQIIYSRLS 125

Query: 135 DIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNL 194
           D FGR+T+ II +V Y VGTII+SQA +V R+A G+ FY  GY G+IL L LI  DFS+L
Sbjct: 126 DFFGRLTLFIIAIVLYVVGTIIQSQAYDVQRYAAGAIFYNAGYVGIILILLLILSDFSSL 185

Query: 195 NWRLFASFVPALPFIINTWISGNVSGAVGQ--HWKWGIGMWAFIVPLSAIPLGCCLLHMR 252
            WRLF  F P  PFIINTWISGNV+ +     HW W +GMWAFI PL+ IP+  C++HM+
Sbjct: 186 KWRLFYQFAPTWPFIINTWISGNVTSSANPLVHWSWDVGMWAFIFPLACIPMIGCMIHMQ 245

Query: 253 WLAHKNAK-DRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGG 311
           W A K  +   L+SE   Y+  G++  + ++F WKLD IG LL  A  GCILVP TLAGG
Sbjct: 246 WKASKTPEWHALRSEKSFYQANGFYKTMTELF-WKLDIIGTLLFTACLGCILVPLTLAGG 304

Query: 312 LQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINF 371
              KW  + +I P V+G+ V +PI  +WE K+++ PL P+ L++DRG++ AL I+F I+F
Sbjct: 305 TNSKWNNSRVIGPFVLGF-VLIPILGVWEYKWARDPLIPYKLVRDRGVWAALGISFLIDF 363

Query: 372 IWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGV 431
           I+YM  DY+YTV++V+V+ES+KSATRI++L SFVS +      L++ +  R KPFIIFG 
Sbjct: 364 IFYMAADYLYTVMVVAVHESVKSATRISTLSSFVSTVASPFFALLMTRCTRLKPFIIFGC 423

Query: 432 SCWFIAFGLLVHYRXXXXXXXXXXXXLCL 460
           S W ++ GLL ++R            LC+
Sbjct: 424 SLWMLSMGLLYNFRGGEQSHSGIIGALCV 452

>Skud_18.6 Chr18 (14597..16429) [1833 bp, 610 aa] {ON} YCL073C
           (REAL)
          Length = 610

 Score =  380 bits (976), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 206/562 (36%), Positives = 312/562 (55%), Gaps = 6/562 (1%)

Query: 30  NSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYG 89
           NS +  +N+   +  D        + + +   E+ A Q+ +P YR ++  + FL  + Y 
Sbjct: 10  NSEKCVTNESSRSFEDEDANPANVEFSKLGESEIIAVQFDTPKYRALMIATAFLCGFGYS 69

Query: 90  LDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGRMTILIIGLVF 149
           LD ++R TY   AT+SY++HSLLS             Q+ ++R SD FGR+ + +   + 
Sbjct: 70  LDHTLRSTYTGYATNSYAEHSLLSTIQVINAVVSVGSQVVFSRLSDYFGRVELFVAATIL 129

Query: 150 YAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWRLFASFVPALPFI 209
           Y +GTI++SQA +V+ +A G+ FY  G  GV L L LI  DFS+L WR+   +VP  PFI
Sbjct: 130 YVIGTIVQSQAYSVSIYAAGAVFYNSGNVGVTLVLLLILSDFSSLKWRILYQYVPYWPFI 189

Query: 210 INTWISGNVSGAVG--QHWKWGIGMWAFIVPLSAIPLGCCLLHMRWLAHKNAK-DRLKSE 266
           I  WISGN+  A    + W W I MWAFI PLSA+P+ C L++M + + K  +   LK  
Sbjct: 190 IIPWISGNIVTAANPEKDWSWDIAMWAFIFPLSALPMICLLVYMMYKSSKTPEWKALKER 249

Query: 267 FRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEV 326
               ++ G+    V +F W+LD IG++L+  + GC+LVP TLA G+  KW ++ II   V
Sbjct: 250 THIKKNQGFLKNTVFLF-WELDSIGIILITVSLGCVLVPLTLANGVSQKWHSSKIIGTLV 308

Query: 327 IGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIV 386
            G  V   IF+ WE  ++K PL P+ L+ DRGI+  L +AF   F +++  D++Y VL+V
Sbjct: 309 FG-GVLFCIFVFWETAYAKNPLLPFKLLGDRGIWAPLGVAFFNYFTFFIACDFLYPVLLV 367

Query: 387 SVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRX 446
           S+NES  +ATRI +L  FV        G+++ K RR K  ++ G + W I+ GL   YR 
Sbjct: 368 SMNESSTTATRILNLPDFVGATLSPFYGILVAKARRLKFSVVGGCAAWMISMGLFYQYRG 427

Query: 447 XXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALYLAMYNIXXXXXXX 506
                        ++G      + +   S+QA +  H +MAVIT++Y     +       
Sbjct: 428 GSESHGGAIAASVIMGMSGLLCSNSVIVSLQA-MTTHGRMAVITSIYFTFSKVGAAVGAS 486

Query: 507 XXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPERQAVVVSYRYTQKILC 566
               +WT ++P Q+ K  +N+TLA  AY SP+TFI  Y W +PER AVV +YRY Q+I+ 
Sbjct: 487 VSGAVWTQIMPNQLRKAFSNDTLADAAYESPYTFIYEYPWGSPERIAVVEAYRYVQRIMM 546

Query: 567 IVGLCFCSTLLGAALFLRNHKL 588
            +GL          LF+R+ +L
Sbjct: 547 TIGLVCTIPFFAFTLFMRDPEL 568

>YCL073C Chr3 complement(6479..8326) [1848 bp, 615 aa] {ON}
           GEX1Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; imports glutathione from
           the vacuole and exports it through the plasma membrane;
           has a role in resistance to oxidative stress and
           modulation of the PKA pathway
          Length = 615

 Score =  378 bits (970), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 216/579 (37%), Positives = 315/579 (54%), Gaps = 9/579 (1%)

Query: 13  INETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPI 72
           ++ +V+   + + S    S ++   +  SN         + K   +   E+ + Q+ S  
Sbjct: 1   MSSSVVGASSNKKSGIRQSCEIIERERHSNDDTYSMTSTFFK---LKENEIMSAQFDSLK 57

Query: 73  YRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYAR 132
           Y+++L  + F+  +   LD ++R TY   AT+SYS+HSLLS             Q+ Y+R
Sbjct: 58  YKILLISTAFVCGFGISLDYTLRSTYTGYATNSYSEHSLLSTVQVINAVVSVGSQVVYSR 117

Query: 133 ASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFS 192
            SD FGR+ + ++  +FY +GTII+SQAT +T +A GS FY  GY G  L L LI  DFS
Sbjct: 118 LSDHFGRLRLFLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGTNLLLTLILSDFS 177

Query: 193 NLNWRLFASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAFIVPLSAIPLGCCLLH 250
           +L WR+F  +    P+II  WISGN+  A    ++W W I MWAFI PLSA+P+   +L+
Sbjct: 178 SLKWRMFYQYASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIYPLSALPIIFLILY 237

Query: 251 MRWLAHKNAKDR-LKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLA 309
           M++ + K A+ R LK + R  R  G F  +V +F WKLD +G+LL+  + GCILVP TLA
Sbjct: 238 MKYKSSKTAEWRSLKEQARKERTGGLFENLVFLF-WKLDIVGILLITVSLGCILVPLTLA 296

Query: 310 GGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHI 369
                KW  + II   V G C+   IFL WE KF+K PL P+ L+ DRGI+  L + F  
Sbjct: 297 NETSQKWHNSKIIATLVSGGCLFF-IFLYWEAKFAKSPLLPFKLLSDRGIWAPLGVTFFN 355

Query: 370 NFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIF 429
            F +++  DY+Y VL+VS+ ES  SA RI +L  FV+        L++ K R+ K  +I 
Sbjct: 356 FFTFFISCDYLYPVLLVSMKESSTSAARIVNLPDFVAATASPFYSLLVAKTRKLKLSVIG 415

Query: 430 GVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVI 489
           G + W +  GL   YR              ++G  +G     +   I  ++  HS+MAVI
Sbjct: 416 GCAAWMVCMGLFYKYRGGSGSHEGVIAASVIMGL-SGLLCSNSVIVILQAMTTHSRMAVI 474

Query: 490 TALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTP 549
           T +      +           IWT  +P Q+ K + N+TLA  AY SP+TFI  Y W +P
Sbjct: 475 TGIQYTFSKLGAAIGASVSGAIWTQTMPNQLYKNLGNDTLAEIAYASPYTFISDYPWGSP 534

Query: 550 ERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKL 588
           ER AVV SYRY Q+I+  VGL          +F+R+ +L
Sbjct: 535 ERDAVVESYRYVQRIIMTVGLACTVPFFAFTMFMRDPEL 573

>YKR106W Chr11 (661442..663289) [1848 bp, 615 aa] {ON}
           GEX2Proton:glutathione antiporter localized to the
           vacuolar and plasma membranes; expressed at a very low
           level; almost identical to paralog Gex1p; potential role
           in resistance to oxidative stress and modulation of the
           PKA pathway
          Length = 615

 Score =  377 bits (968), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 216/579 (37%), Positives = 314/579 (54%), Gaps = 9/579 (1%)

Query: 13  INETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPI 72
           ++ +V+   + + S    S ++   +  SN         + K   +   E+ + Q+ S  
Sbjct: 1   MSSSVVGASSNKKSGIRQSCEIIERERHSNDDTYSMTSTFFK---LKENEIMSAQFDSLK 57

Query: 73  YRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYAR 132
           Y+++L  + F+  +   LD ++R TY   AT+SYS+HSLLS             Q+ Y+R
Sbjct: 58  YKILLISTAFVCGFGISLDYTLRSTYTGYATNSYSEHSLLSTVQVINAVVSVGSQVVYSR 117

Query: 133 ASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFS 192
            SD FGR+ + ++  +FY +GTII+SQAT +T +A GS FY  GY G  L L LI  DFS
Sbjct: 118 LSDHFGRLRLFLVATIFYIMGTIIQSQATRLTMYAAGSVFYNCGYVGTNLLLTLILSDFS 177

Query: 193 NLNWRLFASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAFIVPLSAIPLGCCLLH 250
           +L WR+F  +    P+II  WISGN+  A    ++W W I MWAFI PLS +P+   +L+
Sbjct: 178 SLKWRMFYQYASYWPYIIIPWISGNIITAANPQKNWSWNIAMWAFIYPLSTLPIIFLILY 237

Query: 251 MRWLAHKNAKDR-LKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLA 309
           M++ + K A+ R LK + R  R  G F  +V +F WKLD +G+LL+  + GCILVP TLA
Sbjct: 238 MKYKSSKTAEWRSLKEQARKERTGGLFENLVFLF-WKLDIVGILLITVSLGCILVPLTLA 296

Query: 310 GGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHI 369
                KW  + II   V G C+   IFL WE KF+K PL P+ L+ DRGI+  L + F  
Sbjct: 297 NETSQKWHNSKIIATLVSGGCLFF-IFLYWEAKFAKSPLLPFKLLSDRGIWAPLGVTFFN 355

Query: 370 NFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIF 429
            F +++  DY+Y VL+VS+ ES  SA RI +L  FV+        L++ K R+ K  +I 
Sbjct: 356 FFTFFISCDYLYPVLLVSMKESSTSAARIVNLPDFVAATASPFYSLLVAKTRKLKLSVIG 415

Query: 430 GVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVI 489
           G + W +  GL   YR              ++G  +G     +   I  ++  HS+MAVI
Sbjct: 416 GCAAWMVCMGLFYKYRGGSGSHEGVIAASVIMGL-SGLLCSNSVIVILQAMTTHSRMAVI 474

Query: 490 TALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTP 549
           T +      +           IWT  +P Q+ K + N+TLA  AY SP+TFI  Y W +P
Sbjct: 475 TGIQYTFSKLGAAIGASVSGAIWTQTMPNQLYKNLGNDTLAEIAYASPYTFISDYPWGSP 534

Query: 550 ERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKL 588
           ER AVV SYRY Q+I+  VGL          +F+RN +L
Sbjct: 535 ERDAVVESYRYVQRIIMTVGLACTVPFFTFTMFMRNPEL 573

>KLLA0E14609g Chr5 (1302073..1303992) [1920 bp, 639 aa] {ON} similar
           to uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 639

 Score =  376 bits (965), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 215/611 (35%), Positives = 331/611 (54%), Gaps = 33/611 (5%)

Query: 28  QFNSSQLDSNQ---PDSNQPDLKNYDLYHK-----DAGV------------NNIEVYAEQ 67
           Q  SS  D+N+   P++N+ +L   +  HK     + GV              +E+  +Q
Sbjct: 15  QSRSSSFDNNEDSFPNANKENLTFAEENHKQELLDEYGVPDKLRANRSLVIRKMEIMRKQ 74

Query: 68  YSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQ 127
           Y+S     +  F+ FL      L+  +R  Y   AT+SY  HSLLS              
Sbjct: 75  YTSVFAICVFLFTAFLAGVGTDLNSQLRNNYTTYATNSYRSHSLLSTIGVVSSIISAGAL 134

Query: 128 ICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELI 187
             YAR SD+FGR+ + +  ++F+ VGTII+SQA NV ++A G+ FY LG  G+ + + +I
Sbjct: 135 TVYARLSDVFGRIRLYLSAMLFFVVGTIIQSQANNVQKYAAGTVFYSLGTAGIQVMMFII 194

Query: 188 AMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAFIVPLSAIPLG 245
             DFS+L WRLF +F P  P +   WI+G++   +   + W WGIGMWAFI PLS++P  
Sbjct: 195 MSDFSSLKWRLFFTFAPTWPNLFIPWITGSIVDRLDPVERWSWGIGMWAFIYPLSSVPFV 254

Query: 246 CCLLHMRWLAHKNAKDRLKSEFRTYRDM-GWFAYIVDVFLWKLDFIGLLLLCATFGCILV 304
             LL +R+ A K  + ++ S  +TY +  G    +V +F WK+D +GLLL  A  GCILV
Sbjct: 255 AYLLLVRYKASKTEEWKMLSSEKTYYETHGIIQTLVQLF-WKVDVVGLLLFVAFLGCILV 313

Query: 305 PFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALV 364
           P TLAGG+  +W    I+ P ++G+C+ +P F+LWE K++++P+ P+ ++KDRGI+ AL+
Sbjct: 314 PLTLAGGVSSQWSNGKILGPFILGFCL-VPAFILWETKYARLPIAPFKMLKDRGIWSALI 372

Query: 365 IAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTK 424
           I+     ++Y+   Y+ T+L+V+VN+S   A  I +++S V           +++VRR K
Sbjct: 373 ISMLAKTVYYLAAGYLLTILMVAVNQSRGMAAVIMNVWSVVGCGFSPFFSYFVVRVRRLK 432

Query: 425 PFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHS 484
           PFII G   W ++ GLL +YR            + L G G+   T TT  S Q S+  H 
Sbjct: 433 PFIIIGCGIWMVSMGLLYYYRSGEHSKGGIIGAMVLWGLGSTMITRTTVISSQ-SITAHE 491

Query: 485 KMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTY 544
            MA ITA+ LA+  I           IWT  L  ++ + I +  +A + Y SP + I  Y
Sbjct: 492 NMATITAIMLAISRIGGGIGSAVSGAIWTQTLYAKLVETIGDPEIAKKVYQSPLSAIRVY 551

Query: 545 TWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELENTPNSD 604
            W TP R A+V +YR+ Q+   +V +     L  A+L LR+ +L   VA +++++     
Sbjct: 552 AWGTPTRDAIVEAYRHVQRFEVLVAMILVIPLFIASLCLRDPELTDEVAHTDIKD----- 606

Query: 605 EQGSFADNDKN 615
             G F   D N
Sbjct: 607 --GEFIAVDGN 615

>Kwal_14.722 s14 (9019..10854) [1836 bp, 611 aa] {ON} YCL073C -
           Hypothetical ORF [contig 245] FULL
          Length = 611

 Score =  358 bits (919), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 212/582 (36%), Positives = 313/582 (53%), Gaps = 11/582 (1%)

Query: 18  LQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKD---AGVNNIEVYAEQYSSPIYR 74
           +++   +++     S LD     S +P L   D   +      V  +E+  +  S  + R
Sbjct: 5   MKKVLDDEAIGLECSDLDGGS-SSEKPSLTKGDKGRQQYDYMKVKEMEIIKDVCSGNLAR 63

Query: 75  VMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARAS 134
           V L  S FL  +AY LD   R  Y   A +SY +HSLLS             QI +AR S
Sbjct: 64  VFLLASAFLCGFAYYLDMVTRSVYTTYAANSYEKHSLLSTIQVINSVVGVGAQISFARLS 123

Query: 135 DIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNL 194
           D+FGR+ + ++G + Y VGTII+SQA +V  +AVG+ FY  G+ GV L L L+  D S L
Sbjct: 124 DVFGRLQMFVVGTILYVVGTIIQSQAHDVKVYAVGAIFYNTGFVGVSLLLILVLSDMSPL 183

Query: 195 NWRLFASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAFIVPLSAIPLGCCLLHMR 252
            WRLF  F  + P II +WISG++  A    ++W W IGMWAFI PLS++P    L +  
Sbjct: 184 RWRLFYQFTASFPCIIISWISGDIVEAANPMKNWSWDIGMWAFIFPLSSLPFITYLFYAT 243

Query: 253 WLAHKNAK-DRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGG 311
            ++ K  K   L+++  T++       + D+F  ++D +G +L+ A  G ILVP TLAGG
Sbjct: 244 HISSKTKKWKDLRNKVETHKR-NIILVVKDIFN-QIDIVGTVLVTAALGLILVPLTLAGG 301

Query: 312 LQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINF 371
           + ++W    II   VIG  + L +FL WE KF+K    P+ L+KDRG++ ++V AF    
Sbjct: 302 VSERWHEPGIIATLVIGIALLL-VFLFWEAKFAKNAALPFNLLKDRGVWASIVAAFLEKM 360

Query: 372 IWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGV 431
           I+ M  DY+Y VL+VSVNE+ KSATRI  L +F++ +     GL+++ V+R K F I G 
Sbjct: 361 IYAMISDYLYPVLLVSVNETNKSATRIVWLPTFMACLCSVFFGLLVVSVQRLKVFTICGT 420

Query: 432 SCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITA 491
             W I+ GL   +R              +LGFG+  FT +   ++QA +  H  MA IT 
Sbjct: 421 FLWIISIGLFYQFRGGESSHSGIIGASIVLGFGSAIFTQSIIVTLQA-MASHDNMASITG 479

Query: 492 LYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPER 551
           LY     +           IWT  + KQ+ K++ +  L    + SP+ FI +Y W T ER
Sbjct: 480 LYFMFAQVGAATGASISGAIWTQTMYKQLLKQLKDSDLTMAVFASPYEFIASYAWGTKER 539

Query: 552 QAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVA 593
             V+ +YR+ QK+  +V L     LL + LF ++ KL   V+
Sbjct: 540 DLVIQAYRHVQKVTMLVSLILTVPLLVSVLFTKDRKLSDSVS 581

>KLTH0B00110g Chr2 complement(1655..3538) [1884 bp, 627 aa] {ON}
           similar to uniprot|P25596 Saccharomyces cerevisiae
           YCL073C and similar to uniprot|P36173 Saccharomyces
           cerevisiae YKR106W
          Length = 627

 Score =  339 bits (869), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 214/601 (35%), Positives = 308/601 (51%), Gaps = 24/601 (3%)

Query: 11  GKINETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSS 70
           G I    L+E+  + +     S  DSN         K+  L      V  +E+ +   S 
Sbjct: 23  GGIKAYELKEEKFDVTEHDIESVADSN---------KSSKLGSGFLKVKEMEIMSSTCSG 73

Query: 71  PIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICY 130
              R  L  S FL  + Y LD   R  Y   ATSSY++H+LLS             QI +
Sbjct: 74  KSARAALLASAFLCGFGYYLDYITRSVYTGYATSSYNEHALLSTIQVINSVISIAAQIIF 133

Query: 131 ARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMD 190
           A+ SDIFGR+ + ++G V Y VGTII+ +A ++  +AVG+ FY  GY GV + L ++  D
Sbjct: 134 AQLSDIFGRLQLFLVGTVLYIVGTIIQCEARDIRTYAVGAAFYNSGYVGVSILLIIVLSD 193

Query: 191 FSNLNWRLFASFVPALPFIINTWISGNV--SGAVGQHWKWGIGMWAFIVPLSAIPLGCCL 248
            S   WRL   F  + P II  WISG++  S    ++W++ IGMWAF+ P+SA+P    L
Sbjct: 194 LSPSKWRLLFQFATSWPCIIICWISGDIVQSANPAKNWRFDIGMWAFLFPISALPFIIFL 253

Query: 249 LHMRWLAHKNAK-DRLKSEFR--TYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVP 305
           L+    A K A+   ++ + +  + R + W   I       +D +G  L+  + GCILVP
Sbjct: 254 LYFTRQASKTAEWKEIQGDNKEPSVRIVYWIKSIYS----NIDVVGTSLVTVSLGCILVP 309

Query: 306 FTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVI 365
            TLAGG+ D W    II   V+G+ V+   FL W+IKF+K  + P+ L+KDRG++ +L  
Sbjct: 310 LTLAGGISDDWNKPGIIATIVVGF-VSFMFFLAWDIKFAKNAVLPFKLLKDRGVWASLAA 368

Query: 366 AFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKP 425
           A     I+    DY+Y VL+VSVNES KSATRI  L +FV+       GL++++ +R K 
Sbjct: 369 ALLEKLIYATISDYLYPVLLVSVNESSKSATRILWLPTFVACTGSIFFGLLVVRTKRLKI 428

Query: 426 FIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSK 485
           + I GV  W ++ GL  HYR              +LG G+  FT +   ++Q ++  H  
Sbjct: 429 YSIIGVCLWILSIGLFYHYRGGASSHSGIIGASVVLGTGSAIFTQSLIVNLQ-TMTSHKN 487

Query: 486 MAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYT 545
           MA IT LY     I           IWT  + KQ+ KR+ + +LAA A+ SP+ FI  Y 
Sbjct: 488 MASITGLYFMFAQIGSASGASISGAIWTQTMYKQLYKRLEDSSLAATAFSSPYEFIELYP 547

Query: 546 WDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELENTPNSDE 605
           W TPER  ++ +YR  QK   +V L     L    LF ++ KL   V       T  SDE
Sbjct: 548 WGTPERTQMIYAYREVQKKTMLVSLVLTGPLFLLILFTKDRKLGDNVT----AETTQSDE 603

Query: 606 Q 606
            
Sbjct: 604 D 604

>KLLA0D19945g Chr4 (1701681..1703615) [1935 bp, 644 aa] {ON} similar
           to uniprot|P36173 Saccharomyces cerevisiae YKR106W
          Length = 644

 Score =  331 bits (848), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 205/571 (35%), Positives = 309/571 (54%), Gaps = 11/571 (1%)

Query: 34  LDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGS 93
           ++  QP    P+L+    +     +  +E+ +       ++ +L  +  +  ++Y LD  
Sbjct: 42  VEETQPVG--PNLEITARFSTKRKMKELEIVSSFCKEWHFQSILLVTAIVCGFSYNLDAV 99

Query: 94  VRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVG 153
           +R TY   AT+S+SQHSLL+             Q+ +AR SD FGR+ +     + Y VG
Sbjct: 100 LRSTYTGYATNSFSQHSLLATINVINSVVSIASQLFFARLSDHFGRLQLFGFCTLMYIVG 159

Query: 154 TIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTW 213
           TI++SQ+ NV+ +A G+ FY  GYTGV L + ++  DFS L WR F    P   +II TW
Sbjct: 160 TILQSQSKNVSIYAGGAVFYNAGYTGVRLLMTIMMSDFSTLGWRYFMIASPDWCYIIITW 219

Query: 214 ISGNVSGAVG--QHWKWGIGMWAFIVPLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYR 271
           +SGN+       ++W W I MWAFI PL+ IPL   L++M + A +   D  K      +
Sbjct: 220 VSGNIIEISNPLENWSWDIAMWAFIFPLTTIPLVGFLVYMFYKASRT--DEWKELRSVTK 277

Query: 272 DMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCV 331
            M    YI +VF W LD  G+LL+  + GCIL+P T++GG  ++WK +  I    +G  V
Sbjct: 278 KMPTPVYIKEVF-WNLDIPGVLLIAISLGCILIPLTVSGGETEEWKDSRNIGVLCLG-SV 335

Query: 332 ALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNES 391
             PIFLLWE K +K P+     +KDRG++  L  +F ++  + +  DY+Y VL+V  N+S
Sbjct: 336 LFPIFLLWEGKIAKRPVLALTYLKDRGVWAPLAASFFMSNAYLIATDYLYAVLLVGFNQS 395

Query: 392 IKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXX 451
             ++ RIT L SF  V+     GL+I + +  K   I G   ++IAFGL   YR      
Sbjct: 396 ESASQRITWLPSFAGVVITPFTGLLITRWKHLKVLTITGCIFYYIAFGLFYRYRGGSTNV 455

Query: 452 XXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALYLAMYNIXXXXXXXXXXXI 511
                    +GFG+G  TY    S+QA V  H+K+A++TAL+     +           I
Sbjct: 456 AGIIVGTIFMGFGSGISTYPLMVSLQA-VSSHTKIAIVTALFYTFEQVGRAVGSSISGAI 514

Query: 512 WTNVLPKQISKRIANE-TLAAEAYGSPFTFILTYTWDTPERQAVVVSYRYTQKILCIVGL 570
           WT V+ K+ISKR+  E  +A  AY SP+TF+  Y W+T +R AVV +Y + QKIL +V L
Sbjct: 515 WTQVMFKEISKRLPEEPEVALAAYASPYTFVTKYGWETSQRMAVVGAYMHVQKILLLVAL 574

Query: 571 CFCSTLLGAALFLRNHKLE-SVVALSELENT 600
                L   A+ +R+ +L  S VALS  +++
Sbjct: 575 LMLCPLFLMAIMMRDAELSTSDVALSSSDDS 605

>KLTH0G00198g Chr7 (5908..7284) [1377 bp, 458 aa] {ON} similar to
           uniprot|P38731 Saccharomyces cerevisiae YHL040C ARN1
           Transporter member of the ARN family of transporters
           that specifically recognize siderophore-iron chelates
           responsible for uptake of iron bound to ferrirubin
           ferrirhodin and related siderophores
          Length = 458

 Score =  294 bits (753), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 154/439 (35%), Positives = 245/439 (55%), Gaps = 5/439 (1%)

Query: 127 QICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLEL 186
           Q+  AR SD FGR+ I +   V Y   +I+ES A N++ +  G+  Y +G+  V + L +
Sbjct: 2   QLILARLSDYFGRLEIFLTSTVLYIARSIVESPAYNISAYGAGAVLYNVGFCCVNIVLLV 61

Query: 187 IAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVG--QHWKWGIGMWAFIVPLSAIPL 244
           +  DFS+L WR+   F P    ++  WISG+V  ++G  +HW WGIG WAF  PL+++P 
Sbjct: 62  VMSDFSSLKWRVLYQFAPTWGCVVIPWISGDVVNSIGPIKHWSWGIGFWAFSFPLASLPF 121

Query: 245 GCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILV 304
            CC+++M +   K+ + +L ++ +   +      ++ +F  ++DFIG L+     GC+LV
Sbjct: 122 ICCMVYMIYTTRKSDQWKLFNQEKPLNEAKLLTRVMRIFH-QVDFIGTLIFSVALGCVLV 180

Query: 305 PFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALV 364
           P TLAGG   KW  +  IVP V+G  V    +++WE   +  P  P+ L+KDRGI+  ++
Sbjct: 181 PLTLAGGYSSKWSHSDSIVPLVVG-SVLFVFYIVWESFMASYPALPFKLLKDRGIWIPIL 239

Query: 365 IAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTK 424
             F ++ ++Y   DYMY VL+V++NES KSAT I SL  FV+ +      +++    R K
Sbjct: 240 AGFLMDLVYYFSCDYMYPVLMVAINESTKSATNIASLPLFVTTVASPFFAVLLRWTGRLK 299

Query: 425 PFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHS 484
            + I G + W ++ GL   YR            + LLG G  F  +    ++QA    H+
Sbjct: 300 WYAIGGFAIWMVSLGLFFRYRCGEGSHDGMVAAVVLLGLGRTFTQFPLLTTMQARAP-HT 358

Query: 485 KMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTY 544
           KMA +T L+    ++           +WT  +PK++ K + +  LA  AY SP+TFI++Y
Sbjct: 359 KMATVTGLFHVWGSVGSVVGASISGAVWTQKMPKKLLKMLGSNGLATAAYASPYTFIISY 418

Query: 545 TWDTPERQAVVVSYRYTQK 563
            W T ER AVV++Y+  QK
Sbjct: 419 PWGTSERLAVVLAYKNVQK 437

>Smik_11.370 Chr11 (653235..654554) [1320 bp, 440 aa] {ON} YKR106W
           (REAL)
          Length = 440

 Score =  290 bits (741), Expect = 5e-91,   Method: Compositional matrix adjust.
 Identities = 164/434 (37%), Positives = 248/434 (57%), Gaps = 5/434 (1%)

Query: 157 ESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISG 216
            S   +V+ +A G+ FY  GY GV L L LI  DFS L WR+F  +    P+II  W+SG
Sbjct: 8   NSLCKHVSIYAAGAVFYNCGYVGVSLILTLILSDFSTLKWRIFYQYSSYWPYIIIPWVSG 67

Query: 217 NVSGAVG--QHWKWGIGMWAFIVPLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMG 274
           N+  A    ++W W I MWAFI PLS++PL C +++++  + K  + +   E       G
Sbjct: 68  NIITAAKPEKNWTWDIAMWAFIFPLSSLPLYCLIIYLKMKSVKTPEWKALKERAHSVKRG 127

Query: 275 WFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALP 334
           +F  I+ +F W+LD IG++L+  + GCILVP TLA G  +KW+++ II   V G  + L 
Sbjct: 128 FFKNIIFLF-WELDVIGIVLITVSTGCILVPLTLAAGASEKWRSSKIIGTLVSGGVLFL- 185

Query: 335 IFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKS 394
           IF+ WE  ++  PL P+ L+KDRGI+  L +AF   F +Y+  D++Y VL+VS+NES  S
Sbjct: 186 IFMFWEASYAHNPLLPFKLLKDRGIWAPLGVAFFNYFTFYIACDFLYPVLLVSMNESSTS 245

Query: 395 ATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXX 454
           A RI +L  FV+        L+I K +R K  +I G + W ++ GL   +R         
Sbjct: 246 AARILNLPDFVASTASPFYSLLIAKSKRLKISVIVGCATWMLSMGLFYRFRGGYGSHGGV 305

Query: 455 XXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTN 514
                ++GF +G     +   +  ++  HS+MAV+T ++     I           +WT 
Sbjct: 306 ISASVIMGF-SGLLCSNSVIVLLQAMTTHSRMAVMTGIHYTFSRIGAAVGASVSGGVWTQ 364

Query: 515 VLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCS 574
            +P ++ K + N+TLAAEAY SP++FI +Y W T ER AVV +Y+Y Q+I+ IVGL    
Sbjct: 365 TMPSRLYKLLGNDTLAAEAYESPYSFIDSYPWGTVERYAVVEAYKYVQRIMMIVGLICTI 424

Query: 575 TLLGAALFLRNHKL 588
            L   +LF+R+ +L
Sbjct: 425 PLFAFSLFMRDPEL 438

>YOL158C Chr15 complement(19491..21311) [1821 bp, 606 aa] {ON}
           ENB1Endosomal ferric enterobactin transporter, expressed
           under conditions of iron deprivation; member of the
           major facilitator superfamily; expression is regulated
           by Rcs1p and affected by chloroquine treatment
          Length = 606

 Score =  248 bits (634), Expect = 2e-73,   Method: Compositional matrix adjust.
 Identities = 170/578 (29%), Positives = 274/578 (47%), Gaps = 20/578 (3%)

Query: 31  SSQLDSNQPDSNQPDLKNYDLYHKD-AGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYG 89
           S + DSN   S    L+  D  +K  +  ++   +   +SS   +  L  +LFL  Y  G
Sbjct: 21  SEKTDSNVEKSTTSGLRRIDAVNKVLSDYSSFTAFGVTFSS--LKTALLVALFLQGYCTG 78

Query: 90  LDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGRMTILIIGLVF 149
           L G +  + Q  A +S+ +HS +               + YAR SD FGR+   I  LV 
Sbjct: 79  LGGQISQSIQTYAANSFGKHSQVGSINTVKSIVASVVAVPYARISDRFGRIECWIFALVL 138

Query: 150 YAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWRLFASFVPALPFI 209
           Y +G II +     +    G    Q GY+G  L    +  D S L  R FA  +  +P I
Sbjct: 139 YTIGEIISAATPTFSGLFAGIVIQQFGYSGFRLLATALTGDLSGLRDRTFAMNIFLIPVI 198

Query: 210 INTWISGNVSGAVGQH-----WKWGIGMWAFIVPLSAIPLGCCLLHMRWLAHKNAKD--- 261
           INTW+SGN+  +V  +     W+WG G++  IVP+S + L    ++ ++++ ++ K    
Sbjct: 199 INTWVSGNIVSSVAGNVAPYKWRWGYGIFCIIVPISTLILVLPYVYAQYISWRSGKLPPL 258

Query: 262 RLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHI 321
           +LK + +T R   W       F   ++ IG++L  A    +L+P T+AGG   KW+  HI
Sbjct: 259 KLKEKGQTLRQTLW------KFADDINLIGVILFTAFLVLVLLPLTIAGGATSKWREGHI 312

Query: 322 IVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMY 381
           I   V+G C+   IFL+WE+KF+K P  P   + D  I+ AL++ F       ++ +Y+ 
Sbjct: 313 IAMIVVGGCLGF-IFLIWELKFAKNPFIPRVYLGDPTIYVALLMEFVWRLGLQIELEYLV 371

Query: 382 TVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLL 441
           TVL+V+  ES  SA RI  LY+F+   T  ++G+++      K F++ G     I  GLL
Sbjct: 372 TVLMVAFGESTLSAQRIAQLYNFLQSCTNIVVGIMLHFYPHPKVFVVAGSLLGVIGMGLL 431

Query: 442 VHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALYLAMYNIXX 501
             YR              ++G   G   +     + AS   H++MA +T L +++Y I  
Sbjct: 432 YKYRVVYDGISGLIGAEIVVGIAGGMIRFPMWTLVHASTT-HNEMATVTGLLMSVYQIGD 490

Query: 502 XXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPERQAVVVSYRYT 561
                    IWT  L K++ +R+ + +L    Y SP  ++  Y   +  R  ++ SY   
Sbjct: 491 AVGASIAGAIWTQRLAKELIQRLGS-SLGMAIYKSPLNYLKKYPIGSEVRVQMIESYSKI 549

Query: 562 QKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELEN 599
           Q++L IV + F +       FLR   +    +LS  E 
Sbjct: 550 QRLLIIVSISFAAFNAVLCFFLRGFTVNKKQSLSAEER 587

>Smik_21.4 Chr21 (1261..3078) [1818 bp, 605 aa] {ON} YOL158C (REAL)
          Length = 605

 Score =  218 bits (555), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 157/534 (29%), Positives = 251/534 (47%), Gaps = 17/534 (3%)

Query: 74  RVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARA 133
           ++ L  +LFL  Y  GL G +  + Q  A +S+ +HS +               + YAR 
Sbjct: 62  KITLLVALFLQGYCTGLGGQISQSIQTYAANSFGKHSQVGSINTVKSIVASVVAVPYARM 121

Query: 134 SDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSN 193
           SD FGR+   +  LV Y VG II +          G    Q GY+G  L    +  D S 
Sbjct: 122 SDRFGRIECWMFALVLYTVGEIISAATPTFAGLFAGIVIQQFGYSGFRLLATALTGDLSG 181

Query: 194 LNWRLFASFVPALPFIINTWISGNVSGAVGQH-----WKWGIGMWAFIVPLSAIPLGCCL 248
           L  R FA  +  +P IINTW+SGN+  +V  H     W+WG G++  IVP S + L    
Sbjct: 182 LRDRTFAMNIFLIPVIINTWVSGNIVSSVAGHTTPYNWRWGYGIFCIIVPFSTLMLVLPY 241

Query: 249 LHMRWLAHKNA---KDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVP 305
            + +++  +N      +L+ + +  R   W   IV+     ++ IG++L  A    +L+P
Sbjct: 242 AYAQYIGWRNGTLPPYKLREKGQNLRQTLW--KIVE----DINLIGVILFSAFLVLLLLP 295

Query: 306 FTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVI 365
            T+AGG   KW+  +II   V+G C+   IFL+WE++F+K P  P   + D  I+ AL++
Sbjct: 296 LTIAGGATSKWREGYIIAMIVVGGCLGF-IFLIWELRFAKNPFIPRVYLGDPTIYVALLM 354

Query: 366 AFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKP 425
            F       ++ +Y+ TVL+V+  ES  SA RI  LY+F+   T  ++G+++      K 
Sbjct: 355 EFVWRLSLQIELEYLVTVLMVAFGESKLSAQRIAQLYNFLQSCTNIVVGIILHFYPHPKL 414

Query: 426 FIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSK 485
           F++ G     +  GLL  YR              ++G   G   +     + AS   H++
Sbjct: 415 FVVAGSLLGVLGMGLLYKYRVVYDGISGLIGAEIVVGIAGGMIRFPMWTLVHASTT-HNE 473

Query: 486 MAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYT 545
           MA +T L +++Y I           IWT  L K++ +R+ +  L    Y SP  ++  Y 
Sbjct: 474 MATVTGLLMSVYQIGDAVGASIAGAIWTQCLAKELIQRLGSN-LGMSIYKSPLNYLKKYP 532

Query: 546 WDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELEN 599
             +  R  +V SY   Q++L IV + F +       FLR   +    + S  E 
Sbjct: 533 IGSEVRDQMVESYSKIQRLLIIVSISFAAFNAVLCFFLRGFTVNKKQSFSTEER 586

>TDEL0H01600 Chr8 complement(273692..275506) [1815 bp, 604 aa] {ON} 
          Length = 604

 Score =  211 bits (537), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 168/603 (27%), Positives = 273/603 (45%), Gaps = 23/603 (3%)

Query: 13  INETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPI 72
           I+  +L++   E+ +  +SS   +N+P  +    +   +    +   +   +  ++ +  
Sbjct: 2   IDPELLKKDHVEEDDDKSSSLSQTNEPPLSNGVRRMDAVNATLSRAGSFTAFGVRFQT-- 59

Query: 73  YRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYAR 132
            ++ L  +LFL  Y  GL G +  + Q  A +++ +   +               + YAR
Sbjct: 60  LKIALLIALFLQGYCTGLGGQISQSIQTYAANAFKKQPQIGSINTVKSVVAAAVAVPYAR 119

Query: 133 ASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFS 192
            SD FGR+   I  LV Y VG II +          G    Q GY+G  L    +  D S
Sbjct: 120 LSDRFGRIECWIFALVLYTVGDIISAATPTFGGLFAGVVIQQFGYSGFRLLATALTADIS 179

Query: 193 NLNWRLFASFVPALPFIINTWISGNVSGA-----VGQHWKWGIGMWAFIVPLSAIPLGCC 247
            L  R FA  +  +P IINTW+SGN+  +     V   W+WG G++  IVP S + L   
Sbjct: 180 GLRDRTFAMNIFLIPVIINTWVSGNIVDSLAGVKVPYEWRWGYGIFCIIVPFSTLLLILP 239

Query: 248 LLHMRWLAHKNAKDRLKS-EFRTYRDMGWFAYIVDVFLWKL----DFIGLLLLCATFGCI 302
             + ++LA +    RL   EFR  +   W        LWKL    + IG++L  A    +
Sbjct: 240 YAYAQYLAWREG--RLPQFEFRK-QGQSW-----KQALWKLTEDVNLIGIVLFTAFLVLV 291

Query: 303 LVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFA 362
           L+P TLAGG   KWK  HII   V+G C  + +F +WE+  +K P  P   + D  I+ A
Sbjct: 292 LLPLTLAGGASTKWKEGHIIAMIVVGGCCGI-LFFVWELWLAKKPFIPRVYLGDATIYVA 350

Query: 363 LVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRR 422
           L++ F       ++ +Y+ TVL+V+  ES  SA RI  LY+F+   T  ++G+++     
Sbjct: 351 LLMEFAWRLALQIELEYLITVLMVAFGESKLSAQRIGQLYNFLQSCTNVVVGIMLHFYPH 410

Query: 423 TKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKY 482
            KPFI+ G     +  GLL  YR              ++G       +     + AS   
Sbjct: 411 PKPFIVAGSLLGVLGMGLLYKYRVAYDGISGLIGAEVVVGIAGSMVRFPMWTLVHASTS- 469

Query: 483 HSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFIL 542
           H +MAV T L +++Y I           IWT  L K++ KR+ ++   A  Y SP +++ 
Sbjct: 470 HEEMAVATGLLMSVYQIGNAVGASIAGAIWTQRLAKELIKRLGSKVGLA-VYNSPLSYLT 528

Query: 543 TYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSELENTPN 602
            Y   +  R  ++ SY   Q++L IV + F +       FL  + +    + ++ E    
Sbjct: 529 KYPLGSEVRNEILESYSEIQRLLIIVSISFAALNAVLCFFLPGYTVSEKQSFTQEEREKK 588

Query: 603 SDE 605
             E
Sbjct: 589 KLE 591

>Suva_26.1 Chr26 (1..1602) [1602 bp, 534 aa] {ON} YOL158C (REAL)
          Length = 534

 Score =  205 bits (521), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 144/486 (29%), Positives = 230/486 (47%), Gaps = 17/486 (3%)

Query: 74  RVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARA 133
           + +L  +LFL  Y  GL G +  + Q  A + + +HS +               + YAR 
Sbjct: 58  KTVLLVALFLQGYCTGLGGQISQSIQTYAANGFGKHSQVGSINTVKSIVSSVVAVPYARM 117

Query: 134 SDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSN 193
           SD FGR+   I  LV Y VG II +   N      G    Q GY+G  L    +  D S 
Sbjct: 118 SDRFGRIECWIFALVLYTVGEIISAATPNFGGLFAGIVIQQFGYSGFRLLATALTGDLSG 177

Query: 194 LNWRLFASFVPALPFIINTWISGNV----SGAVGQH-WKWGIGMWAFIVPLSAIPLGCCL 248
           L  R FA  +  +P IINTW+SGN+    +G+V  + W+WG G++  IVP S + L    
Sbjct: 178 LRDRTFAMNIFLIPVIINTWVSGNIVSSLAGSVAPYKWRWGYGIFCIIVPFSTLILVLPY 237

Query: 249 LHMRWLAHKNAKD---RLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVP 305
            + ++++ +N      +LK + +  R   W       F   ++ IG++L  A    +L+P
Sbjct: 238 AYAQYISWRNGTLPPFKLKEKGQNLRQTIW------KFAEDINLIGIILFTAFLVLVLLP 291

Query: 306 FTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVI 365
            T+AGG   KW+  +II   V+G  +   IFL+WE++F+K P  P   + D  I+ AL++
Sbjct: 292 LTIAGGATSKWREGYIIAMIVVGGFLGF-IFLIWELRFAKNPFIPRVYLGDPTIYVALLM 350

Query: 366 AFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKP 425
            F       ++ +Y+ TVL+V+  ES  SA RI  LY+F+   T  ++G+++      K 
Sbjct: 351 EFVWRLGLQIELEYLVTVLMVAFGESTLSAQRIGQLYNFLQSCTNIVVGIILHFYPHPKV 410

Query: 426 FIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSK 485
           F++ G     +  GLL  YR              ++G   G   +     + AS   H +
Sbjct: 411 FVVAGSLLGVLGMGLLYKYRVVYDGISGLIGAEIVVGIAGGMIRFPMWTLVHASTT-HKE 469

Query: 486 MAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYT 545
           MA +T L +++Y I           IWT  L K++ +R+  + L    Y SP  ++  Y 
Sbjct: 470 MATVTGLLMSVYQIGDAVGASIAGAIWTQRLAKELIQRLGYD-LGMSIYKSPLNYLKKYP 528

Query: 546 WDTPER 551
             +  R
Sbjct: 529 IGSEVR 534

>Skud_6.14 Chr6 complement(19547..21457) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score =  187 bits (474), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 168/620 (27%), Positives = 280/620 (45%), Gaps = 54/620 (8%)

Query: 1   MTSSSDSKFDGKIN-ETVLQEQTTEDSNQFNSSQLDSN-QPDSNQPDLKNYDLYHKDAGV 58
           + S +DS   GK+N +    E+   D+ + N   +D + +  ++     + +   K  GV
Sbjct: 4   VVSITDS-ISGKLNVQEKYHEEAKSDAAEKNLVSIDGSLKQITSATSCYDGEKIIKTRGV 62

Query: 59  NNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXX 118
             IEV  E+ S+ + R +L  S+FL +    LD +  Y YQ  ATSS+++HS+LS     
Sbjct: 63  TRIEVVREKMSTRV-RWILGLSIFLTSAVAALDATTTYNYQPYATSSFNRHSMLSTLTIA 121

Query: 119 XXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYT 178
                   +   A+ SD+  R     + L+ Y +G +I + +  +  + VGS F  +G +
Sbjct: 122 NSVIGAVCKPFIAKISDLSSRPVTYFVVLLLYVIGFVITACSPTIAAYVVGSVFIAIGQS 181

Query: 179 GVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGN-VSGAVGQHWKWGIGMWAFIV 237
           G+ L   +I  D + L WR F + + ++P+++ TWISG  V   +  +W+WG GM+A I 
Sbjct: 182 GISLMNMVIIADTTTLKWRSFFTSLLSVPYLVTTWISGYIVEDIINSNWRWGYGMFAIIT 241

Query: 238 PLSAIPLGCCLLHMRWLAHKN-------------AKDRLK------SEFRTYRDMGWFAY 278
           P++  P    +L M +L H+              +K R++      S FR Y ++     
Sbjct: 242 PVALTP---AILVMAYLEHQANKTGEIPVGSDPLSKKRIEVTESHVSGFREYWEL----- 293

Query: 279 IVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLL 338
            V V L ++D  GL+LL   F  IL+P +L    +  W    +I  EV+G  + L  +++
Sbjct: 294 -VKVSLIEIDAFGLILLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVG-GIFLISYVV 351

Query: 339 WEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYMQG--------DYMYTVLIVSVNE 390
           +E+ F+  PL P  ++ +R  F   VI   I+FI+ M G         Y + VL +S   
Sbjct: 352 FEVFFAPFPLLPKRVLMNR-TFICCVI---IDFIYQMAGYFSLLFFTSYTFVVLNLSYRN 407

Query: 391 SIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLLV--HYRXXX 448
            +  +   T    F  V+ G L         R K F + G++   I  GL V    +   
Sbjct: 408 WVYLSNTTTMGLCFFGVVWGALFR----GFHRYKIFQVVGIAIKLIGMGLYVTCSKKEGS 463

Query: 449 XXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALYLAMYNIXXXXXXXXX 508
                    L +  FG       TQ + QA+V +    A I+ L L   +I         
Sbjct: 464 PGIGLVVAALVVTNFGDAANVMGTQVAAQAAVPHQDMAATISVLSL-YSSIGAAVGTAIT 522

Query: 509 XXIWTNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPERQAVVVSYRYTQKILCIV 568
             IWT+ LP  +SK + +   AA A+    T +    W +  R+  + +Y+     L  +
Sbjct: 523 SAIWTDRLPGALSKYVPDREKAA-AFFESLTTVWEEPWGSANREGAIDAYQEVNYTLFCM 581

Query: 569 GLCFCSTLLGAALFLRNHKL 588
           GL   + +   ALF  N+ L
Sbjct: 582 GLGVSAIMFIVALFQTNYYL 601

>Smik_6.22 Chr6 complement(31536..33446) [1911 bp, 636 aa] {ON}
           YEL065W (REAL)
          Length = 636

 Score =  185 bits (470), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 165/616 (26%), Positives = 276/616 (44%), Gaps = 49/616 (7%)

Query: 1   MTSSSDSK--FDGKINETVLQEQTTEDSNQFNS--SQLDSNQPDSNQPDLKNYDLYHKDA 56
           MT S+  +  F  K+++   ++   +D    N    Q+ S+    N   +       K  
Sbjct: 7   MTDSTSGQLNFQEKLHDEARKDAAEKDLISVNGCLQQVSSSITSCNGEKIV------KTR 60

Query: 57  GVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXX 116
           GV  IEV  E+ S+ +  + L  S+FL ++   LD +  Y YQ  ATSS+++HS+LS   
Sbjct: 61  GVTRIEVVREKMSTKVIWI-LGLSIFLTSWVAALDATTTYNYQPYATSSFNRHSMLSTLT 119

Query: 117 XXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLG 176
                     +   A+ SD+  R     + L+ Y +G +I + + N++ + +GS F  +G
Sbjct: 120 IANSVIGAVCKPFIAKISDLSSRPVTYFVVLLLYVIGFVITACSPNISAYVIGSVFIAVG 179

Query: 177 YTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGN-VSGAVGQHWKWGIGMWAF 235
            +G+ L   +I  D + L WR F + + ++P+++ TWISG  V   +  +W+WG GM+A 
Sbjct: 180 QSGISLMNMVIIADTTTLKWRSFFTSLLSVPYLVTTWISGYIVEDIINSNWRWGYGMFAI 239

Query: 236 IVPLSAIPLGCCLLHMRWLAHKNAK-----------DRLKSEFRTYRDMGWFAY--IVDV 282
           I P++  P    +L M +L H   K            + K E    R  G+  Y  ++ V
Sbjct: 240 ITPVALTP---AILVMAYLEHSANKAGEIPIGFDPLAKKKVEVTEARIRGFKVYWELLKV 296

Query: 283 FLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIK 342
            L ++D  GL+LL   F  IL+P +L    +  W    +I  EV+G  + L  ++++E+ 
Sbjct: 297 SLIEIDAFGLILLGFAFSLILLPCSLYSYAEGGWNNPSMIAMEVVG-GILLISYVVFEVF 355

Query: 343 FSKVPLTPWALIKDRGIFFALVIAFHINFIWYMQG--------DYMYTVLIVSVNESIKS 394
           F+  PL P  ++ +R  F   VI   I+FI+ M G         Y + VL +S  + +  
Sbjct: 356 FAPFPLLPKRVLMNR-TFICCVI---IDFIYQMAGYFSLLFFTSYTFVVLNLSYRDWVYL 411

Query: 395 ATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLLV--HYRXXXXXXX 452
           +   T    F  V+ G L         R K F + G++   I  GL V    +       
Sbjct: 412 SNTTTMGLCFFGVVWGALFR----GFHRYKIFQVVGIAIKLIGMGLYVACSKKDGSPGIG 467

Query: 453 XXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALYLAMYNIXXXXXXXXXXXIW 512
                L +  FG       TQ + QA+V +    A I+ L L   +I           +W
Sbjct: 468 LVVAALVVTNFGDAANVMGTQVAAQAAVPHQDMAATISVLSL-YSSIGAAVGTAITSAVW 526

Query: 513 TNVLPKQISKRIANETLAAEAYGSPFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCF 572
           T+ LP  + K + ++  A  A+    T I    W +  R+  + +Y+     L  +GL  
Sbjct: 527 TDQLPGALFKYVPDKEKAV-AFFESLTSIWEEPWGSINREGAISAYQEVNYTLFCMGLGV 585

Query: 573 CSTLLGAALFLRNHKL 588
            S +   ALF  N+ L
Sbjct: 586 SSIMFVVALFQTNYYL 601

>Suva_10.9 Chr10 complement(12679..14592) [1914 bp, 637 aa] {ON}
           YEL065W (REAL)
          Length = 637

 Score =  185 bits (469), Expect = 5e-50,   Method: Compositional matrix adjust.
 Identities = 151/551 (27%), Positives = 251/551 (45%), Gaps = 23/551 (4%)

Query: 54  KDAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLS 113
           K  GV  IEV  E+ S+ +  + L  S+ L A+   LD +  Y YQ  ATSS+++HS+LS
Sbjct: 59  KTRGVTRIEVVKEKMSTKVTWI-LAASILLTAWIAALDATTTYNYQPYATSSFNRHSMLS 117

Query: 114 XXXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFY 173
                        +   A+ SD+  R     + L+ Y +G II + +  +  + VGS F 
Sbjct: 118 TLTIANSVIGAVCKPFIAKISDLSSRPVTYFVVLILYVIGFIITACSPTIAAYVVGSVFI 177

Query: 174 QLGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGN-VSGAVGQHWKWGIGM 232
            +G +G+ L   +I  D ++L WR F + + ++P+++ TWISG  V   +  +W+WG GM
Sbjct: 178 AVGQSGINLMNMVIVADTTSLKWRSFITSLLSVPYLVTTWISGYIVQNIISSNWRWGYGM 237

Query: 233 WAFIVPLSAIPLGCCLLHMRWLAHKNAK--------DRLKSEFRTYRDMGWFAY-----I 279
           +A I P++  P    +L M +L H+  K        D L  + R  R+ G   +     +
Sbjct: 238 FAIITPVALTP---AILVMAYLEHEANKTGEIPIGSDPLTEKKREIRESGISGFKGYWQL 294

Query: 280 VDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLW 339
           +   L ++D  GL+LL   F  IL+P +L    +  WK   +I  EVIG  + L  ++++
Sbjct: 295 LKTSLIEIDAFGLILLGFAFSLILLPCSLYSYAEGGWKNPSMIAMEVIG-GIFLISYVIF 353

Query: 340 EIKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRIT 399
           E+ F+  PL P  ++ +R     +VI F      Y    +  +   V +N S K+   ++
Sbjct: 354 EVFFAPFPLLPKRVLVNRTFICCVVIDFIYQMGGYFSLLFFTSYTFVVLNLSYKNWVYLS 413

Query: 400 SLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLLV--HYRXXXXXXXXXXXX 457
           +  +      G + G++     R K F + G++   I  GL V    +            
Sbjct: 414 NTTTMGLCFFGVVWGVLFRYFHRYKIFQVVGIAIKLIGMGLYVACSKKDGSPGIGLIVAA 473

Query: 458 LCLLGFGAGFFTYTTQASIQASVKYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLP 517
           L +  FG       TQ + QA+V +    A I+ L L   +I           +WTN LP
Sbjct: 474 LIVTNFGDAANVMGTQVAAQAAVPHQDMAATISVLSL-YSSIGAAVGTAITSAVWTNELP 532

Query: 518 KQISKRIANETLAAEAYGSPFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLL 577
             + K + ++  A   + S  T I    W +  R+  + +Y+     L  +GL   S + 
Sbjct: 533 GALLKYVPDKEKAITFFES-LTLIWQEPWGSENREGAIAAYQEVNYTLFCMGLGVSSIMF 591

Query: 578 GAALFLRNHKL 588
             ALF  N  L
Sbjct: 592 IVALFQTNFYL 602

>TDEL0A03210 Chr1 (574153..575907) [1755 bp, 584 aa] {ON} 
          Length = 584

 Score =  130 bits (328), Expect = 2e-31,   Method: Compositional matrix adjust.
 Identities = 133/588 (22%), Positives = 250/588 (42%), Gaps = 23/588 (3%)

Query: 17  VLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPIYRVM 76
           V   +  + S +  SS+ + N   S+  ++ N +L         +    ++       ++
Sbjct: 11  VKSSKPAQVSEKTVSSEAEDNVLPSSDDEVINEELQKGVQKAQAMTQLWKKRDLIAIFII 70

Query: 77  LFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDI 136
           ++   F++A++ G+ G    T     TSS+ QHSL +             QI   ++ DI
Sbjct: 71  IWVIQFVLAFSSGIIG----TLTPYVTSSFEQHSLTAFDWCYFNSYCWSDQIALCQSIDI 126

Query: 137 FGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNW 196
           +GR       ++   +GTI+ +   NV  +     FY +GY G+  ++ +   D + L  
Sbjct: 127 WGRAQGFAFMVLSITIGTIMMAGCNNVKTYCAAQVFYWVGYNGIDFTITIFIADTTKLKN 186

Query: 197 RLFASFVPALPFIINTWISGNVSGAVGQ--HWKWGIGMWAFIVPLSAIPLGCCLLHMRWL 254
           R F     +  +I   W  G  + ++     ++WG G+WA I+P+   PL   L + +  
Sbjct: 187 RAFILAYTSSCYIATVWAYGPAAESILNTIGFRWGFGIWAIIIPVVCSPLFGLLYYYQQK 246

Query: 255 AHKNA--KDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGL 312
           A K      R KS    ++ + ++         + D IG+ +L       L+ F L    
Sbjct: 247 AVKVGLIPKREKSGRTFWQSVVFYGK-------EFDVIGIFILALGLALFLLGFNLYSYQ 299

Query: 313 QDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFI 372
           +++W++  II   +IG  + +  F +WE  F+ V   PW L+ +R + F   +A  +   
Sbjct: 300 KNEWRSPLIICFLIIGGLLIIS-FGIWE-YFAPVSFIPWELLTNRTVIFTYSMAAAMYCS 357

Query: 373 WYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIF-GV 431
           +Y+   Y +       N S   AT IT++YS  S     ++G++I    R K   +F GV
Sbjct: 358 FYIWDSYFFRHH-CRFNLSTARATYITNIYSIGSCFCALVVGVIIRCYGRLKSIALFWGV 416

Query: 432 SCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVITA 491
               +  GL++ YR               + FG G      Q ++ A V     +  + A
Sbjct: 417 PITMLGCGLMIKYRSPDSNLGLIVMCQLFIAFGGGALVICEQMTVMA-VSAQQHIPAVLA 475

Query: 492 LYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIANETLAA--EAYGSPFTFILTYTWDTP 549
           +   +  I           +WT + PK++++ +  +        YGS  T  ++Y   T 
Sbjct: 476 MEAMVIAIGEAVGQTIAGAMWTGIFPKKLAEYLPADVQDQLLSIYGS-LTVQISYPRGTA 534

Query: 550 ERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNHKLESVVALSEL 597
            R+A+  SY  TQ+++CI   C  +T + + L  +   ++ +  +  L
Sbjct: 535 AREAIDRSYGDTQRLMCIAATCIYATCIFSTLLWKEVNVKEIKQVKGL 582

>NCAS0I00100 Chr9 complement(4805..5296) [492 bp, 163 aa] {ON} 
          Length = 163

 Score =  101 bits (251), Expect = 3e-24,   Method: Composition-based stats.
 Identities = 57/127 (44%), Positives = 73/127 (57%), Gaps = 2/127 (1%)

Query: 468 FTYTTQASIQASVKYHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVLPKQISKRIA-N 526
           FTY    S QA+   H  MA +TAL   +Y I           IWT  L  +I KR+  N
Sbjct: 2   FTYPVTVSCQAATS-HEHMATVTALTYTVYRIGSAVGSAISGCIWTQKLYPEILKRLGGN 60

Query: 527 ETLAAEAYGSPFTFILTYTWDTPERQAVVVSYRYTQKILCIVGLCFCSTLLGAALFLRNH 586
            ++A  AY SP+TFI TYTW T ER+AVV +Y+Y QK+  +V L FC+ LL  +L LR+ 
Sbjct: 61  VSMATAAYASPYTFITTYTWGTSEREAVVEAYKYVQKLETVVALVFCAPLLMFSLCLRDA 120

Query: 587 KLESVVA 593
           KL   VA
Sbjct: 121 KLTDKVA 127

>Smik_11.369 Chr11 (652600..653106) [507 bp, 168 aa] {ON} YKR106W
           (REAL)
          Length = 168

 Score = 98.2 bits (243), Expect = 4e-23,   Method: Compositional matrix adjust.
 Identities = 47/145 (32%), Positives = 82/145 (56%)

Query: 39  PDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTY 98
            + N P+  ++        +   E+ + Q++S  YR+++  + FL  + + LD ++R TY
Sbjct: 22  AEKNDPESDSFSESFIGFKIEESELISSQFNSLTYRILILSTAFLCGFGFSLDATLRSTY 81

Query: 99  QAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIES 158
              AT+SY++HSLLS             Q+ ++R SD FGR+ +  +  + Y +GTI++S
Sbjct: 82  TGYATNSYAEHSLLSTIQVINAVVSVGSQVVFSRLSDYFGRLELFTVASILYIIGTIVQS 141

Query: 159 QATNVTRFAVGSCFYQLGYTGVILS 183
           QA +V+ +A G+ FY  GY GV L+
Sbjct: 142 QAYSVSIYAAGAVFYNCGYVGVSLN 166

>Kwal_26.9616 s26 (1294683..1296371) [1689 bp, 562 aa] {ON} YPR198W
           (SGE1) - Member of drug-resistance protein family
           [contig 363] FULL
          Length = 562

 Score = 68.9 bits (167), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 76/338 (22%), Positives = 139/338 (41%), Gaps = 31/338 (9%)

Query: 127 QICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLEL 186
            + + R + + G    L+  +V +  G+++ + AT++     G      G +G+   +  
Sbjct: 59  MLLWGRIASLVGLKNSLVASIVIFEAGSLLAALATSMGMLIGGRVIAGFGGSGIETLVFA 118

Query: 187 IAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGC 246
           +     +   R     +  + +++       + GA  +H  W    W F +    IP+G 
Sbjct: 119 VGTRMVDEKHRARVVTILGIAYMLAEGAGPFIGGAFAEHVSW---RWCFFIN---IPIGG 172

Query: 247 CLLHMRWLAHKNAK----DRLKSEFRTYRDMGW--------FAYIVDVFLWKLDFIGLLL 294
             L +    +  A     + L   +++YR   W           +V +F+++LD +GLLL
Sbjct: 173 VALAILCWGYNPAGRTPINALNHYWKSYRKCSWKKVFRLTSLTKVVKLFIYQLDIVGLLL 232

Query: 295 LCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEI-----------KF 343
               F  I++  T  GG +  W +A II    IG  + L IF+L++              
Sbjct: 233 SSGGFALIMLALTF-GGNKFAWNSASIICMFTIGIAL-LGIFMLYDFVVLPYIGRRLENG 290

Query: 344 SKVPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYS 403
             +PL PW+L  +  I  + +  F  +F + +Q  Y+     +  NE    A+      S
Sbjct: 291 EAMPLVPWSLACNMPILTSSMAGFFNSFAFELQSIYLVQYYQLVTNEGPVFASIHLWQMS 350

Query: 404 FVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLL 441
             ++IT  +   +  K    KP I+ GV   FI  GLL
Sbjct: 351 VPALITVIVSAAINEKFGIVKPIIVTGVVFGFIGSGLL 388

>Smik_17.11 Chr17 complement(8582..10216) [1635 bp, 544 aa] {ON}
           YPR198W (REAL)
          Length = 544

 Score = 68.2 bits (165), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 74/338 (21%), Positives = 148/338 (43%), Gaps = 34/338 (10%)

Query: 128 ICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELI 187
           + + R ++I G    L+I +V + +G++I + +  +     G      G +G+     ++
Sbjct: 61  LLWGRLAEILGTTECLMISVVIFEIGSLISALSNTMGTLIGGRVIAGFGGSGIESLAFVV 120

Query: 188 AMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLG-- 245
                  N+R       A+ ++I   +   + GA  +H  W    W F + L   P+G  
Sbjct: 121 GTSIVQENYRGIMITALAVSYVIAEGVGPFIGGAFNEHLSW---RWCFYINL---PIGAF 174

Query: 246 -------CCLLHMRWLAHKNAKDRLKS--EFRTYR--DMGWFAYIVDVFLWKLDFIGLLL 294
                  CC    +WL+ K    ++ S   ++ Y      ++  +  + ++KLD IG++L
Sbjct: 175 AFISLAFCCASGGKWLSKKWLLSKINSITSYKYYEIFKASFWKKVFQILVFKLDMIGIIL 234

Query: 295 LCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIG------WCV----ALPIF-LLWEIKF 343
             A F  +++  +  GG    W ++ II    +G      +C      LP+  + ++ K+
Sbjct: 235 SSAGFTLLMLGLSF-GGNNFAWNSSIIISFFTLGPILLILFCAYDFHILPLLGVHYKSKY 293

Query: 344 SKVPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVL-IVSVNESIKSATRITSLY 402
           ++ PL  W +  + GIF + +  F   F + +Q  Y+  +  +V    S+ ++  +  L 
Sbjct: 294 AR-PLLTWKIASNAGIFTSSITGFFSCFAYELQSAYLVQLYQLVLKRNSMLASIHLWEL- 351

Query: 403 SFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGL 440
           S  ++IT      +  K    KP I+FGV C  +  G+
Sbjct: 352 SIPAMITTMATAYLNAKYGIIKPAIVFGVLCGIVGSGI 389

>Skud_16.503 Chr16 (880571..882202) [1632 bp, 543 aa] {ON} YPR198W
           (REAL)
          Length = 543

 Score = 62.4 bits (150), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 76/333 (22%), Positives = 139/333 (41%), Gaps = 25/333 (7%)

Query: 128 ICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELI 187
           + + R ++I G    L+I ++ + VG++I + + ++     G      G +G+     ++
Sbjct: 61  LLWGRLAEILGTNECLMISVIIFEVGSLISALSNSMGTLISGRLIAGFGGSGIESLAFVV 120

Query: 188 AMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIV--PLSA---I 242
                  N R       A  ++I   +   + GA  +H  W    W F +  P+ A   I
Sbjct: 121 GTSIVQENHRGTMITALATSYVIAEGVGPFIGGAFNEHLSW---RWCFYINLPIGAFALI 177

Query: 243 PLGCCLLHMRWLAHKNAKDRLKS----EFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCAT 298
            L  C      L   +   ++KS    ++       ++     VF++KLD IG+ L  A 
Sbjct: 178 ILAFCNTSGESLPKVSLLSKIKSIMSYKYDEVFKASFWKKAFKVFVFKLDMIGVTLSSAG 237

Query: 299 FGCILVPFTLAGGLQDKWKTAHIIVPEVIG------WCVA----LPIF-LLWEIKFSKVP 347
           F  +++  +  GG    W ++ II    +G      +C      LP+  L +E K +K P
Sbjct: 238 FTLLMLGLSF-GGNNFAWNSSTIISLFTVGPILLILFCAYDFHFLPLLGLRYENKRTK-P 295

Query: 348 LTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSV 407
           L  W++  + GIF + V  F   F + +Q  Y+  +  + +      A+      S  ++
Sbjct: 296 LLTWSIASNSGIFTSSVTGFFSCFAYELQSAYLVQLYQLVLKRKPTLASIHLWELSIPAI 355

Query: 408 ITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGL 440
           I    +  +  K    KP I+FGV C  +  GL
Sbjct: 356 IATMAIAYLNAKYGIIKPAIVFGVLCGIVGSGL 388

>TBLA0D03270 Chr4 complement(813041..814693) [1653 bp, 550 aa] {ON}
           Anc_8.843 YMR279C
          Length = 550

 Score = 58.9 bits (141), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 46/148 (31%), Positives = 82/148 (55%), Gaps = 8/148 (5%)

Query: 286 KLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSK 345
           K+D++G +L    FG I++ F         W++A+IIV  V+ +C AL IF+++E+K++K
Sbjct: 270 KMDWLGSVL--GVFGLIILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYEVKYAK 326

Query: 346 VPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFV 405
            PL P A+  +RG+   L+I F +   W   G + +      +N    S     S Y F+
Sbjct: 327 TPLIPKAISSNRGM---LMILFSLFCGWGSFGIWTFYYFSFELNLRHYSPLWAGSSY-FI 382

Query: 406 SVITGTLLGLVI-IKVRRTKPFIIFGVS 432
            VI+G+ + +V  + +++ KP ++F  S
Sbjct: 383 FVISGSTVAIVCGLTIKKIKPSVLFCCS 410

>YPR198W Chr16 (934034..935665) [1632 bp, 543 aa] {ON}  SGE1Plasma
           membrane multidrug transporter of the major facilitator
           superfamily, acts as an extrusion permease; partial
           multicopy suppressor of gal11 mutations
          Length = 543

 Score = 58.5 bits (140), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 71/335 (21%), Positives = 138/335 (41%), Gaps = 33/335 (9%)

Query: 130 YARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAM 189
           + R ++I G    L+I ++ + +G++I + + ++     G      G +G+     ++  
Sbjct: 63  WGRLAEILGTKECLMISVIVFEIGSLISALSNSMATLISGRVVAGFGGSGIESLAFVVGT 122

Query: 190 DFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQH--WKW------GIGMWAFIV---- 237
                N R       A+ ++I   +   + GA  +H  W+W       IG +AFI+    
Sbjct: 123 SIVRENHRGIMITALAISYVIAEGVGPFIGGAFNEHLSWRWCFYINLPIGAFAFIILAFC 182

Query: 238 PLSAIPLGCCLLHMR-WLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLC 296
             S  P      H + WL  K  K  +  ++       ++    +V ++KLD +G++L  
Sbjct: 183 NTSGEP------HQKMWLPSK-IKKIMNYDYGELLKASFWKNTFEVLVFKLDMVGIILSS 235

Query: 297 ATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKV---------- 346
           A F  +++  +  GG    W +  II    +G  + L +F  ++  F  +          
Sbjct: 236 AGFTLLMLGLSF-GGNNFPWNSGIIICFFTVG-PILLLLFCAYDFHFLSLSGLHYDNKRI 293

Query: 347 -PLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFV 405
            PL  W +  + GIF + +  F   F + +Q  Y+  +  +   +    A+      S  
Sbjct: 294 KPLLTWNIASNCGIFTSSITGFLSCFAYELQSAYLVQLYQLVFKKKPTLASIHLWELSIP 353

Query: 406 SVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGL 440
           ++I    +  +  K    KP I+FGV C  +  GL
Sbjct: 354 AMIATMAIAYLNSKYGIIKPAIVFGVLCGIVGSGL 388

>KNAG0K01020 Chr11 complement(198213..200012) [1800 bp, 599 aa] {ON}
           
          Length = 599

 Score = 57.4 bits (137), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 76/323 (23%), Positives = 130/323 (40%), Gaps = 25/323 (7%)

Query: 137 FGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNW 196
            G  T ++  +V + +G++I + A ++     G     +G +G+     +I     +   
Sbjct: 121 LGFKTAMLSAIVIFEIGSLICALANSMDMLIGGRVIAGIGGSGIQSLSFVIGSTLVSPRG 180

Query: 197 RLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGC-CLLHMRWLA 255
           R F     +  F I + I   + GA   H  W    W F + L   P+G   L+   W+ 
Sbjct: 181 RGFIIAFMSASFGIASVIGPFIGGAFTSHVTW---RWCFWINL---PVGAVALVIFTWVY 234

Query: 256 HKNAKDRLKSEFRTYRDMG------WFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLA 309
           +   K ++       +++        F  ++   L+KLD I  +L+ A   CIL+ FT  
Sbjct: 235 NPTGKKQVLLTIHDLKELSEKVKKVRFKDLLKHLLFKLDIIEFMLISAGIVCILLAFTF- 293

Query: 310 GGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKV-----------PLTPWALIKDRG 358
           GG + KW +  II+  VIG C+ +   +   + F  +           PL  W  ++ RG
Sbjct: 294 GGNRFKWGSYSIILLFVIGGCLVIVALVYDFVIFPNLQIVKANYIQYQPLISWKNLRIRG 353

Query: 359 IFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLGLVII 418
           IF A +  F     +  Q  Y      +  N S   A+         +V+T  + G +  
Sbjct: 354 IFTASMTTFFFCIGYMSQTVYYVQFFQLIYNSSPWKASIHLIAVMIPTVLTAVVCGFLNG 413

Query: 419 KVRRTKPFIIFGVSCWFIAFGLL 441
           K    KP  + G+    I  GLL
Sbjct: 414 KFGYVKPITVAGMCLAVIGAGLL 436

>SAKL0A00726g Chr1 (82164..83960) [1797 bp, 598 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 598

 Score = 57.0 bits (136), Expect = 9e-08,   Method: Compositional matrix adjust.
 Identities = 85/379 (22%), Positives = 156/379 (41%), Gaps = 50/379 (13%)

Query: 30  NSSQLDSNQPDSNQPDL--KNYDLYHKDAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYA 87
           NSS+    Q +S+  ++  +N  +  +D  V    +YA   S       L  +LFL A  
Sbjct: 7   NSSKELCTQAESSTSEVVEQNKKVVSQDQVVKGFALYACLGS-------LTLALFLSA-- 57

Query: 88  YGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGRMTILIIGL 147
             LD  +  T     +  ++++S                 + + RA+ I G  + +++ +
Sbjct: 58  --LDILIVSTIIETVSRDFNEYSKSGWLVTGYSLPTALLSLVWGRAASIIGFKSSMLLSI 115

Query: 148 VFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWRLFASFVPALP 207
           + + VG+++ + A ++     G     +G +G+     LI     N   R  A  V +  
Sbjct: 116 IIFEVGSLVSALANSMNMLIGGRVISGVGGSGLQTLCFLIISTLVNERSRGMAISVLSCS 175

Query: 208 FIINTWISGNVSGAVGQH--WKW------GIGMWAFIV-PLSAIPLGCCLLH-----MRW 253
           F + + +   + GA   H  W+W       IG  AF+V  LS  P G   +      +R 
Sbjct: 176 FAVASIVGPFLGGAFTTHVTWRWCFYINLPIGGLAFLVFVLSYNPNGGNSIKNFTKAVRS 235

Query: 254 LAHKNAKDRLKSE--FRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGG 311
           ++H +    LK++  + T+  +          ++K DF+G  L  A F C+++     GG
Sbjct: 236 ISHVDFGGLLKAKSYYNTFEKL----------VFKFDFVGFALCSAGF-CLILLGLTFGG 284

Query: 312 LQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKV----------PLTPWALIKDRGIFF 361
            +  W +  II   VIG  +++  FL     F++           PL  W +I   G+  
Sbjct: 285 NEYSWGSGTIIAYLVIGIVLSIAFFLYDFFVFNRFKAPRENMVYRPLVSWNVISKPGVIT 344

Query: 362 ALVIAFHINFIWYMQGDYM 380
           A  + F I  ++  Q  Y+
Sbjct: 345 ATAVNFTICLMYNAQVIYI 363

>KLTH0C10120g Chr3 (839780..841735) [1956 bp, 651 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 651

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 88/396 (22%), Positives = 158/396 (39%), Gaps = 42/396 (10%)

Query: 128 ICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELI 187
           + + R + + G  T L++ ++ + +G++I + + ++     G      G +G+   + ++
Sbjct: 96  LLWGRMASLLGLKTCLMLSVLIFEIGSLIAAVSNSMGMLIAGRVVAGAGGSGIQSLVYIV 155

Query: 188 AMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGCC 247
                +   R     V    F+ +      + GA+ +H  W    W F + L   P+G  
Sbjct: 156 GTSLVSERSRGMVIMVLTFAFVGSNAGGPILGGALNEHASW---RWCFFINL---PIGGA 209

Query: 248 LLHMRWLAHKNAKDRLKSEF-------RTYR-----DMGWFAYIVDVFLWKLDFIGLLLL 295
              M +L +  +   L S         R YR        ++A+ +D+ +++ D IG  L 
Sbjct: 210 AAFMLFLCYNPSGKPLLSTLTSKLEAARDYRYSNVCTRKFWAHALDLGVFRFDIIGFALS 269

Query: 296 CATFGCILVPFTLAGGLQDKWKTAHIIVPEVIG------WCV----ALPIFLLWEIKFSK 345
            A F  +L+     GG +  W +   I    +G      +C+     LP+ L   + +S 
Sbjct: 270 SAGFVLLLL-GLTFGGRKYSWSSGTTIAYLTVGPVLIVVFCLYDFLVLPV-LARSLAYSS 327

Query: 346 --VPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYS 403
              PL PW +I   G+F     +F   F + MQ  Y+     V  NES  +A+      S
Sbjct: 328 EVTPLVPWPVISKPGVFATSFASFFNFFAYNMQIIYLVQFYQVVHNESPTNASTHMWALS 387

Query: 404 FVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGF 463
             +++   +LG +  K    KP  + G +C  I  GLL   +             C+L  
Sbjct: 388 IPALVVIIVLGRINKKFGILKPVAVIGAACGTIGAGLLTLLKGSTTSGQSIGY--CILA- 444

Query: 464 GAGFFTYTTQASIQASV-------KYHSKMAVITAL 492
           GAGF        + A +       K++ K   IT L
Sbjct: 445 GAGFSAVMQSTLLSAQIQVDKTDPKFNQKFIEITTL 480

>TBLA0D03280 Chr4 complement(815937..817679) [1743 bp, 580 aa] {ON} 
          Length = 580

 Score = 52.4 bits (124), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 52/87 (59%), Gaps = 3/87 (3%)

Query: 281 DVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWE 340
           +++   +D+IG +L    FG +++ F         W++A+IIV  V+ +C AL IF+++E
Sbjct: 289 NIYNLSMDWIGAIL--GIFGLLILNFVFNQAPIVGWQSAYIIVLLVLSFC-ALVIFVVYE 345

Query: 341 IKFSKVPLTPWALIKDRGIFFALVIAF 367
           +K++K PL P A+  +RG+   L   F
Sbjct: 346 VKYAKTPLIPKAISSNRGMLMILFALF 372

>KLTH0C10142g Chr3 (842371..844092) [1722 bp, 573 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 573

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 106/532 (19%), Positives = 199/532 (37%), Gaps = 62/532 (11%)

Query: 128 ICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELI 187
           + + R + I G  T L   +V + +G++I + + ++     G      G +G+   + ++
Sbjct: 60  LLWGRLASILGLKTSLTFSIVIFEIGSLIVAVSNSMGMIIGGRVVAGCGGSGIQSLVFVV 119

Query: 188 AMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGCC 247
                    R     V  L F +   +   + GA  ++  W    W F + L   P+G  
Sbjct: 120 GTSLVEERNRGMVITVLGLAFAVAFAVGPVIGGAFTENVSW---RWCFYINL---PIGGV 173

Query: 248 LLHMRWLAHKNAKDRLKS-------EFRTYRDMGWF-------AYIVDVFLWKLDFIGLL 293
            L M   ++   +  ++        + +TYR   W        AY  +  ++ LDFIG  
Sbjct: 174 ALTMLTFSYNTTEKSVQETLTYNCRQLQTYRYGQWVTASFWRRAY--NFLMFDLDFIGFA 231

Query: 294 LLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIG------WCVALPIFL----LWEIKF 343
           L    F   ++  T  GG    W +  II    +G      W V   + L     W  K 
Sbjct: 232 LSSTGFVLFMLGLTF-GGNTYAWNSGTIISFLTVGAILVLFWLVFDFVLLYKWAAWCRKR 290

Query: 344 SKVPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYS 403
              PL   +L    GIF + +      F + MQ  Y+  +  +  N    +A+     + 
Sbjct: 291 EATPLLRRSLCFRPGIFTSSIANLFTCFGFNMQTVYIVQLYQLVFNSGPTAASMHLWAFL 350

Query: 404 FVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGF 463
             ++++  ++G         KP I+FG +C  +  GL+   R             C+L  
Sbjct: 351 IATMVSVIIIGKAAAIFGLIKPAIVFGATCGLVGSGLMTLVRNTSTTGNVIGY--CILP- 407

Query: 464 GAGFFTYTTQASIQASVK-------YHSKMAVITALYLAMYNIXXXXXXXXXXXIWTNVL 516
           GA F +      + A V+       + +     TAL   + ++           I+TN +
Sbjct: 408 GAAFGSIMQGTLLSAQVQVDHDDENFQTMFIEATALNTFVKSLGFSFGGVVATMIFTNSV 467

Query: 517 PKQISKRIANETLAAEAYGSPFTFILTY---TWDTPERQAVVVSYRYTQKILCIVGLCFC 573
             Q+       T A  A  S    ++ Y    +D P     ++  +  + ++     C+ 
Sbjct: 468 KNQL-----RSTSAGVAAFSSVEALIAYRGQNYDGPGSTLSLMFVKAIKDVMYAALGCYG 522

Query: 574 STLLGAALFLRNHKL------ESVVALSELENTPNSDEQ----GSFADNDKN 615
              + A+LF  N +L      + V A ++ ++    D+      S ++ND+N
Sbjct: 523 IVFI-ASLFTSNRRLRLPSKNDGVEATAQEKSISGGDKSQLAPQSTSENDEN 573

>TDEL0F03990 Chr6 (740471..742366) [1896 bp, 631 aa] {ON} Anc_8.272
           YDR119W
          Length = 631

 Score = 50.8 bits (120), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 64/280 (22%), Positives = 111/280 (39%), Gaps = 33/280 (11%)

Query: 13  INETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPI 72
           I   +LQ+ +T D   F + ++   +  +N       D +  D         AE+ S   
Sbjct: 52  IKPEILQDPST-DLPGFVAEEIGQQEEVANGYG-SITDPHDGDNKSERPVSTAEEISGAR 109

Query: 73  YRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYAR 132
            RV++  S++L  +   +D ++  T  A   S ++Q S +S             Q  Y +
Sbjct: 110 LRVIML-SMYLGIFLAAIDNTIVSTTSAHVASEFNQLSKVSWIATSYLLSSATFQPLYGK 168

Query: 133 ASDIFGRMTILIIGLVFYAVGTIIESQATN-----VTRFAVGSCFYQLGYTGVILSLELI 187
            SDIFGR  +L+   V + +G ++   + +     + RF  G     +G  G+     + 
Sbjct: 169 VSDIFGRKCLLVFTNVAFLIGCLMCGLSKSFWWLVIARFVAG-----VGGGGLTSMSSIT 223

Query: 188 AMDFSNLNWR--------LFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFI--V 237
             D   L  R        +F     A   I+  W S N  G     W+      AF+  V
Sbjct: 224 ITDLVPLRERAMYQGICNVFYGLGTACGGIVGGWFSDNKGG-----WR-----MAFLIQV 273

Query: 238 PLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFA 277
           PLSAI L   +LH++  + +  +++  S  R    + W  
Sbjct: 274 PLSAISLLVIILHLKLPSKRATRNQDNSIKRKLLAIDWLG 313

>KLTH0D16962g Chr4 (1399514..1401229) [1716 bp, 571 aa] {ON} similar
           to uniprot|P33335 Saccharomyces cerevisiae YPR198W SGE1
           Member of drug-resistance protein family multicopy
           suppressor of gal11 null mutation
          Length = 571

 Score = 49.7 bits (117), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 72/342 (21%), Positives = 134/342 (39%), Gaps = 37/342 (10%)

Query: 130 YARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAM 189
           + R + + G    L+  +V +  G+++   A ++            G +G+   +  +  
Sbjct: 62  WGRIASLVGLKCSLMASIVIFEAGSLMAGAANSMGMLIGARVISGFGGSGIESLVYGVGT 121

Query: 190 DFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLG-CCL 248
                  R     V  + +++       V G + +H  W    W F V L   P+G   L
Sbjct: 122 SIVEEKHRARVITVLGIAYMLAEGAGPFVGGGLAEHVSW---RWCFYVNL---PIGGVAL 175

Query: 249 LHMRWLAHKNAKDRLKSEFRTYRDMGWFAY-----------IVDVFLWKLDFIGLLLLCA 297
             + W  +   +   ++  R +     F Y              + +++LD  GL L   
Sbjct: 176 AALGWGYNPAGRAPGRALARFWVRARAFPYGTLLQAQFWRRAAALMVFRLDIPGLALSSG 235

Query: 298 TFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEI-----------KFSKV 346
            F  +++  T  GG Q  W++A I+   V G  + L +F+L++             +  +
Sbjct: 236 GFALVMLALTF-GGNQYAWRSATIVCMFVFGAAL-LALFMLYDFVVLPRVGARIAGYEPL 293

Query: 347 PLTPWALIKDRGIFFALVIAFHINFIWYMQGDYM--YTVLIVSVNESIKSATR-ITSLYS 403
           PL PW L  +  +  + +  F   F + +Q  Y+  Y  L+V+   ++ S      SL +
Sbjct: 294 PLVPWRLAANVPVLTSSLCGFFNCFAFELQSIYLVQYYQLVVNKGPTLASVHLWQMSLPA 353

Query: 404 FVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLLVHYR 445
            VSVI      +V  +    KP ++ GV   F+  GLL   R
Sbjct: 354 LVSVIASA---VVNERFGVVKPLVLAGVVMGFVGSGLLTLVR 392

>KLLA0D19941g Chr4 complement(1698889..1700724) [1836 bp, 611 aa]
           {ON} similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 611

 Score = 47.4 bits (111), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 98/469 (20%), Positives = 186/469 (39%), Gaps = 72/469 (15%)

Query: 4   SSDSKFDGKINET-VLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIE 62
           S ++  DG +++  ++Q + T D+     + +D+N PD N  D  N  L      ++ + 
Sbjct: 10  SLNNSMDGPMSKNAIMQVEVTADN-----ASIDANTPDHN--DNSNVRL------MSGLR 56

Query: 63  VYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXX 122
           +Y           +   +L L  + + LD  +  T     ++S   +S            
Sbjct: 57  LY-----------VCVAALVLATFIFALDVFIVNTIIDSVSASLGGYSKSGWLIAGYSLP 105

Query: 123 XXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGV-I 181
                + + R + + G    + + +  + VG+I+ + AT++    VG     +G +G+  
Sbjct: 106 NSLFSLIWGRTASLLGFQASMTLSIFIFEVGSIVSASATSMDNLIVGRVIAGVGGSGLQT 165

Query: 182 LSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSA 241
           LSL + +      N  +  S V +  F   + I   V GA   H  W    W F + L  
Sbjct: 166 LSLVIGSSIVEEKNRAMIVSIVMS-AFAAASLIGPFVGGAFTTHVIW---RWCFWINL-- 219

Query: 242 IPLGCCLLHMRWLAHK----NAKDRLKSEFR--------------TYRDMGWFAYIVDVF 283
            P+G     + +  +     +A  R  S F+              TYR MG         
Sbjct: 220 -PIGAVTALLFYFTYNPKRLSAASRFTSCFKSVKALSFEKLASWETYRCMG------KNL 272

Query: 284 LWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKF 343
           L++ D +G    CA   C+L+     GG  D WK+A +I   ++G+ +++   +     F
Sbjct: 273 LFRFDIVGFATGCAGV-CLLLLGLTLGGEDDSWKSAIVICFLIVGFLLSVLSVVYDFYIF 331

Query: 344 SKV----------PLTPWALIKDRGIFFALVI--AFHINFIWYMQGDYMYTVLIVSVNES 391
            K+          P+    L+ +R I    ++  A  I F  YM     +  L++  + +
Sbjct: 332 DKINPEPSNLSFRPMLVKGLLNNRFILLPNLVTCASAIAFSGYMLYSVQFFQLVMG-SSA 390

Query: 392 IKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGL 440
             +   +  L    S+++  + G ++ K  + KP +I  VS   I  G+
Sbjct: 391 WNAGLHLIPLV-IASIVSAIICGGIMKKTGQVKPLMISTVSILLIGGGV 438

>Skud_7.560 Chr7 (917668..919596) [1929 bp, 642 aa] {ON} YGR224W
           (REAL)
          Length = 642

 Score = 45.8 bits (107), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 50/171 (29%), Positives = 76/171 (44%), Gaps = 15/171 (8%)

Query: 282 VFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVAL-------- 333
           VF++  D I  +L  A F  IL+ FT  GG +  W +A IIV  VIG  + +        
Sbjct: 303 VFMY--DIIEFVLCTAGFTSILLAFTF-GGNRYAWDSAEIIVLFVIGVILVILAAVYDFF 359

Query: 334 --PIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNES 391
             P F + +      PL  W  IK  GIF   +  F +   +  Q  Y+     +  N+S
Sbjct: 360 VFPKFDVVKTAPRYQPLMSWRNIKRPGIFTVNIALFLLCTGYISQFTYIVQYFQLIYNDS 419

Query: 392 I-KSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLL 441
             K+A  + +     +VIT  + G++  K R+ KP I+       +  GLL
Sbjct: 420 AWKAAVHLVACI-IPTVITSVVCGVITDKTRQIKPIIVISSILGVVGAGLL 469

>NCAS0C03460 Chr3 complement(690089..691981) [1893 bp, 630 aa] {ON} 
          Length = 630

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 91/402 (22%), Positives = 152/402 (37%), Gaps = 49/402 (12%)

Query: 128 ICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELI 187
           + + R + I G  + ++  ++ + +G++I   A ++     G     +G +G+     +I
Sbjct: 131 LLWGRIASIIGFKSCMLAAIIIFEIGSLISGVANSMNMLIGGRVIAGVGGSGIQSLAFVI 190

Query: 188 AMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGCC 247
             +  +   R       +  F + + I   + GA   H  W    W F + L    +   
Sbjct: 191 GSNLVDERRRGLIIACMSSAFAVASVIGPFLGGAFTTHATW---RWCFYINLPVGGVAFA 247

Query: 248 LLHMRWLAHKNAKD------RLKSEFRTYRDM-------GW--FAYIVDVFLWKLDFIGL 292
           L  + +   + + +       LK    T R +        W  +  IV   +++ D I  
Sbjct: 248 LFVVFYNPQRKSLEGISILSSLKEFCNTLRQITVIKNLKNWPTWKSIVYSLVFRFDIIEF 307

Query: 293 LLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEI----KFSKV-- 346
           +   A F  +L+ FT  GG Q  W +A IIV  VIG  + L + LL++     +F  V  
Sbjct: 308 IFCSAGFVLVLLAFTF-GGNQYNWSSASIIVMFVIG-IILLIVSLLYDFVIFPRFKAVKE 365

Query: 347 -----PLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVL-IVSVNESIKSATRI-- 398
                PL  W++    GIF A    F     +  Q  Y+     +V  N + K+A  +  
Sbjct: 366 NSLYQPLIKWSIFSHPGIFTANAALFFECTAYICQTVYIIQFFQLVRGNTAWKAAVHLIA 425

Query: 399 ----TSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLLVHY-RXXXXXXXX 453
               T + +F S I  +  GLV       K     GV    +  GLL             
Sbjct: 426 TVVPTVITTFSSGIANSKFGLV-------KHVTFIGVVTSLVGAGLLTLLDNNSSSAKHI 478

Query: 454 XXXXLCLLGFGAGFFTYTTQASIQ---ASVKYHSKMAVITAL 492
               L  +GFGA   +    A IQ    +V Y S    +T L
Sbjct: 479 GLLILPGIGFGATMQSTMIGAQIQLDKKAVTYRSDFIAVTTL 520

>SAKL0A08228g Chr1 complement(732518..734227) [1710 bp, 569 aa] {ON}
           similar to uniprot|P33335 Saccharomyces cerevisiae
           YPR198W SGE1 Member of drug-resistance protein family
           multicopy suppressor of gal11 null mutation
          Length = 569

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 70/340 (20%), Positives = 146/340 (42%), Gaps = 37/340 (10%)

Query: 128 ICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELI 187
           + + R + IFG  T L++ ++ + +G+++ + + ++     G      G +G+   +  I
Sbjct: 73  LLWGRFAVIFGSKTTLMVSIIIFEIGSLVIAVSNSMDMIIGGRVIAGCGASGIQTLVFAI 132

Query: 188 AMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGCC 247
           A    + + R     + +L + + + +   + GA+ ++  W    W F + L   P+G  
Sbjct: 133 ATSLVDEHTRGTIVTLLSLSYAVASALGPYIGGALTEYVTW---RWCFYINL---PIGGL 186

Query: 248 LLHMRWLAHKNAKDRL--------KS----EFRTYRDMGWFAYIVDVFLWKLDFIGLLLL 295
            L + +L++  A+ ++        KS    EF+    + ++  ++   +++LDF G    
Sbjct: 187 ALGVFYLSYNPAQRKVLKCFPHFFKSVTSLEFKQLLSLKFYRMLLKFLVFELDFFG-FTF 245

Query: 296 CATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKF-----------S 344
           C+    +L+     GG    W++  II   V+G    + IF ++E              +
Sbjct: 246 CSVGFVLLLLGLTFGGNLHPWQSGTIIAYLVVG-SFFIVIFFVYEFVIFDMFWQSQRNGN 304

Query: 345 KVPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNES-IKSATRITSLY- 402
             PL  W      GIF A    F     + +Q  ++  +  +   +S  ++A+ + SL  
Sbjct: 305 ARPLISWTTFSKSGIFTATATMFFGCCAYNLQSIHVVQLFQLVFGQSPSRAASHLWSLLI 364

Query: 403 -SFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLL 441
            +FVS+I   + G +  +    KP  +F      I  GLL
Sbjct: 365 PAFVSII---ISGKITSRYGYVKPITLFAGISGVIGAGLL 401

>ZYRO0A00330g Chr1 (19597..21327) [1731 bp, 576 aa] {ON} similar to
           uniprot|P38358 Saccharomyces cerevisiae YBR293W VBA2
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 45.1 bits (105), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 80/437 (18%), Positives = 175/437 (40%), Gaps = 39/437 (8%)

Query: 10  DGKINETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYS 69
           DG+I + +L    +  + Q N+ +++ +    +  D+  Y     D    +++      +
Sbjct: 2   DGEIAQPLLTRTVSSSNKQTNADKINQHYLSISHSDVGEYREEPNDDEQGDLD----DET 57

Query: 70  SPIYRV----MLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXX 125
           +P+ R+    ++  +L+   +  G D +V  +      + ++   L S            
Sbjct: 58  TPLSRIPHLWLIEAALYTNVFLSGFDSTVTASTYQTIGNEFNHMDLSSWITASYLITSTS 117

Query: 126 GQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLE 185
            Q  Y   SD+ GR   L    + +++G +    + N+   +    F  +G  G+I    
Sbjct: 118 FQPLYGSFSDVLGRRKCLFFASMIFSIGCLGCGISINILWLSFMRAFTGIGGGGLITLST 177

Query: 186 LIAMDFSNLNWR----LFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSA 241
           ++  D    + R     F + +  L  I      G ++ ++G  W+W    +   VP+S 
Sbjct: 178 IVNSDMIPTSKRGIFQAFQNLLLGLGAICGASFGGVITSSIG--WRW---CFLLQVPIS- 231

Query: 242 IPLGCCLLHMRWLAHKNAKDRLKS-EFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFG 300
             L   L+   ++ +++  +R KS E    ++M          L  +DF G  L+     
Sbjct: 232 --LAGALIGHLYVRNQDEYERRKSKESSQTKEM----------LKHIDFSGAFLIIIGLT 279

Query: 301 CILVPFTLAGGLQDKWKT--AHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRG 358
             LV  +L     +   T  +  +   ++   + L +F+L E + S   + P  L++   
Sbjct: 280 LQLVYLSLGSAADESGNTWSSPGLSAVLVASFIVLVLFVLTEERTSARAIIPSKLVRSLF 339

Query: 359 IFFALVIAFHINFIWYMQGDYMYTVLI---VSVNESIKSATRITSLYSFVSVITGTLLGL 415
            F  L I+  + F  Y    Y++T+ +   V + +S   A    ++ S  + + G + G+
Sbjct: 340 SFLVLTISVLVGFASYA---YLFTLPLFFQVILGDSTAKAGLRLAIPSVFTPVGGLIAGI 396

Query: 416 VIIKVRRTKPFIIFGVS 432
            + K    +  +  G++
Sbjct: 397 CMSKFNCLQTLLYVGIA 413

>Smik_13.272 Chr13 complement(427283..428968) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 28/120 (23%), Positives = 53/120 (44%)

Query: 61  IEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXX 120
           +E    +Y+  + +  + FSL+L ++   LDG++      +    +S+ S          
Sbjct: 22  LEQKFHEYNLALPKFPILFSLWLGSFLSSLDGTIVANIMNRVAEEFSESSRKQWIATSFL 81

Query: 121 XXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGV 180
                 Q  Y + SDI GR + L+    F+ +G ++   A NVT F++      +G  G+
Sbjct: 82  LTNTAFQPLYGKLSDITGRKSALLTAHFFFGIGCLLTCFARNVTEFSIARAICGIGAGGL 141

>SAKL0H16808g Chr8 complement(1477137..1479110) [1974 bp, 657 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 657

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 71/318 (22%), Positives = 114/318 (35%), Gaps = 36/318 (11%)

Query: 55  DAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSX 114
           D   ++IE       SP    ++  S++L  +   LD ++  T  A   S +++   +S 
Sbjct: 109 DLETSSIEAKNNTGLSPARIKIIMGSMYLGIFLASLDNTIVSTLLAHIASEFNEMPHISW 168

Query: 115 XXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQ 174
                       Q  Y + SDIFGR  +LI   V +A+G +I   +  +     G     
Sbjct: 169 IATAYLLSSATFQPLYGKISDIFGRKPLLIFSNVMFALGCLICGLSPGLWCLVAGRFIAG 228

Query: 175 LGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMW- 233
           +G  G+     +   D   L  R     +    F + T   G V G   +H     G W 
Sbjct: 229 IGGGGLTSMSSITTSDIVPLRNRALYQGICNFFFGLGTACGGLVGGWFSEHG----GGWR 284

Query: 234 -AFIVPLSAIPLGCCLLHMRWLAHKNAK------DRLKSEFRTYRDMGWFAYIVDVFLWK 286
            AF++ +    + C L+       K  K      D         R + WF  +  V    
Sbjct: 285 VAFLIQIPLCAISCSLIVAYLELPKGCKGSGIQSDEDNQISEKLRRIDWFGALSLVVFLL 344

Query: 287 LDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPI----FLLWEIK 342
                L +L ++ G   +PF   G                   CVA+ +    F+  E  
Sbjct: 345 -----LFMLASSLGGKELPFQSNG---------------FYALCVAIVVGGATFVYVETY 384

Query: 343 FSKVPLTPWALIKDRGIF 360
            SK P+ P A +K+R I 
Sbjct: 385 VSKDPILPVAFLKNRTIL 402

>KLTH0B00132g Chr2 (4664..6370) [1707 bp, 568 aa] {ON} similar to
           uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 568

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 67/351 (19%), Positives = 138/351 (39%), Gaps = 62/351 (17%)

Query: 127 QICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLEL 186
            + + R S + G    +I  ++ +  G++I + A ++     G     +G +G+     +
Sbjct: 96  SLLWGRLSAVLGPRISVISCIILFETGSLISALAKSMNMLISGRVIAGVGGSGLQTLSLV 155

Query: 187 IAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGC 246
           I     N   R     +    F + + +   + GA   H  W    W F + L   P+G 
Sbjct: 156 IGCQLVNEKSRPLVLSLLNCTFAVASIVGPFLGGAFTTHVTW---RWCFYINL---PIGG 209

Query: 247 CLLHM-RWLAHKNAKDRLKSEFRTYRDMGWF-------AYIVDVFLWKLDFIGLLLLCAT 298
             + +  +  +    D L+   +T++ +  +         ++D  L+  D +  +L  A 
Sbjct: 210 LAIAIFIFFYNPEGADLLEKGSQTFKKLLSYRRANLSLKQLLDQLLFGFDIVSFVLFTAG 269

Query: 299 FGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIK-FSKV-------PLTP 350
           +   L+  T  GG    WK+  I++  +I   + + + L+++ + F  +       PL  
Sbjct: 270 WLLFLLALTF-GGQTHPWKSG-IVISFIIVGVLLIALSLIYDFRLFDHIKTMDTFRPLLS 327

Query: 351 WALIKDRGIF------FALVIAFHINFIWYMQ-------------GDYMYTVLIVSVNES 391
           W L+  R I       F   IA+++  I+ +Q             G ++  +L+ +V  S
Sbjct: 328 WHLMSQRAILNANFTGFFSTIAYNVQMIYSVQFFQLVYGFSAWKAGLHLIPILVSTVVFS 387

Query: 392 IKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLLV 442
           I S                   G++I K    KP ++FG +   +  GL++
Sbjct: 388 IAS-------------------GVIIKKTGHIKPLLVFGSAMGVLGSGLMI 419

>ZYRO0G21868g Chr7 complement(1799212..1801074) [1863 bp, 620 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 620

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/180 (20%), Positives = 74/180 (41%), Gaps = 15/180 (8%)

Query: 18  LQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPIYRVML 77
           L  Q++ +++ + S +  S   + N+ D ++ ++  +D               P     +
Sbjct: 60  LTVQSSSENDSYKSGREHSGALEGNKEDEEDLEIDLRD---------------PKTFKWV 104

Query: 78  FFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIF 137
             SL+  +    LDG++  T      S + Q S+++             Q  Y + SDI 
Sbjct: 105 LTSLWTNSALSALDGTIVSTTVNDVASRFQQASMVTWVATAYLLTTTAAQPLYGKISDII 164

Query: 138 GRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWR 197
           GR   L+ G + +AVG  +   + ++ + A+      +G +G      +I  D + L+ R
Sbjct: 165 GRRKCLLFGEIVFAVGVGLCIFSKSIPQLAIARGICGIGGSGTGAMTNIILSDMAPLSER 224

>Ecym_4298 Chr4 complement(636605..638641) [2037 bp, 678 aa] {ON}
           similar to Ashbya gossypii AGR076C
          Length = 678

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 56/281 (19%), Positives = 111/281 (39%), Gaps = 19/281 (6%)

Query: 12  KINETVLQEQTTEDSNQFNSSQLDSNQ---PDSNQPDLKNYDLYHKDAGVNNIEVYAEQY 68
           ++ E  L    ++ +   NSS   ++    PDSN    KN +++ + + V    +   Q 
Sbjct: 90  EVQELSLGSAGSQSTTILNSSYGSTSTTVTPDSN----KNGNVFIRSSSVEVGNIGDSQN 145

Query: 69  SSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQI 128
            S I    +  SL +  +   LDG++  T      S +     +S             Q 
Sbjct: 146 ISQIRFAAIVSSLVVGVFLGSLDGTILSTLLDYIASEFEALPYISWIAASYLLSACIFQP 205

Query: 129 CYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIA 188
            Y + SDIFGR  IL+   + + +G ++   A  V     G     +G  G+     +I 
Sbjct: 206 LYGKLSDIFGRKAILLFSNLMFGLGCLVCGTAPTVWWLLAGRFVAGIGGGGLTSMPSIII 265

Query: 189 MDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGCCL 248
            D   L  R     +  + +++   + G++ G + ++  W +    F++ + A  +  C 
Sbjct: 266 SDIVPLRSRASYQDLFNICYVLGITLGGSMGGWLAEYGGWRL---VFLLQVVAALISGCF 322

Query: 249 LH----MRWLAHKNA-----KDRLKSEFRTYRDMGWFAYIV 280
           +     +  + H N      K+ LK++      +G F  ++
Sbjct: 323 IQAFLILPKVHHGNGIALANKESLKTKLYMMDWLGTFCLVI 363

>SAKL0B12716g Chr2 (1101141..1103039) [1899 bp, 632 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 632

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 75/337 (22%), Positives = 140/337 (41%), Gaps = 35/337 (10%)

Query: 130 YARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAM 189
           + R + IFG    L++ ++ +  G++I + + ++     G     +G +G+     +IA 
Sbjct: 96  WGRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVIAS 155

Query: 190 DFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGCCLL 249
             +    R  A  V +  + +       + GA   H  W    W F + L    L   +L
Sbjct: 156 TLTTERSRGVAISVLSCAYAVAAVAGPFMGGAFTTHVTW---RWCFYINLPIGSLAFAVL 212

Query: 250 HMRWLAHKNAKDR-----LKS--EFRTYRDMGWFAYIVDVFLWKLDFI-----GLLLLCA 297
            + +  H+    R     LKS  EF T R      +  D++L   D +      +  +  
Sbjct: 213 VLTYKPHEGNSARSIVSVLKSCCEFGTAR-----LFSKDLYLKMFDELVFGFDFIGFIFC 267

Query: 298 TFGCILVPFTLA-GGLQDKWKTAHIIVPEVIGWCVALPIFLLWEI----KFSKV------ 346
           + G IL    L  GG +  W +  IIV  ++G  +++  FLL++     KF +V      
Sbjct: 268 SVGFILFLLGLTFGGDKYAWSSGAIIVYFIVGVTISVA-FLLYDFMIFPKFGRVRKNASF 326

Query: 347 -PLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVL-IVSVNESIKSATRITSLYSF 404
            PL PW+++   GI  A+   F +   +  Q  Y+     +V  +++ +++  + +L   
Sbjct: 327 RPLVPWSVVSRPGIATAVAANFLMCVAYSAQVVYIIQFFQLVRGSDAWRASIHVVAL-EI 385

Query: 405 VSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLL 441
             +IT  + G +       KP I  G+    +  GLL
Sbjct: 386 PDIITVAISGAISRMTGHVKPIIFVGIIAGLVGAGLL 422

>YKR105C Chr11 complement(658716..660464) [1749 bp, 582 aa] {ON}
           VBA5Putative transporter of the Major Facilitator
           Superfamily (MFS); proposed role as a basic amino acid
           permease based on phylogeny
          Length = 582

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 84/397 (21%), Positives = 156/397 (39%), Gaps = 36/397 (9%)

Query: 127 QICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLEL 186
            + + R + I G    LI+ ++ +  G++I + A+++     G     +G +G+     +
Sbjct: 89  SLIWGRFASIIGFQHSLILAILIFEAGSLIAALASSMNMLIFGRVVAGVGGSGLQTLCFV 148

Query: 187 IAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGC 246
           I         R     + +  F +   +   + GA   H  W    W F + L   P+G 
Sbjct: 149 IGCTMVGERSRPLVISILSCAFAVAAIVGPIIGGAFTTHVTW---RWCFYINL---PIGG 202

Query: 247 CLLHMRWLAHK--------NAKDRLKS----EFRTYRDMGWFAYIVDVFLWKLDFIGLLL 294
             + M  L +K          KD + +     F  +R    F  +++  ++K DF G  L
Sbjct: 203 LAIIMFLLTYKAENKGILQQIKDAIGTISSFTFSKFRHQVNFKRLMNGIIFKFDFFGFAL 262

Query: 295 LCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIF-LLWEI----KFSKVP-- 347
             A     L+  T  GG +  W +  +I   V+G  V L IF L+++     KF+  P  
Sbjct: 263 CSAGLVLFLLGLTF-GGNKYSWNSGQVITYLVLG--VLLFIFSLVYDFFLFDKFNPEPDN 319

Query: 348 LTPWALIKDRGIFF-ALVIAFHINFIWYM--QGDYMYTVL---IVSVNESIKSATRITSL 401
           ++   L+  R +   A++I   + F+      G  +Y+V    ++  + + K+   +  +
Sbjct: 320 ISYRPLLLRRLVAKPAIIIVNMVTFLLCTGYNGQMIYSVQFFQLIFASSAWKAGLHLIPI 379

Query: 402 YSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLL 461
               +VI     G++  K+   KP +IFG     I  GL+                L L 
Sbjct: 380 V-ITNVIAAIASGVITKKLGLVKPLLIFGGVLGVIGAGLMT-LMTNTSTKSTQIGVLLLP 437

Query: 462 GFGAGFFTYTTQASIQASVKYHSKMAVITALYLAMYN 498
           GF  GF    +  S Q  +      A +  + +  +N
Sbjct: 438 GFSLGFALQASLMSAQLQITKDRPEAAMDFIEVTAFN 474

>Smik_16.81 Chr16 complement(152022..153515,153516..153899) [1878
           bp, 625 aa] {ON} YGR224W (REAL)
          Length = 625

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 54/203 (26%), Positives = 92/203 (45%), Gaps = 21/203 (10%)

Query: 251 MRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAG 310
           +R +AH + K +  ++  +++ +    +I  VF++  D I L+L  A F  IL+ FT  G
Sbjct: 261 VRKVAHHSLKVKNFNKSNSWKKL----FIELVFMY--DVIELVLCSAGFTSILLAFTF-G 313

Query: 311 GLQDKWKTAH----------IIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIF 360
           G +  W +            +++  +I      P F L +   S  PL  W  IK  G+F
Sbjct: 314 GNRYAWNSTSIIILFIVGIILVISAIIYDFFVFPKFNLVKATPSYQPLMLWRNIKKPGVF 373

Query: 361 FALVIAFHINFIWYMQGDYMYTVLIVSVNESI-KSATR-ITSLYSFVSVITGTLLGLVII 418
              +  F +   +  Q  Y+     +  N+S  K+A   IT + S  +VIT  + G++  
Sbjct: 374 TVNIALFLLCAGYISQFTYIVQYFQLIYNDSAWKAAVHLITCVIS--TVITAIVCGVITD 431

Query: 419 KVRRTKPFIIFGVSCWFIAFGLL 441
           K R+ KP I+       +  GLL
Sbjct: 432 KTRQIKPIIVISSILGVVGAGLL 454

>Suva_13.467 Chr13 complement(807375..809006) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score = 43.1 bits (100), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 43/146 (29%), Positives = 68/146 (46%), Gaps = 8/146 (5%)

Query: 281 DVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWE 340
           +V  + +D+ G +L  A  G IL  F         W TA+II   +I     L  F ++E
Sbjct: 260 NVHGFSMDWTGSVL--AVIGLILFNFVWNQAPTAGWGTAYIIALLIIS-VFFLVAFFVYE 316

Query: 341 IKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITS 400
           +K++KVPL P A+ K+R +   L+  F     W   G + +  +   +N    S      
Sbjct: 317 VKYAKVPLLPHAVTKNRHMIMILLAVF---LGWGSFGIWTFYYMSFQLNLRHYSPVWTGG 373

Query: 401 LYSFVSVITGTLLG-LVIIKVRRTKP 425
            Y FV VI GT+   +V + ++R  P
Sbjct: 374 TY-FVFVIFGTIAAFMVALSIKRVGP 398

>Suva_13.265 Chr13 complement(424929..426614) [1686 bp, 561 aa] {ON}
           YMR088C (REAL)
          Length = 561

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 29/127 (22%), Positives = 55/127 (43%)

Query: 54  KDAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLS 113
           ++A V  +E    +Y+  + +  + FSL+L ++   LD ++      +    +S+ S   
Sbjct: 15  EEAEVLPLEQKYHEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEFSESSKKQ 74

Query: 114 XXXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFY 173
                        Q  Y + SDI GR   L+    F+ +G ++   A NVT F++     
Sbjct: 75  WIATSFLLTNTAFQPLYGKLSDIIGRRPALLTAQFFFGLGCLMTCFARNVTEFSIARAVC 134

Query: 174 QLGYTGV 180
            +G  G+
Sbjct: 135 GIGAGGL 141

>Skud_13.244 Chr13 complement(417271..418959) [1689 bp, 562 aa] {ON}
           YMR088C (REAL)
          Length = 562

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 27/115 (23%), Positives = 51/115 (44%)

Query: 66  EQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXX 125
            +Y+  + +  + FSL+L ++   LD ++      +    +S+ S               
Sbjct: 27  HEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEDFSESSRKQWIATSFLLTNTA 86

Query: 126 GQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGV 180
            Q  Y + SDI GR + L+I   F+ +G ++   A NVT F++      +G  G+
Sbjct: 87  FQPLYGKLSDITGRKSALLIAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGL 141

>Kwal_27.10245 s27 (259090..260637) [1548 bp, 515 aa] {ON} YML116W
           (ATR1) - predicted protein is very hydrophobic, has many
           membrane-spanning regions, several potential
           glycosylation sites, potential ATP-binding site [contig
           38] FULL
          Length = 515

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 59/246 (23%), Positives = 95/246 (38%), Gaps = 47/246 (19%)

Query: 131 ARASDIFGRMTILIIGLVFYAVGTII---ESQATNVTRFAVGSCFYQLGYT-------GV 180
            +  DI+G    L+ G V   + ++I    S A NV  F V   F  LG         G+
Sbjct: 108 GKVGDIYGLKKTLLGGYVVVVIWSLICGLSSYAHNVDFFVVARSFQGLGIAFVLPNVMGI 167

Query: 181 ILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQH---WKWGIGMWAFIV 237
           + ++     +  NL + L  +  P     I   +    SG +G     W W    +A   
Sbjct: 168 VGNIYKPNTEAKNLVFSLIGACAP-----IGATLGCVFSGLIGARTDLWGWTFYAYAITA 222

Query: 238 PLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCA 297
            L+        L   W+   N    +                     +K+D+IG  +   
Sbjct: 223 ALNG-------LVALWIIPNNIPTNVNE-------------------YKMDWIGSAI--G 254

Query: 298 TFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDR 357
            FG IL  F         W +A+IIV  ++   VAL  F+ +EI+F+K PL P +++ +R
Sbjct: 255 VFGLILFNFVWNQAPIAGWGSAYIIVLLIVA-VVALIAFITYEIRFAKQPLLPHSVLFNR 313

Query: 358 GIFFAL 363
            +   L
Sbjct: 314 KLMMIL 319

>Skud_13.25 Chr13 (37872..39485) [1614 bp, 537 aa] {ON} YML116W
           (REAL)
          Length = 537

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 27/73 (36%), Positives = 41/73 (56%), Gaps = 3/73 (4%)

Query: 285 WKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFS 344
           + +D+IG  L     G +L+ F         W  A+IIV  VI   V L +F+++E +F+
Sbjct: 264 FSMDWIGSAL--GVIGLVLMNFVWNQAPISGWDQAYIIVLLVIS-VVFLVVFIIYENRFA 320

Query: 345 KVPLTPWALIKDR 357
           K PL P A++KDR
Sbjct: 321 KSPLLPRAVLKDR 333

>Kwal_14.1585 s14 (377103..378815) [1713 bp, 570 aa] {ON} YMR088C -
           Hypothetical ORF [contig 239] FULL
          Length = 570

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 37/174 (21%), Positives = 70/174 (40%), Gaps = 10/174 (5%)

Query: 30  NSSQLDSNQPDSNQPDLKNYDLYHK--DAGV----NNIEVYAEQYSSPIYRVMLFFSLFL 83
           N   LDS + +    +++NY +     D G+       E     +  P    ++  SL+L
Sbjct: 4   NDDLLDSLELE----EVRNYKVGENTGDEGIYDLEETEEDLERDFRDPKTFPLVLLSLWL 59

Query: 84  VAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGRMTIL 143
                 +DG++  T   +  S + + SL++             Q  Y + SD+ GR   L
Sbjct: 60  NTSICAIDGTIISTTMNEVASIFQEASLVTWVATAYMLTTCSVQPLYGKTSDLLGRKKCL 119

Query: 144 IIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWR 197
           +   V + +G ++   A  V   A+      +G +G+     +I  D + L+ R
Sbjct: 120 LFAEVVFIIGLVLCGMARTVKELAIARAICGIGGSGLGAMCNIILSDLAPLSQR 173

>ZYRO0C01430g Chr3 complement(101140..102912) [1773 bp, 590 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 590

 Score = 42.0 bits (97), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 63/297 (21%), Positives = 114/297 (38%), Gaps = 30/297 (10%)

Query: 71  PIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICY 130
           P   +++  S++L  +    DG++  T  A   S +++   +S             Q  Y
Sbjct: 75  PDKLLVITLSMYLGIFLAAADGTLVSTIMAHIASEFNELPRISWIATAYLLSSATFQPLY 134

Query: 131 ARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMD 190
            + SDIFGR  +L++  + + VG ++     +            +G  GV     +   D
Sbjct: 135 GKLSDIFGRKPLLMLNNIVFLVGCLMCGLTPSFWGLVGARFISGIGGGGVTSMCSITISD 194

Query: 191 FSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMW--AFI--VPLSAIPLGC 246
              L  R     +    F + T   G V G    H     G W  AF+  VPLSA+    
Sbjct: 195 IVPLRDRALYQGMCNFFFGLGTACGGVVGGWFSDHG----GGWRMAFLIQVPLSALSSLL 250

Query: 247 CLLHMRWLAHK---NAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCIL 303
             + M+        N+   +K++  +   +G  A +V        F+ L L+ A+ G   
Sbjct: 251 IAVFMKLPPRSKRVNSPASIKNKLLSVDWIGASALVV--------FLSLFLVTASLGGKE 302

Query: 304 VPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIF 360
           + F            +   V   IG  +A   F+  E+  +K P+ P + +++R + 
Sbjct: 303 IAF-----------NSKTFVALCIGSSLACAFFIGVELYGAKDPILPLSFLRNRSVL 348

>Kpol_543.44 s543 (96992..98923) [1932 bp, 643 aa] {ON}
           (96992..98923) [1932 nt, 644 aa]
          Length = 643

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 68/294 (23%), Positives = 117/294 (39%), Gaps = 28/294 (9%)

Query: 76  MLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASD 135
           ++  S++L  +   LD ++  T  A   S +++   +S             Q  Y + SD
Sbjct: 122 IIMLSMYLGIFLAALDNTIVSTLLAHIASEFNELPRISWVATAYLLSSATFQPIYGKISD 181

Query: 136 IFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLN 195
           IFGR  +LI   + + VG++I   + +      G     +G  G+     +   D   L 
Sbjct: 182 IFGRKVVLIFCNITFFVGSLICGLSPSFEWLVAGRFIAGIGGGGITSMSSITTSDIVPLR 241

Query: 196 WRLFASFVPALPFIINTWISGNVSG-----AVGQHWKWGIGMWAFIVPLSAIPLGCCLLH 250
            R     +    F + T + G V G     +VG  W+      +F++ L        L+ 
Sbjct: 242 NRALYQGICNFYFGLGTALGGVVGGWFSDRSVG--WR-----MSFLIQLPIAFFSTILII 294

Query: 251 MRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAG 310
           +     K +K R         D  +F+ I  V L  +D+IG   L       ++  +L G
Sbjct: 295 LFLRLPKESKGR-----GLQVDGNYFSTI-KVRLSAVDWIGATTLVLFLFSFMITASLGG 348

Query: 311 GLQDKWKTAHIIVPEVIGWCV----ALPIFLLWEIKFSKVPLTPWALIKDRGIF 360
             ++   T+H    + IG CV       IF   E+K +K P+ P   +KDR + 
Sbjct: 349 --KEIPYTSH----KFIGLCVVTVIGALIFGYTELKIAKDPILPLRFLKDRSVL 396

>TBLA0F03040 Chr6 complement(735352..738072) [2721 bp, 906 aa] {ON}
           Anc_8.272 YDR119W
          Length = 906

 Score = 42.0 bits (97), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 64/288 (22%), Positives = 107/288 (37%), Gaps = 20/288 (6%)

Query: 76  MLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASD 135
           ++  S++L  +   LD +V  T  A   S ++Q   +              Q  Y + SD
Sbjct: 398 IIMCSMYLGVFLAALDNTVVSTLMAHIGSEFNQIPKVPWVATSYLLSSAVFQPLYGKLSD 457

Query: 136 IFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLN 195
           IFGR  +LI   + +  G II   + ++     G     +G  G+     +   D   L 
Sbjct: 458 IFGRKALLIFSNLIFFFGCIICGMSNSLNMLVWGRFVAGIGGGGITSMTTITVSDIVPLR 517

Query: 196 WRLFASFVPALPFIINTWISGNVSGA-VGQHWKWGIGMWAFIVPLSAIPLGCCLLHMRWL 254
            R     +    F + T   G + G  V   + W +  W+  VP+S +     LL   +L
Sbjct: 518 SRAVYQGICNFFFGLGTAFGGVIGGIFVDHQYGWRMVFWSQ-VPVSGL---STLLICSFL 573

Query: 255 AHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQD 314
                K+   S  R    + W   I  + LW   F   LL+    G I         L  
Sbjct: 574 VVPRIKNYEVSLGRKLMRVDWLGSI-SMILWLTSF---LLITTMMGGI--------SLDI 621

Query: 315 KWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFA 362
                H +   ++   V+  IF+L E+  +  P+ P   + +R +  A
Sbjct: 622 DSDQFHYL---IMFSSVSAIIFVLTELFVASDPVLPLRFLSNRSVLGA 666

>KLTH0G13464g Chr7 complement(1154304..1156085) [1782 bp, 593 aa]
           {ON} weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 593

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 76/371 (20%), Positives = 138/371 (37%), Gaps = 32/371 (8%)

Query: 1   MTSSSDSKFDGKINETVLQEQTTE----DSNQFNSSQ--LDSNQPDSNQPDLKNY---DL 51
           M  S  S     ++   +Q+ +T+     +NQ       LD  Q  +     K+    + 
Sbjct: 1   MVQSEHSPLLTPVDRDAMQDPSTDLPGFVANQIEQQDHLLDIEQGRAYGSTTKSSISSEN 60

Query: 52  YHKDAGVNNIE-VYAEQYSSPIYRVML-FFSLFLVAYAYGLDGSVRYTYQAQATSSYSQH 109
             +DAG   +    + ++  P  R+++  FS+FL  +   LDG++  T      S ++  
Sbjct: 61  EREDAGGATVAGCGSAEFYLPSSRILIIMFSMFLGIFLAALDGTIVSTLLTHIGSEFNSL 120

Query: 110 SLLSXXXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVG 169
              S             Q  Y + SD  GR  +L+     +A+G +I   + ++     G
Sbjct: 121 DKASWIATSYLLSSSTCQPLYGKLSDRLGRKPLLVFSNAVFAIGCLICGLSNSIWAVVAG 180

Query: 170 SCFYQLGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWG 229
                +G  G+     +I  D   L  R     +    F + T  SG + GA  + W+  
Sbjct: 181 RFISGIGGCGLTSLATMIMSDLVPLRDRAVYQGLCNFVFGLGT-ASGGLVGAYFRDWRLA 239

Query: 230 IGMWAFIVPLSAIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDF 289
             +   I  LS I L    L +   A  + KD   +  R     G  + I  +FL+    
Sbjct: 240 FILQCPISVLSGI-LIVVYLELPPRASASNKDCWSARLRRLDWAGATSLIAFLFLF---- 294

Query: 290 IGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLT 349
               +L ++ G   V +        +   A      V G      +F+  E++ +  P+ 
Sbjct: 295 ----MLTSSMGGSSVAY------GSRLFAAMCAATLVFG-----AVFVYVELRVAADPVL 339

Query: 350 PWALIKDRGIF 360
           P   ++DR + 
Sbjct: 340 PVTFLRDRSVL 350

>SAKL0C05588g Chr3 (527748..529781) [2034 bp, 677 aa] {ON} similar
           to uniprot|P36172 Saccharomyces cerevisiae YKR105C
           Hypothetical ORF
          Length = 677

 Score = 41.2 bits (95), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 61/276 (22%), Positives = 117/276 (42%), Gaps = 33/276 (11%)

Query: 128 ICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELI 187
           + + R + I G  + L++ ++ +  G++I + + ++     G     +G +G+     +I
Sbjct: 171 LLWGRFATIIGFKSSLLVSILIFEAGSLISAISNSMNMLIGGRVVAGIGGSGIQSLCFVI 230

Query: 188 AMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGCC 247
           A   +    R+    V +  + +   +   + GA+  H  W    W F + L    L   
Sbjct: 231 ASTLTPDRSRVIIISVLSCSYAVAAVVGPFLGGALTTHVTW---RWCFYINLPIGGLAFV 287

Query: 248 LLHMRW--LAHKNAKDRL---KSEFRTYRDMG------WFAYIVDVFLWKLDFIGLLLLC 296
           +L M +     K+ KD     K+ +R  R MG      +++ I +  ++++DF+G +L  
Sbjct: 288 VLAMVYNPSGRKSIKDVFSVTKANYR--RGMGRLLTARFYSKIPNWLVFQIDFVGFVLCT 345

Query: 297 ATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVA----------LPIFLLWEIKFSKV 346
           A F  +L+  T  G +   W +  IIV  V+G  +            P F       S +
Sbjct: 346 AGFTLLLLGLTFGGSMY-AWSSGTIIVSLVVGVLLITASLVYDFALFPRFKQVRKDASCM 404

Query: 347 PLTPWALIKDRGIF------FALVIAFHINFIWYMQ 376
           PL PW ++   GIF      F   IA+    ++ +Q
Sbjct: 405 PLLPWRVVSRPGIFTSNTAVFLGCIAYSAQIVYAVQ 440

>ABL040W Chr2 (321534..323237) [1704 bp, 567 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR088C
          Length = 567

 Score = 40.8 bits (94), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 57/137 (41%), Gaps = 7/137 (5%)

Query: 40  DSNQPDLKNYDLYHK--DAGVNNIEVYAE-----QYSSPIYRVMLFFSLFLVAYAYGLDG 92
           D ++  L+   L H   + G N+ +   E     +++  + +  +  SL+L ++   +D 
Sbjct: 2   DESESQLRGTLLPHDSLEYGTNSDKTLTETQRCQEHNRSLPKAPILTSLWLGSFLASIDA 61

Query: 93  SVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAV 152
           S+      +    + +                  Q  Y R SDI GR   L+I   F+ +
Sbjct: 62  SIVANIMNKIAEEFHESDKKQWMATSFLLTNAAFQPLYGRCSDIVGRKCALLIAQSFFLL 121

Query: 153 GTIIESQATNVTRFAVG 169
           GT++   A NVT FA+ 
Sbjct: 122 GTLLTCFARNVTEFAIA 138

>KNAG0J00260 Chr10 (37950..39602) [1653 bp, 550 aa] {ON} Anc_8.843
           YMR279C
          Length = 550

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 39/131 (29%), Positives = 59/131 (45%), Gaps = 6/131 (4%)

Query: 300 GCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGI 359
           G IL  F    G  D W   +II   ++     L  F ++EIKF+K PL P  +IK+R I
Sbjct: 282 GMILFNFVWNQGPIDGWNKGYIIALLIVS-VFLLIAFFIYEIKFAKSPLLPPEVIKNRHI 340

Query: 360 FFALVIAFHINFIWYMQGDYMYTVLIVSVNESIKSATRITSLYSFVSVITGTLLG-LVII 418
              L+  F     W   G + +      +N    SA      + F+ VI GT+   LV +
Sbjct: 341 GMILLAVF---MGWGSFGIWTFYYYAFQLNLRHYSAVWAGGTF-FMFVIWGTIAAFLVAL 396

Query: 419 KVRRTKPFIIF 429
            ++R  P ++ 
Sbjct: 397 TIKRVGPSVLL 407

>NCAS0B00290 Chr2 (33760..35388) [1629 bp, 542 aa] {ON} Anc_8.843
          Length = 542

 Score = 40.4 bits (93), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 29/87 (33%), Positives = 46/87 (52%), Gaps = 3/87 (3%)

Query: 281 DVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWE 340
           +V  + +D+IG +L  A  G IL+ F    G    W+TA+II   V+     L +F  +E
Sbjct: 259 NVHGFAMDWIGSVL--AVIGLILLNFVWNQGPIVGWQTAYIIALLVVS-VFFLALFFTYE 315

Query: 341 IKFSKVPLTPWALIKDRGIFFALVIAF 367
           +K+++ PL P  + K+R I   L   F
Sbjct: 316 VKYAESPLLPVEVTKNRHIIMILAALF 342

>YMR088C Chr13 complement(443414..445102) [1689 bp, 562 aa] {ON}
           VBA1Permease of basic amino acids in the vacuolar
           membrane
          Length = 562

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 26/115 (22%), Positives = 50/115 (43%)

Query: 66  EQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXX 125
            +Y+  + +  + FSL+L ++   LD ++      +    +S+ S               
Sbjct: 27  HEYNLALPKFPILFSLWLGSFLSSLDSTIVANIMNRVAEEFSESSKKQWIATSFLLTNTA 86

Query: 126 GQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGV 180
            Q  Y + SDI GR + L+    F+ +G ++   A NVT F++      +G  G+
Sbjct: 87  FQPLYGKLSDITGRKSALLTAQFFFGLGCLLTCFARNVTEFSIARAICGIGAGGL 141

>ZYRO0G21890g Chr7 complement(1801391..1803121) [1731 bp, 576 aa]
           {ON} weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 576

 Score = 40.0 bits (92), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 23/91 (25%), Positives = 41/91 (45%)

Query: 89  GLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGRMTILIIGLV 148
            LDG++  T      S + Q S+++             Q  Y + SDI GR   L+ G V
Sbjct: 74  ALDGTIVSTTVNDIASQFQQASMVTWVATAYLLTTTAVQPLYGKISDIIGRRKCLLFGEV 133

Query: 149 FYAVGTIIESQATNVTRFAVGSCFYQLGYTG 179
            +A+G ++ + A  + + A+      +G +G
Sbjct: 134 IFALGVLLCNFANTIPQLAIARAICGIGGSG 164

>SAKL0F00198g Chr6 complement(10713..12326) [1614 bp, 537 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 537

 Score = 39.7 bits (91), Expect = 0.019,   Method: Compositional matrix adjust.
 Identities = 75/339 (22%), Positives = 141/339 (41%), Gaps = 35/339 (10%)

Query: 128 ICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELI 187
           + + R + IFG    L++ ++ +  G++I + + ++     G     +G +G+     +I
Sbjct: 94  LLWGRFATIFGFKLSLLLSILIFETGSLISAVSNSMNVLIGGRVVAGIGGSGIQSLCFVI 153

Query: 188 AMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGCC 247
           A   +    R  A  V +  + +    S  +  A   H  W    W F + L    L   
Sbjct: 154 ASTLTTERSRGVAISVLSCAYAVAAVASPFMGSAFTTHVTW---RWCFYINLPIGGLAFA 210

Query: 248 LLHMRWLAHKNAKDR-----LKS--EFRTYRDMGWFAYIVDVFLWKLDFI-----GLLLL 295
           +L + +  H+    R     LKS  EF T R      +  D++L   + +      +  +
Sbjct: 211 VLVLTYKPHEGNSARSIVSVLKSCCEFGTAR-----LFSKDLYLKMFNELVFGFDFIGFI 265

Query: 296 CATFGCILVPFTLA-GGLQDKWKTAHIIVPEVIGWCVALPIFLLWEI----KFSKV---- 346
             + G IL    L  GG +  W +  IIV  V+G  +++  FLL++     KF +V    
Sbjct: 266 FCSVGFILFRLGLTFGGDKYTWSSGAIIVYFVVGVTISVA-FLLYDFMVFPKFGRVRKNA 324

Query: 347 ---PLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVL-IVSVNESIKSATRITSLY 402
              PL PW+++   GI  A+   F +   +  Q  Y+     +V  +++ +++  + +L 
Sbjct: 325 SFRPLVPWSVVSRPGIATAVAANFLMCVAYSAQVVYIIQFFQLVRGSDAWRASIHVVAL- 383

Query: 403 SFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLL 441
               +IT  + G +       KP I  G+    +  GLL
Sbjct: 384 EIPDIITVAISGAISRMTGHVKPIIFVGIIAGLVGAGLL 422

>TPHA0C04790 Chr3 complement(1033653..1035323) [1671 bp, 556 aa]
           {ON} Anc_8.843 YMR279C
          Length = 556

 Score = 39.7 bits (91), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 27/82 (32%), Positives = 42/82 (51%), Gaps = 3/82 (3%)

Query: 286 KLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSK 345
           K+D+IG  +     G +L  F       D W  A+IIV  VI   + +  F ++EI +++
Sbjct: 273 KMDWIGSAV--GVVGLLLFSFVWNQAPMDGWDKAYIIVLLVIS-VILIIAFFIYEINYAE 329

Query: 346 VPLTPWALIKDRGIFFALVIAF 367
           VPL P A+  +R I   L+  F
Sbjct: 330 VPLLPKAITGNRHIIMILLAIF 351

>SAKL0E02992g Chr5 complement(243652..245364) [1713 bp, 570 aa] {ON}
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 570

 Score = 39.3 bits (90), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 26/132 (19%), Positives = 59/132 (44%), Gaps = 1/132 (0%)

Query: 39  PDSNQPDLKNYDLYHK-DAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYT 97
           PD+  P   + +L  + +   +++E    +++  + ++ + FSL++ ++   LDG++   
Sbjct: 14  PDTLDPQSLSLNLEDEFNRKNSSLEEEYHKHNLDLPKLPIVFSLWMGSFLGALDGTIVAN 73

Query: 98  YQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIE 157
              +    + +                  Q  Y + SDI GR   L++   F+ +G ++ 
Sbjct: 74  IMNRVAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDITGRKFALLVAHTFFCLGCLLT 133

Query: 158 SQATNVTRFAVG 169
             A NVT F++ 
Sbjct: 134 CFARNVTEFSIA 145

>KLLA0A04631g Chr1 complement(415070..416809) [1740 bp, 579 aa] {ON}
           weakly similar to uniprot|Q04602 Saccharomyces
           cerevisiae YDR119W Uncharacterized transporter
          Length = 579

 Score = 39.3 bits (90), Expect = 0.028,   Method: Compositional matrix adjust.
 Identities = 30/118 (25%), Positives = 51/118 (43%)

Query: 80  SLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGR 139
           S+ L ++   LD ++  T  +   S +++ S +S             Q  Y + SDIFGR
Sbjct: 66  SMCLGSFLAALDNTIVTTLLSHIASEFNELSHISWIATAYLLSSATFQPLYGKISDIFGR 125

Query: 140 MTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWR 197
             ++II  +F+ +G +I   + N+     G     +G  GV     + A D   L  R
Sbjct: 126 RPLIIISNLFFILGCLICGLSKNLWTLVAGRFIAGIGGGGVTSLGSITASDIVPLRSR 183

>NDAI0K00400 Chr11 (90040..91701) [1662 bp, 553 aa] {ON} 
          Length = 553

 Score = 38.9 bits (89), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 28/81 (34%), Positives = 44/81 (54%), Gaps = 3/81 (3%)

Query: 287 LDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKV 346
           +D+IG +L     G IL  F    G    W+ A+IIV  ++   + L  F ++EIK++KV
Sbjct: 272 MDWIGSVL--GVIGLILFNFVWNQGPIVGWEKAYIIVLLIVS-VIFLIAFFVYEIKYAKV 328

Query: 347 PLTPWALIKDRGIFFALVIAF 367
           PL P A+ ++  I   L + F
Sbjct: 329 PLLPKAVTQNGHILTILTVLF 349

>KNAG0G03430 Chr7 complement(734828..736456) [1629 bp, 542 aa] {ON}
           Anc_8.843 YMR279C
          Length = 542

 Score = 38.1 bits (87), Expect = 0.066,   Method: Compositional matrix adjust.
 Identities = 26/87 (29%), Positives = 45/87 (51%), Gaps = 3/87 (3%)

Query: 281 DVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWE 340
           +V  + +D+IG  L  A  G IL+ F    G  D W  A+IIV  ++     L +F ++E
Sbjct: 259 NVHGFSMDWIGSGL--AVVGLILLNFVWNQGPIDGWGKAYIIVLLIVS-VFVLTLFFIYE 315

Query: 341 IKFSKVPLTPWALIKDRGIFFALVIAF 367
           + ++  PL P  + ++R +   L+  F
Sbjct: 316 VHYAASPLLPRVITQNRHMVMILMALF 342

>KLTH0H05456g Chr8 (484160..485866) [1707 bp, 568 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 568

 Score = 38.1 bits (87), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 35/171 (20%), Positives = 66/171 (38%), Gaps = 14/171 (8%)

Query: 27  NQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAY 86
           ++ +SS+ +S  P  + PD    +   KD            +  P     +  SL+L   
Sbjct: 14  DEIHSSKGESTVP--SFPDTGEEEDLEKD------------FRDPNTFPYILLSLWLNTS 59

Query: 87  AYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGRMTILIIG 146
              +DG++  T   +  S + + S ++             Q  Y + SD+ GR   L+  
Sbjct: 60  ICAVDGTIISTTMNEIASIFQEASKVTWVATAYMLTTCAVQPLYGKTSDLLGRKKCLLFA 119

Query: 147 LVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWR 197
            V + VG ++   A  +    V      +G +G+     +I  D + L+ R
Sbjct: 120 EVVFIVGLVMCGAARTIEELIVARAICGVGGSGLGAMCNIILSDLAPLSQR 170

>Skud_13.451 Chr13 complement(798006..799625) [1620 bp, 539 aa] {ON}
           YMR279C (REAL)
          Length = 539

 Score = 37.7 bits (86), Expect = 0.078,   Method: Compositional matrix adjust.
 Identities = 28/82 (34%), Positives = 42/82 (51%), Gaps = 3/82 (3%)

Query: 286 KLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSK 345
            +D+ G +L  A  G IL  F         W  A+IIV  V+     L  F ++EIK+++
Sbjct: 264 SMDWTGSVL--AVIGLILFNFVWNEAPIAGWDKAYIIVLLVVS-VFFLVAFFVYEIKYAE 320

Query: 346 VPLTPWALIKDRGIFFALVIAF 367
           VPL P A+ K+R +   L+  F
Sbjct: 321 VPLLPHAVTKNRHMIMILLAVF 342

>KNAG0E02560 Chr5 (506517..508253) [1737 bp, 578 aa] {ON} Anc_2.473
           YMR088C
          Length = 578

 Score = 37.7 bits (86), Expect = 0.087,   Method: Compositional matrix adjust.
 Identities = 31/131 (23%), Positives = 53/131 (40%), Gaps = 13/131 (9%)

Query: 39  PDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTY 98
           P+    D K    YH+D             + P   ++L  SL+L ++   LDG+V    
Sbjct: 19  PNDLPDDTKLEQEYHRD-----------NMALPKGPILL--SLWLGSFVSALDGTVVANI 65

Query: 99  QAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIES 158
                + +++                  Q  Y + SDI GR   +I    F+A+G ++  
Sbjct: 66  MNSIAAEFAESDKKQWIATSYLLTNTAFQPLYGKLSDITGRKVAVITAHFFFALGCLLTC 125

Query: 159 QATNVTRFAVG 169
            A NVT+F++ 
Sbjct: 126 FAQNVTQFSIA 136

>KLTH0D05434g Chr4 (486319..488049) [1731 bp, 576 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 576

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 33/145 (22%), Positives = 60/145 (41%), Gaps = 5/145 (3%)

Query: 41  SNQPDLKNYDLYHKDAGVNNIEVYAE----QYSSPIYRVMLFFSLFLVAYAYGLDGSVRY 96
           S  P  ++  L    +  N  +V  E    +++  + ++ +  SL+L ++   LDG++  
Sbjct: 2   SGSPPGEDTALLGSISEENECDVGLEREYHEHNLALPKIPILVSLWLGSFLVALDGTIVA 61

Query: 97  TYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIF-GRMTILIIGLVFYAVGTI 155
               +    + +                  Q  Y + SD+  GR    +I   F+ +G I
Sbjct: 62  NVMNRIAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRKLATLIAQFFFFLGLI 121

Query: 156 IESQATNVTRFAVGSCFYQLGYTGV 180
           I   A NVT+FA+G     +G  GV
Sbjct: 122 ISCFAQNVTQFAIGRAVCGIGGGGV 146

>YML116W Chr13 (38196..39824) [1629 bp, 542 aa] {ON}  ATR1Multidrug
           efflux pump of the major facilitator superfamily,
           required for resistance to aminotriazole and
           4-nitroquinoline-N-oxide
          Length = 542

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 45/77 (58%), Gaps = 3/77 (3%)

Query: 281 DVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWE 340
           ++  + +D+IG +L     G IL+ F         W  A+IIV  +I   + L +F+++E
Sbjct: 259 NIHHFSMDWIGSVL--GVIGLILLNFVWNQAPISGWNQAYIIVILIIS-VIFLVVFIIYE 315

Query: 341 IKFSKVPLTPWALIKDR 357
           I+F+K PL P A+IKDR
Sbjct: 316 IRFAKTPLLPRAVIKDR 332

>Suva_13.27 Chr13 (37895..39556) [1662 bp, 553 aa] {ON} YML116W
           (REAL)
          Length = 553

 Score = 37.0 bits (84), Expect = 0.16,   Method: Compositional matrix adjust.
 Identities = 26/77 (33%), Positives = 41/77 (53%), Gaps = 3/77 (3%)

Query: 281 DVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWE 340
           +V  + +D+IG  L     G +L+           W  A+IIV  +I   + L +F ++E
Sbjct: 270 NVHRFSMDWIGSGL--GVIGLVLLNLVWNQAPISGWNQAYIIVLLIIS-VLFLVLFGVYE 326

Query: 341 IKFSKVPLTPWALIKDR 357
           I F+K PL P A++KDR
Sbjct: 327 IHFAKSPLLPQAVMKDR 343

>NCAS0A07810 Chr1 complement(1554541..1556247) [1707 bp, 568 aa]
           {ON} Anc_2.473
          Length = 568

 Score = 37.0 bits (84), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 24/122 (19%), Positives = 49/122 (40%)

Query: 59  NNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXX 118
           N +E    +Y+  + +  +  SL+L ++   LD ++      +    + +          
Sbjct: 24  NGLEEQYHEYNLSLPKFPILLSLWLGSFLSSLDSTIVANIMNKVAEEFEESDKKQWIATS 83

Query: 119 XXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYT 178
                   Q  Y + SDI GR   ++    F+ +G  +   A N+T+F++      +G  
Sbjct: 84  FLLTNTAFQPLYGKLSDITGRKFAVLTSHFFFGLGCFLTCFAQNITQFSIARAICGIGAG 143

Query: 179 GV 180
           GV
Sbjct: 144 GV 145

>AGR076C Chr7 complement(871564..873624) [2061 bp, 686 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR119W
          Length = 686

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 32/147 (21%), Positives = 58/147 (39%)

Query: 74  RVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARA 133
           R ++  S+ L  +   LDG++  T      S +++   +S             Q  Y + 
Sbjct: 139 RRVVMASMCLGVFLAALDGTIVTTLLDHIASEFNELPRISWIATAYLLSSATFQPLYGKL 198

Query: 134 SDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSN 193
           SDIFGR  +L+   + + +G +I   + N+    +G     +G  G+     +   D   
Sbjct: 199 SDIFGRRPLLVFSNLVFCLGALICGMSKNLWVLVLGRFVAGIGGGGLTSMCSITTTDIVP 258

Query: 194 LNWRLFASFVPALPFIINTWISGNVSG 220
           L  R     +  + F + T   G V G
Sbjct: 259 LRSRALYQGICNVFFGLGTACGGLVGG 285

>YGR224W Chr7 (942806..944647) [1842 bp, 613 aa] {ON}  AZR1Plasma
           membrane transporter of the major facilitator
           superfamily, involved in resistance to azole drugs such
           as ketoconazole and fluconazole
          Length = 613

 Score = 36.6 bits (83), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 73/173 (42%), Gaps = 18/173 (10%)

Query: 274 GWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAH----------IIV 323
           GW    +++ ++  D I  +   A F CIL+ FT  GG +  W +A           ++V
Sbjct: 285 GWRKPFMEL-IFMYDIIEFVFCSAGFTCILLAFTF-GGNRYAWNSASIIILFIIGIVLVV 342

Query: 324 PEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTV 383
              I   +  P F + +      PL  W  IK  GIF   +  F     +  Q  Y+   
Sbjct: 343 LAGIYDFLVFPKFNIVKATPHYQPLMSWTNIKKPGIFTVNIALFLTCAGYISQFTYIVQY 402

Query: 384 LIVSVNESI-KSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFI----IFGV 431
             +  N+S  ++A  + +     +V+T  L G +  K R+ KP I    IFGV
Sbjct: 403 FQLIYNDSAWRAAVHLVACI-ISTVVTAILCGAITDKTRQIKPIIVISSIFGV 454

>TPHA0A01750 Chr1 complement(354061..355971) [1911 bp, 636 aa] {ON}
           Anc_8.272 YDR119W
          Length = 636

 Score = 36.6 bits (83), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 71/313 (22%), Positives = 123/313 (39%), Gaps = 10/313 (3%)

Query: 53  HKDAG--VNNIEVYAEQYS-SPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQH 109
           H D G   N+I +  ++ + SP    +   S++L  +   LD ++  T  A+  S +++ 
Sbjct: 70  HHDYGSVANSIILDNDKNNLSPTRLRLAMSSMYLGIFLSALDNTIVSTLLARIGSEFNEL 129

Query: 110 SLLSXXXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVG 169
             +S             Q  Y + SDIFGR  +L    V + +G +I   A +     +G
Sbjct: 130 PRISWIATAYLLSSATFQPLYGKISDIFGRKIVLTFCNVNFFIGCLICGTAKSFWVLVIG 189

Query: 170 SCFYQLGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWG 229
                +G  G+     +   D   L  R     V    + +   + G + G   +     
Sbjct: 190 RFISGVGGGGITSMSTITVSDIIPLRNRALYQGVCNFYYGLGIALGGIIGGWFTEKLGSW 249

Query: 230 IGMWAFIVPLSAIPLGCCLLHMRWLA-HKNAKD-RLKSEFRTYRDMGWFAYIVDVFLWKL 287
            G + F VPLS I     +  M WL   K++K   L+              I+   L  +
Sbjct: 250 RGAFLFQVPLSVI---STVTVMVWLQLPKDSKSYGLEITMSNNSSNNGTESIIMKKLKTI 306

Query: 288 DFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVP 347
           D+ G + L   F    +  + AGG     K+   +   +I    +   F+  E+KF+K P
Sbjct: 307 DWYGAMSL-VIFLLSFMILSSAGGSDISVKSNTFLYLTLIS-VTSFISFIYIELKFAKDP 364

Query: 348 LTPWALIKDRGIF 360
           + P   +KDR + 
Sbjct: 365 ILPLVFLKDRSVL 377

>Smik_13.492 Chr13 complement(807726..809357) [1632 bp, 543 aa] {ON}
           YMR279C (REAL)
          Length = 543

 Score = 36.2 bits (82), Expect = 0.25,   Method: Compositional matrix adjust.
 Identities = 24/71 (33%), Positives = 36/71 (50%), Gaps = 1/71 (1%)

Query: 297 ATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKD 356
           A  G IL  F         W  A+IIV  ++     L  F ++EIK+++VPL P A+ K+
Sbjct: 274 AVLGLILFNFVWNQAPIAGWGEAYIIVLLILS-VFFLIAFFVYEIKYAEVPLLPHAVTKN 332

Query: 357 RGIFFALVIAF 367
           R +   L+  F
Sbjct: 333 RHMIMILLAVF 343

>Smik_11.368 Chr11 complement(649880..651622) [1743 bp, 580 aa] {ON}
           YKR105C (REAL)
          Length = 580

 Score = 36.2 bits (82), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 100/491 (20%), Positives = 181/491 (36%), Gaps = 50/491 (10%)

Query: 37  NQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRY 96
            + +S+Q ++K YD    D  +N   V +      I   +   SL LV +   LD  +  
Sbjct: 3   EEKNSSQAEVKAYD---SDTELN---VNSSDERGGISLYLCLTSLTLVLFITALDILIVG 56

Query: 97  TYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTII 156
           T        +  +S                 + + R + I G    LI+ ++ +  G+++
Sbjct: 57  TIIDVVAEQFGNYSKTGWLVTGYSLPNAILSLVWGRFASIIGFQHSLILAVLIFEAGSLV 116

Query: 157 ESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISG 216
            + A ++    VG     +G +G+     +I     N   R     + +  F +   +  
Sbjct: 117 AALANSMNMLIVGRVVAGVGGSGLQTLCFVIGCTMVNERSRPLVISILSCAFAVAAIVGP 176

Query: 217 NVSGAVGQHWKWGIGMWAFIVPLSAIPLGCCLLHMRWLAHKNAKDRL------------K 264
            + GA   H  W    W F + L   P+G   + M  L +K   + +            K
Sbjct: 177 IIGGAFTTHVTW---RWCFYINL---PIGGFAVIMFLLTYKTKSENILQQTRNILGRISK 230

Query: 265 SEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVP 324
            E R   + G     +   L+K DF+G  L  A     L+  T  GG +  W +  II  
Sbjct: 231 FELRRLTEPGNLRKALIGILFKFDFLGFALSSAGLVLFLLGLTF-GGNKYSWNSGQIITY 289

Query: 325 EVIGWCVALPIF-LLWEI----KFSKVPLTPWALIKDRGIFFALVIA----FHINFIWYM 375
            V+G  + L +F L+++     KF+  P         R +F   ++A      +N + ++
Sbjct: 290 LVLG--ILLFVFSLIYDFFIFQKFNPEPDNT----SYRPLFLKRLVAKPAVIIVNMVTFL 343

Query: 376 -----QGDYMYTVL---IVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFI 427
                 G  +Y+V    ++  + + K+   +  +    +VI     G++  K+   KP +
Sbjct: 344 LCIGYNGQMIYSVQFFQLIFASSAWKAGLHLIPIV-ITNVIAAIASGVITKKLGLVKPLL 402

Query: 428 IFGVSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMA 487
           IFG     I  GL+                L L G   GF    +  S Q  +K     A
Sbjct: 403 IFGGILGVIGAGLMT-LMSNNSTSSTQIGVLILPGLSLGFALQASLMSAQLQIKKDRPEA 461

Query: 488 VITALYLAMYN 498
               + +  +N
Sbjct: 462 TTDFIEITAFN 472

>KNAG0C05250 Chr3 (1024201..1025895) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 35.8 bits (81), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 50/183 (27%), Positives = 78/183 (42%), Gaps = 21/183 (11%)

Query: 21  QTTED-SNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSS----PIYRV 75
           Q TE  SN F S+   SN+ D +  DLK  D Y+ +   N IE+  +  S+     I  +
Sbjct: 11  QATESASNSFASTT--SNKADRD--DLK--DEYNDENVDNQIEIPKKPGSAYVTVSIMCI 64

Query: 76  MLFFSLFLVAYAYGLDGS-------VRYTYQAQATSS-YSQHSLLSXXXXXXXXXXXXGQ 127
           M+ F  F+  +  G           +R   Q +A  + Y                   G 
Sbjct: 65  MIAFGGFVFGWDTGTISGFVAQTDFIRRLGQRRADGTHYLSKVRTGLVVSIFNIGCAIGG 124

Query: 128 ICYARASDIFGRMTILIIGLVFYAVGTIIESQATNV-TRFAVGSCFYQLGYTGV-ILSLE 185
           I  ++A D++GR   L+I LV Y  G +I+    N   ++ +G     LG  G+ +LS  
Sbjct: 125 IILSKAGDMYGRKKGLLIVLVIYIAGIVIQIATINKWYQYFIGRIISGLGVGGISVLSPM 184

Query: 186 LIA 188
           LI+
Sbjct: 185 LIS 187

>KNAG0C05190 Chr3 (1014564..1016258) [1695 bp, 564 aa] {ON} 
          Length = 564

 Score = 35.8 bits (81), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 41/184 (22%), Positives = 78/184 (42%), Gaps = 16/184 (8%)

Query: 19  QEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSS----PIYR 74
           ++Q     +  ++S++ +    + + DLK  D Y+ +   N +E+  +  S+     I  
Sbjct: 6   EQQQFSRVDSASNSEISTPSNKAERDDLK--DEYNDENAENEVEIPKKPGSAYVTVSIMC 63

Query: 75  VMLFFSLFLVAYAYGLDGS-------VRYTYQAQATSS-YSQHSLLSXXXXXXXXXXXXG 126
           +M+ F  F+  +  G           +R   Q +A  + Y     +             G
Sbjct: 64  IMIAFGGFVFGWDTGTISGFVAQTDFIRRLGQRRADGTHYLSKVRIGLVVSIFNIGCAIG 123

Query: 127 QICYARASDIFGRMTILIIGLVFYAVGTIIESQATNV-TRFAVGSCFYQLGYTGV-ILSL 184
            I  ++A D++GR   LII +  Y VG +I+    N   ++ +G     LG  G+ +LS 
Sbjct: 124 GIILSKAGDMYGRKKGLIIVVSIYIVGIVIQIATINKWYQYFIGRIISGLGVGGISVLSP 183

Query: 185 ELIA 188
            LI+
Sbjct: 184 MLIS 187

>TDEL0A02490 Chr1 (446429..448093) [1665 bp, 554 aa] {ON} Anc_2.473
           YMR088C
          Length = 554

 Score = 35.4 bits (80), Expect = 0.39,   Method: Compositional matrix adjust.
 Identities = 23/90 (25%), Positives = 38/90 (42%)

Query: 80  SLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGR 139
           SL+L ++   LDG++      +    +S+                  Q  Y + SD+ GR
Sbjct: 40  SLWLGSFVSSLDGTIVANIMNRVAEEFSESDKKQWIATSFLLTNTAFQPLYGKLSDVTGR 99

Query: 140 MTILIIGLVFYAVGTIIESQATNVTRFAVG 169
              L++   F  +G ++   A NVT FAV 
Sbjct: 100 KFALLMAYFFLVIGCLLTCLARNVTEFAVA 129

>CAGL0J01375g Chr10 (127843..129537) [1695 bp, 564 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088c
          Length = 564

 Score = 35.4 bits (80), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 73/390 (18%), Positives = 143/390 (36%), Gaps = 49/390 (12%)

Query: 27  NQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAY 86
           N   ++ L    PD+ + D    + YH             +++  + ++ +  SL+L ++
Sbjct: 3   NLDETTGLLEQTPDTTEQDALEQE-YH-------------EHNLSLPKLPIVLSLWLGSF 48

Query: 87  AYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGRMTILIIG 146
              LDG++      +    + +                  Q  Y + SD+ GR   ++  
Sbjct: 49  LSSLDGTIVANIMNRVAEEFQESDKKQWIATSYLLTNTAFQPLYGKLSDLTGRKFAVLTA 108

Query: 147 LVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWRLFASFVPAL 206
             F+ +G ++   A +VT+FA+      +G  G+     +   D      R        +
Sbjct: 109 HFFFGLGCLLTCFANSVTQFAIARAICGVGGGGINAMSSITVSDICTQRERGIYQGYANI 168

Query: 207 PFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGCCLLHMRWLAHKNAKDRLKSE 266
            F +   +   + G       W I ++   VP         +L    L HKN   +L   
Sbjct: 169 VFGLGQILGAPIGGLFIDTLGWRI-LFGLQVP--------TILLCSSLVHKNVNIKLSHL 219

Query: 267 FRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGL---QDKWKTAHIIV 323
                   W        L ++D +G   L          FT++G L     +   A + +
Sbjct: 220 LPVEERFKWSN------LSRIDILGSSTLV---------FTISGVLFLCSTELNKALLSI 264

Query: 324 PEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTV 383
             VI +      F+L E+ +SK  + P+ L+K     F L  A  +   + + GD   + 
Sbjct: 265 FTVISFIA----FILIELYYSKERIMPFELLKGS---FGLASAATVISSFIIFGDIFRSP 317

Query: 384 LIVSVNESIK-SATRITSLYSFVSVITGTL 412
           + + + + +  + T    L+  +SV  G+L
Sbjct: 318 IYLQLIQGVSVTKTGFFMLFPSISVAVGSL 347

>Kwal_26.7755 s26 (500034..501713) [1680 bp, 559 aa] {ON} YMR088C -
           1:1 [contig 55] FULL
          Length = 559

 Score = 35.0 bits (79), Expect = 0.55,   Method: Compositional matrix adjust.
 Identities = 33/140 (23%), Positives = 58/140 (41%), Gaps = 9/140 (6%)

Query: 34  LDSNQPDSNQPDLKNYDLYHKDAGVNNI---EVYAEQYSSPIYRVMLFFSLFLVAYAYGL 90
           + S   D N   L   D   +D  V++I   E + +  + P  +  +  SL+L ++   L
Sbjct: 1   MSSPVQDENTRLLSPVD---EDNNVHSILEKEYHEQNLNLP--KTPILVSLWLGSFLVAL 55

Query: 91  DGSVRYTYQAQATSSYSQHSLLSXXXXXXXXXXXXGQICYARASDI-FGRMTILIIGLVF 149
           DG++      +    + +                  Q  Y + SD+  GR    ++   F
Sbjct: 56  DGTIVANVMNRIAEEFQESDKKQWIATSFLLTNTAFQPLYGKLSDVATGRKGAALVAQFF 115

Query: 150 YAVGTIIESQATNVTRFAVG 169
           + +G +I   A NVT+FAVG
Sbjct: 116 FCLGLVISCFAQNVTQFAVG 135

>Kpol_467.24 s467 (55523..56632) [1110 bp, 370 aa] {ON}
           (55523..56632) [1110 nt, 370 aa]
          Length = 370

 Score = 34.7 bits (78), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 16/43 (37%), Positives = 25/43 (58%)

Query: 127 QICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVG 169
           Q  Y + SDI GR   L+  L F+ +G  + S +TN+ +FA+ 
Sbjct: 86  QPLYGKLSDITGRKFALLTALSFFGLGCFLTSLSTNIKQFAIA 128

>KAFR0B03940 Chr2 complement(820954..822597) [1644 bp, 547 aa] {ON}
           Anc_8.843 YMR279C
          Length = 547

 Score = 35.0 bits (79), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 281 DVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWE 340
           +++  K+D+IG LL     G IL+ F         W  A+IIV  ++     L  F ++E
Sbjct: 264 NIYNLKMDWIGSLL--GVIGLILMNFVWNQAPISGWSKAYIIVILIVA-VFFLVAFFIYE 320

Query: 341 IKFSKVPLTPWALIKDRGI 359
           +K ++ PL P  + K+R I
Sbjct: 321 LKKAESPLLPPEVTKNRHI 339

>YCL069W Chr3 (9706..11082) [1377 bp, 458 aa] {ON}  VBA3Permease of
           basic amino acids in the vacuolar membrane
          Length = 458

 Score = 34.7 bits (78), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 70/308 (22%), Positives = 121/308 (39%), Gaps = 40/308 (12%)

Query: 218 VSGAVGQHWKWGIGMWAFIVPLSAIPLGCCLLHMRWLAHK--------NAKDRLKS---- 265
           + GA   H  W    W F + L   P+G   + M  L +K          KD + +    
Sbjct: 56  IGGAFTTHVTW---RWCFYINL---PIGGLAIIMFLLTYKAENKGILQQIKDAIGTISSF 109

Query: 266 EFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPE 325
            F  +R    F  +++  ++K DF G  L  A     L+  T  GG +  W +  +I   
Sbjct: 110 TFSKFRHQVNFKRLMNGIIFKFDFFGFALCSAGLVLFLLGLTF-GGNKYSWNSGQVIAYL 168

Query: 326 VIGWCVALPIF-LLWEI----KFSKVP--LTPWALIKDRGIFFALVIAFHINFIWYM--- 375
           V+G  V L IF L+++     KF+  P  ++   L+  R +    +I   IN + ++   
Sbjct: 169 VLG--VLLFIFSLVYDFFLFDKFNPEPDNISYRPLLLRRLVAKPAIII--INMVTFLLCT 224

Query: 376 --QGDYMYTVL---IVSVNESIKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFG 430
              G  +Y+V    ++  + + K+   +  +    +VI     G++  K+   KP +IFG
Sbjct: 225 GYNGQMIYSVQFFQLIFASSAWKAGLHLIPIV-ITNVIAAIASGVITKKLGLVKPLLIFG 283

Query: 431 VSCWFIAFGLLVHYRXXXXXXXXXXXXLCLLGFGAGFFTYTTQASIQASVKYHSKMAVIT 490
                I  GL+                L L GF  GF    +  S Q  +      A + 
Sbjct: 284 GVLGVIGAGLMT-LMTNTSTKSTQIGVLLLPGFSLGFALQASLMSAQLQITKDRPEAAMD 342

Query: 491 ALYLAMYN 498
            + +  +N
Sbjct: 343 FIEVTAFN 350

>KAFR0B03930 Chr2 complement(816351..818018) [1668 bp, 555 aa] {ON} 
          Length = 555

 Score = 34.7 bits (78), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 43/88 (48%), Gaps = 3/88 (3%)

Query: 280 VDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLW 339
           V+V  + +D+ G ++     G IL  F         W+ A+IIV  +    + + +F ++
Sbjct: 271 VNVHGFSMDWTGSVV--GVIGLILFNFVWNEAPIVGWEKAYIIVLLIFSLLI-IVVFFIY 327

Query: 340 EIKFSKVPLTPWALIKDRGIFFALVIAF 367
           EIKF+K PL P A+  +  I   L   F
Sbjct: 328 EIKFAKSPLLPQAVTHNHNIIMILSAMF 355

>SAKL0C02178g Chr3 complement(191542..193239) [1698 bp, 565 aa] {ON}
           weakly similar to uniprot|Q04301 Saccharomyces
           cerevisiae YMR088C VBA1 Permease of basic amino acids in
           the vacuolar membrane
          Length = 565

 Score = 34.7 bits (78), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 62/260 (23%), Positives = 101/260 (38%), Gaps = 18/260 (6%)

Query: 55  DAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSX 114
           D G  +   ++E   + +   +L  +L + ++   LD ++  T      S     S +S 
Sbjct: 23  DTGEESTTSHSELPPTKVRITVL--ALLMGSFLSALDTTIVATLLPTIASDLDASSQMSW 80

Query: 115 XXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQ--ATNVTRFAVGSCF 172
                       Q  Y + SDIFGR  +LI+  + +A+G  I       NV   + G   
Sbjct: 81  IATAYLLSCSAFQPLYGKLSDIFGRKILLILSNLTFALGCAICGSPWTNNVWVLSTGRFV 140

Query: 173 YQLGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIG- 231
             +G  G      +   D   L  R     +  + F +    SG+V GAV Q    GIG 
Sbjct: 141 AGIGGGGQATLSTITTSDIIPLRKRGVYQGLVNICFSLGC-ASGSVLGAVLQQ---GIGW 196

Query: 232 MWAFIVPLSAIPLGCCLLHMRWL---AHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLD 288
            WAF+V +  + L C L+    L   A    +  L  E +  + + W      V     D
Sbjct: 197 RWAFLVQV-PMALVCALMIAVVLDLPADSPGRGLLWLELKRGKRLKWCTVTEMV-----D 250

Query: 289 FIGLLLLCATFGCILVPFTL 308
           F+G   L A+   ++   +L
Sbjct: 251 FVGSFTLIASMILLMTAISL 270

>CAGL0B02079g Chr2 complement(191736..193610) [1875 bp, 624 aa] {ON}
           similar to uniprot|P50080 Saccharomyces cerevisiae
           YGR224w AZR1 or uniprot|P36172 Saccharomyces cerevisiae
           YKR105c
          Length = 624

 Score = 34.3 bits (77), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 73/357 (20%), Positives = 133/357 (37%), Gaps = 51/357 (14%)

Query: 128 ICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELI 187
           + + R + + G  T  +  +V + VG+++ + A ++     G     +G +GV   + +I
Sbjct: 96  LIWGRIATLVGFKTSTLAAIVIFEVGSLVSALANSMDMLIGGRVIAGIGGSGVQSLVFVI 155

Query: 188 AMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGCC 247
           +        R     V +  F I + +   + GA   H  W    W F + L   P+G  
Sbjct: 156 SSTLVEERNRGLIIAVMSSSFGIASVVGPFLGGAFTTHVTW---RWCFYINL---PVGGL 209

Query: 248 LLHM--------RWLAHKN-AKDRLKSEFR-----------------------TYRDMGW 275
              +        +W+ +K+ A+D +    R                         R  G 
Sbjct: 210 AFFLFLTFYNPEKWVVNKDTAEDEVVGNGRLGLLSILGGQAVRFVKSVGVQLAKLRYPGT 269

Query: 276 FAYIVDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPI 335
           +  I     ++ D +  + +      IL+ FT  GG + KW +   I   V+G    L  
Sbjct: 270 WRIIARELFYRFDIVEFVFMTLGSVLILLAFTF-GGNKYKWNSGSTISMFVLGILFTLGA 328

Query: 336 FL---LWEIKFSKV-------PLTPWALIKDRGIFFALVIAFHINFIWYMQGDYMYTVLI 385
           F+       KF  V       PL  W + K  G++   +  F +   + +Q +Y+     
Sbjct: 329 FVYDFFIYPKFEAVKTVPHYQPLMSWNICKKPGVWLFNIAVFFVACAFSIQTNYIIQYFQ 388

Query: 386 VSVNESI-KSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLL 441
           +  N++  K+A  + +    V +   +  G+V  K    KP  IF      I  GLL
Sbjct: 389 LVFNDTAWKAAIHLIATVVPVVITVVS-SGIVNSKTGYVKPIAIFSGVTGIIGAGLL 444

>NDAI0H02200 Chr8 complement(536385..538100) [1716 bp, 571 aa] {ON} 
           YGR224W
          Length = 571

 Score = 34.3 bits (77), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 23/121 (19%), Positives = 52/121 (42%)

Query: 60  NIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXXX 119
           ++E    +++  + +V +  SL+L ++   LD ++      +    +++           
Sbjct: 28  SLEKKYHEHNLSLPKVPILSSLWLGSFFSSLDSTIVANIMNRVAEEFAESDKKQWIATSF 87

Query: 120 XXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTG 179
                  Q  Y + SDI GR   ++    F+ +G ++   A NVT+F++      +G  G
Sbjct: 88  LLTNTAFQPLYGKLSDITGRKFAVLTAHFFFGLGCLLTCFAQNVTQFSIARAICGMGAGG 147

Query: 180 V 180
           +
Sbjct: 148 I 148

>KLTH0B10142g Chr2 complement(847376..849082) [1707 bp, 568 aa] {ON}
           similar to uniprot|P36172 Saccharomyces cerevisiae
           YKR105C Hypothetical ORF
          Length = 568

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 64/350 (18%), Positives = 134/350 (38%), Gaps = 62/350 (17%)

Query: 127 QICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLEL 186
            + +AR S + G    ++  ++ +  G++I + A ++     G     +G +G+     +
Sbjct: 96  SLLWARLSAVLGPRISVVSCIILFEAGSLISALANSMNMLIAGRVVAGIGGSGLQTLSLV 155

Query: 187 IAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGC 246
           I     +   R     +    F + + +   + GA   H  W    W F + L   P+G 
Sbjct: 156 IGCQLVDEKSRPLVLSLLNCTFAVASIVGPFLGGAFTTHVTW---RWCFYINL---PIGG 209

Query: 247 CLLHMRWLAHKNAKDRLKSEF-RTYRDMGWF-------AYIVDVFLWKLDFIGLLLLCAT 298
             + +    +      L  +F  T++ +  F         ++   L+  D +  +   A 
Sbjct: 210 LAIAIFVFFYNPEGVNLLEKFGNTFKKVSSFHPVKKSPKKVLQQLLFGFDILSFISFTAG 269

Query: 299 FGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIK-FSKV-------PLTP 350
           +   L+  T  GG    W +  +I   +IG  + + I L+++ K F ++       PL  
Sbjct: 270 WLLFLLALTF-GGQTHAWNSGIVISFIIIG-VLLIAISLVYDFKVFEQIKTQDSFRPLLS 327

Query: 351 WALIKDRGIF------FALVIAFHINFIWYMQ-------------GDYMYTVLIVSVNES 391
           W ++ +R I       F   +A+++  I+ +Q             G ++  +L+ +V  S
Sbjct: 328 WEIMSNRSILLSNFTGFFSTVAYNVQMIYSVQFFQLVYGFSAWKAGLHLIPILVSTVVFS 387

Query: 392 IKSATRITSLYSFVSVITGTLLGLVIIKVRRTKPFIIFGVSCWFIAFGLL 441
           I S                   G++  K    KP ++FG +   +  GL+
Sbjct: 388 IAS-------------------GILTKKTGHIKPLLVFGSAMGVLGGGLM 418

>NCAS0F03100 Chr6 complement(618654..620366) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 33.5 bits (75), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 43/191 (22%), Positives = 80/191 (41%), Gaps = 19/191 (9%)

Query: 14  NETVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYHKDAGVNN--IEVYAEQYSS- 70
            +T ++++T  +S   +     SN+ + +     + D+   DA VN   +E+     S+ 
Sbjct: 6   EQTPIEQETPIESATHSVISTPSNKAERDDEKYGSDDI---DAEVNPEVVEIPKRPASAY 62

Query: 71  ---PIYRVMLFFSLFLVAYAYG-LDGSV-------RYTYQAQATSSYSQHSLLSXXXXXX 119
               I  +M+ F  F+  +  G + G V       R+  +    + Y     +       
Sbjct: 63  VTVSIMCIMIAFGGFVFGWDTGTISGFVAQTDFLRRFGQKHHNGTHYLSKVRMGLMVSIF 122

Query: 120 XXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNV-TRFAVGSCFYQLGYT 178
                 G I  A++ DI+GR   LII +  Y VG +I+  +     ++ +G     LG  
Sbjct: 123 NIGCAFGGIILAKSGDIYGRKMGLIIVVCIYIVGIVIQIASVKAWYQYFIGRIISGLGVG 182

Query: 179 GV-ILSLELIA 188
           G+ +LS  LI+
Sbjct: 183 GIAVLSPMLIS 193

>TDEL0B00550 Chr2 (105483..107096) [1614 bp, 537 aa] {ON} Anc_8.843
           YMR279C
          Length = 537

 Score = 33.5 bits (75), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 3/84 (3%)

Query: 280 VDVFLWKLDFIGLLLLCATFGCILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLW 339
           V+V  + +D+IG  L     G +L  F         W T +II   ++     + +F ++
Sbjct: 253 VNVNKFAMDWIGSAL--GVSGLVLFNFVWNQSTVVGWATGYIIALLIVS-IFLIALFFIF 309

Query: 340 EIKFSKVPLTPWALIKDRGIFFAL 363
           EIK++KVPL P  + + R I   L
Sbjct: 310 EIKYAKVPLLPKEVTESRSIIMIL 333

>SAKL0E04246g Chr5 (336416..338113) [1698 bp, 565 aa] {ON} weakly
           similar to uniprot|Q04301 Saccharomyces cerevisiae
           YMR088C VBA1 Permease of basic amino acids in the
           vacuolar membrane
          Length = 565

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 52/204 (25%), Positives = 85/204 (41%), Gaps = 16/204 (7%)

Query: 44  PDLKNYDLYHKDAGVNNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQAT 103
           P++  +D  + DA  N+  V  E  +      ++  +LFL ++   LD ++  T      
Sbjct: 17  PEIPTFDSSY-DAAANH-SVLTETKTR-----IIVIALFLGSFLSALDTTIVSTLLPTIA 69

Query: 104 SSYSQHSLLSXXXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTII--ESQAT 161
           S     S +S             Q  Y + SDIFGR  +L+   + +A+G  +      T
Sbjct: 70  SDLDASSQMSWIATSYLLSCSAFQPLYGKLSDIFGRKILLVWSNLVFAIGCALCGSPWTT 129

Query: 162 NVTRFAVGSCFYQLGYTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGA 221
           N+   + G     +G  G+     +   D   L  R     +  + F +    SG+V GA
Sbjct: 130 NIWILSAGRFIAGIGGGGLTTLSTITTSDIIPLRKRGVYQGLGNICFSLGC-ASGSVLGA 188

Query: 222 VGQHWKWGIG-MWAFI--VPLSAI 242
           V Q    GIG  WAF+  VP++ I
Sbjct: 189 VLQQ---GIGWRWAFLIQVPIALI 209

>Kwal_26.6686 s26 complement(23884..25593) [1710 bp, 569 aa] {ON}
           YIL171W (HXT12) - hexose permease [contig 381] FULL
          Length = 569

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 36/65 (55%), Gaps = 2/65 (3%)

Query: 126 GQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNV-TRFAVGSCFYQLGYTGV-ILS 183
           G +   +  DI+GR   L+I +V Y VGTII+  A +   ++ +G   Y  G  GV +L+
Sbjct: 131 GGLTLPKLGDIYGRRLGLMIVIVLYVVGTIIQISAQDKWYQYFIGKIIYGWGVGGVSVLA 190

Query: 184 LELIA 188
             LI+
Sbjct: 191 PMLIS 195

>Suva_15.291 Chr15 complement(497138..498916) [1779 bp, 592 aa] {ON}
           YHR094C (REAL)
          Length = 592

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 46/197 (23%), Positives = 77/197 (39%), Gaps = 32/197 (16%)

Query: 23  TEDSNQFNSSQLDSNQP-----DSNQPDLKNYDLYHKDAGVNNIEVYA------EQYSSP 71
           + +SN +N    +S  P     + + P +K    Y    G    E+         Q  + 
Sbjct: 19  STNSNSYNEKSGNSTAPGAARYNDDSPQVKPVSSYSSHGGPPKDELEELQREADNQLETK 78

Query: 72  IYRVMLFFSLFLVAYAYG----------LDGSVRYT--------YQAQATSSYSQHSLLS 113
               +LF S+  +  A+G          + G VR T         +A  TS Y  +    
Sbjct: 79  SKSDLLFVSICCLMVAFGGFVFGWDTGTISGFVRQTDYIRRFGTTRANGTS-YLSNVRTG 137

Query: 114 XXXXXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNV-TRFAVGSCF 172
                       G I  +R  D++GR   L+I +V Y+VG II+  + +   ++ +G   
Sbjct: 138 LLVSIFNIGCAIGGIVLSRLGDMYGRKIGLVIVVVIYSVGIIIQIASIDKWYQYFIGRII 197

Query: 173 YQLGYTGV-ILSLELIA 188
             LG  G+ +LS  LI+
Sbjct: 198 SGLGVGGITVLSPMLIS 214

>SAKL0D01386g Chr4 (109619..111184) [1566 bp, 521 aa] {ON}
           uniprot|Q875S7 Saccharomyces kluyveri ATR1
          Length = 521

 Score = 33.1 bits (74), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 54/247 (21%), Positives = 96/247 (38%), Gaps = 41/247 (16%)

Query: 131 ARASDIFGRMTILIIGLVFYAVGTII---ESQATNVTRFAVGSCFYQLGYT-------GV 180
            +  DI+G    L++G V   + ++I    S  ++V  F +   F  LG         G+
Sbjct: 111 GKIGDIYGLKKTLLVGYVVTIIWSLICGLTSYTSSVEFFIISRAFQGLGIAFILPNIMGI 170

Query: 181 ILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSGAVGQHWKWGIGMWAFIVPLS 240
           + ++ +      N+   L  +  P +   +    SG + G + + W W    +A+ +  +
Sbjct: 171 VGNIYVAGTTRKNMVISLIGACAP-IGATMGVLFSGLI-GTLSERWAWT--FYAYTIT-A 225

Query: 241 AIPLGCCLLHMRWLAHKNAKDRLKSEFRTYRDMGWFAYIVDVFLWKLDFIGLLLLCATFG 300
           AI +G  +    W+        ++        M W              IGLL      G
Sbjct: 226 AINMGLSI----WVIPNTIPTNVRGS-----SMDWIG----------SGIGLL------G 260

Query: 301 CILVPFTLAGGLQDKWKTAHIIVPEVIGWCVALPIFLLWEIKFSKVPLTPWALIKDRGIF 360
            IL  F    G    W TA+IIV  ++    A+  F L+E K++  PL P   + +  + 
Sbjct: 261 MILFNFVWNQGPIVGWDTAYIIVLLIVS-VAAIVAFFLYETKYANDPLIPRPAMHNHRLL 319

Query: 361 FALVIAF 367
             L+  F
Sbjct: 320 MTLLAVF 326

>Kwal_26.6669 s26 complement(14202..15974) [1773 bp, 590 aa] {ON}
           YBR293W - Hypothetical ORF [contig 294] FULL
          Length = 590

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 50/234 (21%), Positives = 88/234 (37%), Gaps = 14/234 (5%)

Query: 7   SKFDGKI-NE-TVLQEQTTEDSNQFNSSQLDSNQPDSNQPDLKNYDLYH------KDAGV 58
           S F  +I NE T L ++T ED    +S  L+S+   +     + + LYH      ++   
Sbjct: 4   SSFMNRIPNERTHLLDRTLEDGIG-DSDMLNSDLKSTKIKHTQRHQLYHSNLDKARNGND 62

Query: 59  NNIEVYAEQYSSPIYR--VMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXX 116
           +  +  +   S  + R   M+  S+FL  +   LD ++  T      S  +    +S   
Sbjct: 63  SATDFSSNNLSDLMSRRIFMISASMFLGIFLAALDNTIVSTLLPHIGSELNDMPNVSLVA 122

Query: 117 XXXXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLG 176
                     Q  + + SD+FGR  +LI   + +  G +    +  +    +G     +G
Sbjct: 123 TSYVFSCAIFQPLFGKTSDVFGRKPLLISSNLLFFAGCLTCGLSKTIWWLILGRLVTGIG 182

Query: 177 YTGVILSLELIAMDFSNLNWRLFASFVPALPFIINTWISGNVSG---AVGQHWK 227
             G+     +I  D   L  R        L + + T   G V G     G  W+
Sbjct: 183 GGGLTSMCTIIINDIVPLRNRAVYQGFGNLFYALGTACGGLVGGLFSEYGNGWR 236

>AFR343C Chr6 complement(1060723..1062438) [1716 bp, 571 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL103W
           (ITR2) and YDR497C (ITR1)
          Length = 571

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 44/184 (23%), Positives = 75/184 (40%), Gaps = 31/184 (16%)

Query: 75  VMLFFSLFLVAYAYGLD-GSVRYTYQAQATS-----SYSQHSLLSXXXXXXXXXXXXGQ- 127
           VML F   L  + +G D G +    Q+  T      +Y     ++            G  
Sbjct: 67  VMLTFVASLSGFLFGYDTGYISSALQSVGTDLGHQLTYRDKEYITSATSLGALIAALGAG 126

Query: 128 ICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCF--YQLGYTGVILSLE 185
           IC    +D+FGR   ++   + + VGT+++  A N  +  VG     + +G+  +I  L 
Sbjct: 127 IC----ADLFGRRKCIMFSNILFVVGTVLQVAAFNFWQMVVGRLVMGFGIGFGSLISPLF 182

Query: 186 LIAMDFSNLNWRLFASFVPALPFIINT-WISGN-----VSGAVGQHWKWGIGMWAFIVPL 239
           +  +    +  RL          +IN+ W++G        GA  QH K G   W  +V +
Sbjct: 183 ISEIAPKMIRGRL---------TVINSLWLTGGQLIAYACGAGFQHVKHG---WRILVGI 230

Query: 240 SAIP 243
           S +P
Sbjct: 231 SMLP 234

>YDL245C Chr4 complement(11657..13360) [1704 bp, 567 aa] {ON}
           HXT15Protein of unknown function with similarity to
           hexose transporter family members, expression is induced
           by low levels of glucose and repressed by high levels of
           glucose
          Length = 567

 Score = 32.7 bits (73), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 126 GQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNV-TRFAVGSCFYQLGYTGVILSL 184
           G + +AR +D  GR   ++I ++ Y VG II+  + +   ++ VG   Y LG  G  +  
Sbjct: 125 GGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLC 184

Query: 185 ELIAMDFSNLNWR 197
            ++  + +  + R
Sbjct: 185 PMLLSEIAPTDLR 197

>YJR158W Chr10 (732440..734143) [1704 bp, 567 aa] {ON}  HXT16Protein
           of unknown function with similarity to hexose
           transporter family members, expression is repressed by
           high levels of glucose
          Length = 567

 Score = 32.7 bits (73), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 126 GQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNV-TRFAVGSCFYQLGYTGVILSL 184
           G + +AR +D  GR   ++I ++ Y VG II+  + +   ++ VG   Y LG  G  +  
Sbjct: 125 GGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLC 184

Query: 185 ELIAMDFSNLNWR 197
            ++  + +  + R
Sbjct: 185 PMLLSEIAPTDLR 197

>Skud_4.5 Chr4 complement(9302..11023) [1722 bp, 573 aa] {ON}
           YJR158W (REAL)
          Length = 573

 Score = 32.7 bits (73), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 126 GQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNV-TRFAVGSCFYQLGYTG 179
           G + +AR +D  GR   ++I ++ Y VG II+  + +   ++ VG   Y LG  G
Sbjct: 122 GGVAFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGG 176

>Kpol_1039.19 s1039 (63222..64943) [1722 bp, 573 aa] {ON}
           (63222..64943) [1722 nt, 574 aa]
          Length = 573

 Score = 32.7 bits (73), Expect = 3.5,   Method: Compositional matrix adjust.
 Identities = 28/117 (23%), Positives = 47/117 (40%), Gaps = 9/117 (7%)

Query: 134 SDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIAMDFSN 193
           +DI+GR  +++ G++ Y V +I  + A +        C    G + +I        DF+ 
Sbjct: 162 ADIYGRRPVILFGMLVYIVASIALACANSYGVIIFLRCLQSCGISPIIAISSGCVGDFTM 221

Query: 194 LNWRLFASFVPALP--FIINTWISGNVSGAVGQHWKWGIGMWAFIVPLSAIPLGCCL 248
              R   +FV A+    ++       +  A+   W W    W       AI  GCCL
Sbjct: 222 KAER--GTFVGAVSGLVLLGQAFGSLIGAALAAAWDWRAIFWFL-----AIGAGCCL 271

>ZYRO0G03234g Chr7 (247798..249486) [1689 bp, 562 aa] {ON} similar
           to uniprot|Q04301 Saccharomyces cerevisiae YMR088C VBA1
           Permease of basic amino acids in the vacuolar membrane
          Length = 562

 Score = 32.3 bits (72), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 22/111 (19%), Positives = 47/111 (42%)

Query: 59  NNIEVYAEQYSSPIYRVMLFFSLFLVAYAYGLDGSVRYTYQAQATSSYSQHSLLSXXXXX 118
            ++E    +Y+  + ++ +  SL+L ++   LDG++      +    + +          
Sbjct: 17  ESLEAEYHRYNLSLPKLPILTSLWLGSFIGSLDGTIVANIMNRVAEEFEESDKKQWIATS 76

Query: 119 XXXXXXXGQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVG 169
                   Q  Y + SDI GR   L+    F+ +G ++   A +V +FA+ 
Sbjct: 77  FLLTNTAFQPLYGKLSDITGRRFALLTAHFFFGLGCLLTCFAQSVEQFALA 127

>Kwal_56.22285 s56 (26966..28669) [1704 bp, 567 aa] {ON} YNR072W
           (HXT17) - Putative hexose transporter [contig 187] FULL
          Length = 567

 Score = 32.0 bits (71), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 22/66 (33%), Positives = 37/66 (56%), Gaps = 2/66 (3%)

Query: 126 GQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNV-TRFAVGSCFYQLGYTGV-ILS 183
           G +  ++  DIFGR   L+  +  Y VGTII+  A++   ++ +G   Y  G  GV +L+
Sbjct: 128 GGLTLSKLGDIFGRRLALMFVVGVYVVGTIIQISASDKWYQYFIGKIIYGWGVGGVSVLA 187

Query: 184 LELIAM 189
             LI++
Sbjct: 188 PMLISL 193

>YNR072W Chr14 (772657..774351) [1695 bp, 564 aa] {ON}  HXT17Hexose
           transporter, up-regulated in media containing raffinose
           and galactose at pH 7.7 versus pH 4.7, repressed by high
           levels of glucose
          Length = 564

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 19/73 (26%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 126 GQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNV-TRFAVGSCFYQLGYTGVILSL 184
           G + +AR +D  GR   ++I ++ Y VG II+  + +   ++ VG   Y LG  G  +  
Sbjct: 122 GGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGGCSVLC 181

Query: 185 ELIAMDFSNLNWR 197
            ++  + +  + R
Sbjct: 182 PMLLSEIAPTDLR 194

>Skud_14.406 Chr14 (740510..742204) [1695 bp, 564 aa] {ON} YNR072W
           (REAL)
          Length = 564

 Score = 32.0 bits (71), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 19/55 (34%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 126 GQICYARASDIFGRMTILIIGLVFYAVGTIIE-SQATNVTRFAVGSCFYQLGYTG 179
           G + +AR +D  GR   ++I ++ Y VG II+ S +    ++ VG   Y LG  G
Sbjct: 122 GGLIFARFADKLGRRLAIVIVVLVYMVGAIIQISSSHKWYQYFVGKIIYGLGAGG 176

>YEL069C Chr5 complement(21537..23231) [1695 bp, 564 aa] {ON}
           HXT13Hexose transporter, induced in the presence of
           non-fermentable carbon sources, induced by low levels of
           glucose, repressed by high levels of glucose
          Length = 564

 Score = 32.0 bits (71), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 126 GQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNV-TRFAVGSCFYQLGYTG 179
           G + +AR +D  GR   ++I ++ Y VG II+  + +   ++ VG   Y LG  G
Sbjct: 122 GGLIFARLADTLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGG 176

>ZYRO0G00286g Chr7 (18542..20311) [1770 bp, 589 aa] {ON} highly
           similar to uniprot|P39003 Saccharomyces cerevisiae
           YDR343C HXT6 High-affinity glucose transporter of the
           major facilitator superfamily nearly identical to Hxt7p
           expressed at high basal levels relative to other HXTs
           repression of expression by high glucose requires SNF3
          Length = 589

 Score = 31.6 bits (70), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 39/159 (24%), Positives = 59/159 (37%), Gaps = 29/159 (18%)

Query: 19  QEQTTEDSNQFNSSQLDSNQPDSNQP-DLKNYDLYHKDAGVNNIEVYAEQYSSP------ 71
           +E T  DS    +  L  N+ D  QP +  NYD      G N I+      + P      
Sbjct: 29  RESTASDS--LENRSLSKNEKDDLQPVEGMNYD------GHNGIQEEENDVALPKKPLSD 80

Query: 72  -----IYRVMLFFSLFLVAYAYG-LDGSVRYT----YQAQATSSYSQHSLLSXXXXXXXX 121
                I+ V++ F  F+  +  G + G V  T       Q      +H L          
Sbjct: 81  YLSVFIFCVLIAFGGFVFGWDTGTISGFVNQTDFIERFGQLNHRTGEHYLSKVRTGLIVS 140

Query: 122 XX----XXGQICYARASDIFGRMTILIIGLVFYAVGTII 156
                   G +   + +D++GR   + I  VFY VGT+I
Sbjct: 141 LFNIGCAFGGLILTKPADVYGRKLAVTIAAVFYVVGTVI 179

>CAGL0J09944g Chr10 (976274..978052) [1779 bp, 592 aa] {ON} similar
           to uniprot|P53943 Saccharomyces cerevisiae YNL065w
          Length = 592

 Score = 31.6 bits (70), Expect = 6.3,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 47/107 (43%), Gaps = 4/107 (3%)

Query: 129 CYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCFYQLGYTGVILSLELIA 188
           C    +D FGR  +L+IG++ Y V +I  + A +        C   +G +  I     + 
Sbjct: 154 CSGGLADKFGRRPVLLIGMLIYVVASIGLACAPSYGVIVFLRCVQSIGISPSIAISSGVV 213

Query: 189 MDFSNLNWRLFASFVPALP-FIINTWISGNVSG-AVGQHWKWGIGMW 233
            DF+  + R   +FV A   F++     G++ G A+   W W    W
Sbjct: 214 GDFTVKSER--GTFVGATSGFVLLGQAFGSLIGAALAAAWDWRAIFW 258

>KAFR0F04080 Chr6 complement(795772..797421) [1650 bp, 549 aa] {ON} 
          Length = 549

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 126 GQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNV-TRFAVGSCFYQLGYTGVILSL 184
           G I +++  D +GR   L+I  + Y VG +I   A +   ++A+G  F  LG  G+ +  
Sbjct: 119 GGILFSKLGDTYGRRIALVIVTLVYMVGIVICISANSKWYQYAIGRVFAGLGVGGIAVYS 178

Query: 185 ELIAMDFSNLNWR 197
            L+  + S  + R
Sbjct: 179 PLLISEASPKHLR 191

>KAFR0E02030 Chr5 (404370..406016) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score = 31.6 bits (70), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 126 GQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNV-TRFAVGSCFYQLGYTGVILSL 184
           G I +++  D +GR   L+I  + Y VG +I   A +   ++A+G  F  LG  G+ +  
Sbjct: 118 GGILFSKLGDTYGRRIALVIVTLVYMVGIVICISANSKWYQYAIGRVFAGLGVGGIAVYS 177

Query: 185 ELIAMDFSNLNWR 197
            L+  + S  + R
Sbjct: 178 PLLISEASPKHLR 190

>KAFR0F02800 Chr6 (556502..558157) [1656 bp, 551 aa] {ON} 
          Length = 551

 Score = 31.6 bits (70), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 21/73 (28%), Positives = 37/73 (50%), Gaps = 1/73 (1%)

Query: 126 GQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNV-TRFAVGSCFYQLGYTGVILSL 184
           G I +++  D +GR   L+I  + Y VG +I   A +   ++A+G  F  LG  G+ +  
Sbjct: 121 GGILFSKLGDTYGRRIALVIVTLVYMVGIVICISANSKWYQYAIGRVFAGLGVGGIAVYS 180

Query: 185 ELIAMDFSNLNWR 197
            L+  + S  + R
Sbjct: 181 PLLISEASPKHLR 193

>Smik_14.401 Chr14 (716260..718170) [1911 bp, 636 aa] {ON} YNR072W
           (REAL)
          Length = 636

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 126 GQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNV-TRFAVGSCFYQLGYTG 179
           G + +AR +D  GR   ++I ++ Y VG II+  + +   ++ VG   Y LG  G
Sbjct: 194 GGVSFARFADKLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGG 248

>Kwal_55.19582 s55 (35002..36705) [1704 bp, 567 aa] {ON} YNR072W
           (HXT17) - Putative hexose transporter [contig 159] FULL
          Length = 567

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 22/65 (33%), Positives = 36/65 (55%), Gaps = 2/65 (3%)

Query: 126 GQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNV-TRFAVGSCFYQLGYTGV-ILS 183
           G +  ++  DIFGR   L+  +  Y VGTII+  A++   ++ +G   Y  G  GV +L+
Sbjct: 128 GGLTLSKLGDIFGRRLALMFVVGVYVVGTIIQISASDKWYQYFIGKIIYGWGVGGVSVLA 187

Query: 184 LELIA 188
             LI+
Sbjct: 188 PMLIS 192

>Smik_5.19 Chr5 complement(25102..26805) [1704 bp, 567 aa] {ON}
           YEL069C (REAL)
          Length = 567

 Score = 31.6 bits (70), Expect = 7.8,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 30/55 (54%), Gaps = 1/55 (1%)

Query: 126 GQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNV-TRFAVGSCFYQLGYTG 179
           G + +AR +D  GR   ++I ++ Y VG II+  + +   ++ VG   Y LG  G
Sbjct: 125 GGVSFARFADKLGRRLAIVIVVLVYMVGAIIQISSNHKWYQYFVGKIIYGLGAGG 179

>AFL207C Chr6 complement(44349..45968) [1620 bp, 539 aa] {ON}
           Unclear if syntenic homolog of Saccharomyces cerevisiae
           YDR343C (HXT6), YDR342C (HXT7) and YHR092C (HXT4)
          Length = 539

 Score = 31.2 bits (69), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 35/65 (53%), Gaps = 2/65 (3%)

Query: 126 GQICYARASDIFGRMTILIIGLVFYAVGTIIE-SQATNVTRFAVGSCFYQLGYTGV-ILS 183
           G I  +R  D++GR   L+I  + Y VG II+ S  T   ++ +G     LG  G+ +LS
Sbjct: 108 GGIILSRLGDMYGRRIGLMIVSLIYVVGIIIQISSNTKWYQYCIGRVISGLGVGGIAVLS 167

Query: 184 LELIA 188
             LI+
Sbjct: 168 PMLIS 172

>ZYRO0C00374g Chr3 (23229..24923) [1695 bp, 564 aa] {ON} similar to
           uniprot|P30605 Saccharomyces cerevisiae YDR497C ITR1
          Length = 564

 Score = 31.2 bits (69), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 18/47 (38%), Positives = 23/47 (48%)

Query: 126 GQICYARASDIFGRMTILIIGLVFYAVGTIIESQATNVTRFAVGSCF 172
           G I     S++ GR T L+I   FY +G II + A NV     G  F
Sbjct: 147 GSILLTPFSEMLGRKTSLVISCGFYTMGAIICAAALNVQTMYAGRFF 193

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.326    0.139    0.437 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 59,060,263
Number of extensions: 2410251
Number of successful extensions: 10156
Number of sequences better than 10.0: 235
Number of HSP's gapped: 10149
Number of HSP's successfully gapped: 235
Length of query: 617
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 501
Effective length of database: 40,180,143
Effective search space: 20130251643
Effective search space used: 20130251643
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 69 (31.2 bits)