Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_358.3na 1ON57557526530.0
TPHA0M00130singletonON61156520590.0
SAKL0G14916gna 1ON58157119720.0
CAGL0A01199gna 1ON61356219570.0
YPL265W (DIP5)na 1ON60856319290.0
Smik_6.473na 1ON60656319180.0
Suva_16.40na 1ON60656319030.0
Skud_16.12na 1ON60756319010.0
TBLA0A07060na 1ON62552718920.0
NDAI0I02660na 1ON59456918790.0
KLTH0B01166gna 1ON57753518540.0
NCAS0D02260na 1ON59757018550.0
Kwal_33.15545na 1ON57657618370.0
KNAG0L02460singletonON58855918240.0
KAFR0B06430singletonON59358118240.0
KLLA0E16281gna 1ON60558717470.0
KNAG0L02470singletonON63855317330.0
Ecym_2480na 1ON58653717160.0
ACL135Wna 1ON58855816850.0
SAKL0C02662g1.83ON5485089381e-119
ZYRO0D17908gna 1ON5185189231e-117
Ecym_80357.44ON5635299241e-117
Kpol_2000.641.84ON6105239271e-117
Ecym_10871.83ON5705279201e-116
SAKL0C02640gsingletonON5485259081e-115
YNL268W (LYP1)1.84ON6115429121e-115
TDEL0A08030singletonON5145089011e-114
Skud_5.261.83ON5905139041e-114
YNL270C (ALP1)1.83ON5735449001e-113
Smik_14.671.83ON5735518991e-113
CAGL0J08184g1.83ON5725348981e-113
CAGL0J08162g1.84ON5974938991e-113
Suva_5.41.83ON5905198991e-113
KLTH0F02398g1.83ON5555438951e-113
TDEL0C061701.84ON5735128931e-112
Skud_14.711.84ON6124938951e-112
Skud_14.701.83ON5735358901e-112
YOR348C (PUT4)7.44ON6275318941e-112
Ecym_10881.84ON5675358891e-112
Suva_14.751.84ON6114938921e-112
Smik_5.241.83ON5905138891e-111
SAKL0C02684gsingletonON5885188881e-111
SAKL0B10956g7.44ON5725138861e-111
TBLA0A054601.84ON6085448891e-111
Smik_14.681.84ON6114938881e-111
NDAI0F041901.84ON5994938851e-111
Smik_15.5327.44ON6315388871e-111
KAFR0D039401.83ON5975218841e-111
YEL063C (CAN1)1.83ON5905138811e-110
Kwal_26.69407.44ON5705178771e-110
KNAG0F004801.84ON5975508781e-110
SAKL0C02728g1.84ON5625218731e-109
NDAI0A006101.83ON5655308731e-109
Kwal_23.4026singletonON5345268681e-109
TDEL0H040707.44ON5775548711e-109
TBLA0A054501.83ON6064938711e-109
Suva_8.4027.44ON6835348761e-108
TPHA0B044701.84ON5995278681e-108
KLLA0C02343g1.83ON5815178651e-108
CAGL0E05632g7.44ON5985298641e-108
KNAG0E003907.44ON5995208631e-107
KLTH0F02420g1.84ON6215218641e-107
ZYRO0F16632g1.84ON6075078621e-107
TDEL0C061801.83ON5835028561e-107
Kwal_33.134111.84ON5605208521e-106
NDAI0E038007.44ON6215318551e-106
KNAG0C05920singletonON5995118531e-106
TPHA0H028507.44ON6015208511e-106
NCAS0A006101.84ON6075538521e-106
TPHA0B044801.83ON6035008501e-105
NCAS0A006001.83ON5445298441e-105
KLLA0C02365g1.84ON5795478461e-105
ZYRO0F16654g1.83ON5805138411e-104
AFR156W7.44ON5585158381e-104
Kpol_2000.651.83ON5955218401e-104
Suva_14.731.83ON4974588311e-104
NDAI0F042001.83ON5665388361e-104
Skud_15.5157.44ON6265388401e-104
KAFR0D007001.83ON5745438341e-103
NCAS0E022607.44ON5935618331e-103
KLLA0F23419g7.44ON5735588311e-103
Kwal_33.134011.83ON5595188291e-103
Kpol_367.77.44ON5845198301e-103
AFR667C1.84ON5635468271e-103
SAKL0F09790gsingletonON5585138231e-102
KLTH0D01474g7.44ON6245038211e-101
NCAS0B085701.83ON5325158101e-100
KNAG0C007901.83ON5794938101e-100
AFR668W1.83ON5565257902e-97
Kwal_8.590na 2ON6295427893e-96
SAKL0F16544gsingletonON5675087756e-95
TBLA0C01240singletonON6294867649e-93
KLTH0F04048gsingletonON5835217461e-90
KLLA0B14685gna 3ON5715107424e-90
ZYRO0C18502g7.44ON5755147373e-89
KLTH0B00154gna 2ON5564867344e-89
Kwal_23.2817na 3ON5805297287e-88
Smik_6.482na 4ON5585317268e-88
KAFR0C051607.44ON5845707252e-87
TDEL0E05750singletonON5485367195e-87
CAGL0K05753g1.50ON6605377199e-86
Suva_13.517singletonON5475017119e-86
TDEL0D00200singletonON5675237032e-84
ZYRO0D03762g1.244ON6005447052e-84
NDAI0D021605.158ON5875436948e-83
Kpol_1010.325.158ON5995486949e-83
Ecym_60211.244ON6005396904e-82
SAKL0G14014g5.158ON6055676887e-82
KAFR0E018505.158ON5605046788e-81
Ecym_26643.285ON5755286781e-80
KAFR0C004003.284ON5825166791e-80
NDAI0B052201.244ON6115466811e-80
TDEL0C00930singletonON5955366791e-80
Skud_7.5255.158ON6035256792e-80
KLTH0A00308gsingletonON5415386707e-80
CAGL0B01012g1.50ON6235516741e-79
NCAS0A071105.158ON5925386712e-79
Skud_16.2na 4ON4965016642e-79
NCAS0D018705.158ON5955426712e-79
YBR068C (BAP2)3.284ON6095246704e-79
Suva_11.2731.244ON6014986678e-79
Kpol_2000.921.50ON6375516708e-79
Kwal_27.126811.244ON5934976669e-79
Skud_11.2751.244ON6025656661e-78
Suva_2.716singletonON6035306652e-78
KAFR0A011203.284ON5925516642e-78
KAFR0D04120na 5ON6485326682e-78
KNAG0C02140singletonON5984986642e-78
TPHA0A002405.158ON6035456642e-78
TPHA0E036601.50ON6475236655e-78
Skud_3.381.50ON6335386637e-78
Ecym_47895.158ON5885226581e-77
Smik_16.1155.158ON6035256582e-77
Smik_3.531.50ON6335316602e-77
Kpol_543.791.244ON6055296573e-77
YCL025C (AGP1)1.50ON6335226584e-77
SAKL0C01232gsingletonON6135306564e-77
Suva_7.4855.158ON6035296555e-77
Kpol_1052.143.285ON6025316555e-77
Suva_3.1891.50ON6335376566e-77
TPHA0A047005.158ON5695416511e-76
NDAI0C029505.158ON6095146531e-76
Smik_11.3021.244ON5535416482e-76
YGR191W (HIP1)5.158ON6035406512e-76
SAKL0D02926g3.285ON5835556492e-76
CAGL0B03773g5.158ON6055016503e-76
NCAS0B079001.244ON6195406513e-76
CAGL0H08393g3.284ON6125396503e-76
Suva_4.3073.284ON6095246494e-76
SAKL0D00836gna 6ON6014976494e-76
KNAG0H011503.284ON6175216495e-76
TPHA0B010901.244ON6064966486e-76
KAFR0D041401.50ON6375386481e-75
Skud_2.1923.285ON6195186452e-75
TBLA0B077605.158ON6585426472e-75
Skud_2.1913.284ON6095246434e-75
KLLA0A06886gsingletonON5875426414e-75
AGR040C3.285ON5735256388e-75
NDAI0A074903.284ON5965476398e-75
YKR039W (GAP1)1.244ON6025666391e-74
KAFR0D00510na 7ON6175026401e-74
Kpol_526.103.397ON5805376371e-74
AGR319W5.158ON6265176392e-74
SAKL0D04664g1.244ON5935366344e-74
NCAS0I015303.284ON5955326345e-74
NDAI0A006401.50ON6415376375e-74
Suva_2.6881.50ON6615296385e-74
KLTH0F01606gna 5ON6045256346e-74
KNAG0G009005.158ON6135196346e-74
Smik_2.2013.284ON6095366347e-74
Skud_2.2603.397ON5984986338e-74
KLLA0A11770g5.158ON5815426328e-74
YBR132C (AGP2)3.397ON5964986329e-74
KLTH0E15642g1.244ON5965336329e-74
KNAG0J022003.284ON6075556331e-73
YDR508C (GNP1)1.50ON6635446361e-73
Smik_2.2723.397ON5974986311e-73
Smik_2.2023.285ON6175276303e-73
NDAI0G060301.368ON5995486283e-73
Suva_4.3813.397ON5905066284e-73
KAFR0D005001.50ON6175036294e-73
KAFR0D00520na 5ON5985496274e-73
TBLA0I020103.285ON6285196295e-73
Kpol_1052.163.284ON6135186276e-73
NCAS0A106803.284ON5935356251e-72
KLTH0B02046g5.158ON5895386241e-72
Kwal_33.14276na 6ON5965016241e-72
ZYRO0F13838g8.342ON8365586371e-72
NCAS0B085801.50ON6275326261e-72
CAGL0L03267g1.244ON5975656196e-72
KNAG0F002701.50ON6345326227e-72
Kpol_2002.441.50ON6275456217e-72
Suva_2.2033.284ON6045406198e-72
SAKL0H15092g8.342ON8505556329e-72
KLLA0C01606g1.50ON6205586209e-72
Kwal_26.9612singletonON5435116159e-72
Kpol_1065.133.284ON5965446181e-71
KAFR0D04130na 7ON6445436211e-71
TDEL0C065101.50ON6425396141e-70
NDAI0F043901.50ON6675436151e-70
TPHA0M012003.284ON6075416111e-70
SAKL0C01650g1.50ON6135306111e-70
SAKL0D02970g3.284ON6015316092e-70
Kwal_27.105383.284ON6025306092e-70
AFR698C1.50ON6095026092e-70
Smik_4.2843.284ON6045246092e-70
NDAI0A056203.284ON5715386073e-70
Kwal_33.132041.50ON6075086093e-70
AGR039Cna 8ON5865236064e-70
KNAG0J022103.285ON5815196064e-70
KLLA0A06930g1.244ON5875706065e-70
AEL030W1.368ON5825546056e-70
Smik_4.7901.50ON6635346106e-70
NCAS0A089201.368ON5995586031e-69
ZYRO0C17182g3.397ON5785476012e-69
Skud_4.7841.50ON6635446062e-69
YBR069C (TAT1)3.285ON6195396032e-69
YDR046C (BAP3)3.284ON6045276023e-69
TPHA0B047501.50ON6395496033e-69
AFR230C1.244ON6045206014e-69
AAR038W3.397ON5664895984e-69
SAKL0C13992gsingletonON5525415974e-69
KLTH0F01584g1.50ON5965306005e-69
Kwal_33.154075.158ON5875425995e-69
Suva_4.3083.285ON6185265998e-69
TBLA0A051801.50ON6765456038e-69
TDEL0F02830na 9ON5615365951e-68
TBLA0C025203.397ON5805565961e-68
TBLA0C012101.368ON6005375961e-68
TDEL0C053403.397ON5755475942e-68
CAGL0L07546g3.284ON6344965972e-68
KLLA0F27093gsingletonON5635155923e-68
ZYRO0A00308gsingletonON5645125923e-68
Skud_4.3003.284ON6045105943e-68
KNAG0C005901.50ON6345325963e-68
TDEL0F046608.342ON8405966046e-68
ZYRO0F17446g1.50ON6335395947e-68
KLTH0C05170g3.284ON5985125919e-68
KLLA0C15873g3.397ON5685015881e-67
SAKL0D02948gna 8ON5945305882e-67
YFL055W (AGP3)na 10ON5585205852e-67
SAKL0B08734g3.397ON5584915836e-67
NCAS0I008503.397ON5845365846e-67
CAGL0C00539g3.397ON5935085847e-67
KLLA0A10813g1.368ON5845485839e-67
Kpol_543.78singletonON6055465841e-66
TPHA0A024503.397ON5834965821e-66
Suva_15.1481.368ON5925345812e-66
Smik_13.1singletonON5234975772e-66
YOL020W (TAT2)1.368ON5925285812e-66
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_358.3
         (575 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...  1026   0.0  
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     797   0.0  
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   764   0.0  
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   758   0.0  
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   747   0.0  
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   743   0.0  
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   737   0.0  
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   736   0.0  
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   733   0.0  
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   728   0.0  
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   718   0.0  
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              719   0.0  
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   712   0.0  
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             707   0.0  
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   707   0.0  
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   677   0.0  
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             672   0.0  
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   665   0.0  
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   653   0.0  
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   365   e-119
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   360   e-117
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   360   e-117
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   361   e-117
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   358   e-116
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   354   e-115
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   355   e-115
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            351   e-114
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   352   e-114
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   351   e-113
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   350   e-113
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   350   e-113
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   350   e-113
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   350   e-113
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   349   e-113
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   348   e-112
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   349   e-112
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   347   e-112
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   348   e-112
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   347   e-112
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   348   e-112
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   347   e-111
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   346   e-111
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   345   e-111
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   347   e-111
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   346   e-111
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   345   e-111
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   346   e-111
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   345   e-111
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   343   e-110
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   342   e-110
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                342   e-110
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   340   e-109
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   340   e-109
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   338   e-109
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   340   e-109
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   340   e-109
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   342   e-108
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   338   e-108
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   337   e-108
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   337   e-108
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   337   e-107
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   337   e-107
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   336   e-107
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   334   e-107
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   332   e-106
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     333   e-106
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            333   e-106
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   332   e-106
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              332   e-106
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   332   e-105
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   329   e-105
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   330   e-105
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   328   e-104
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   327   e-104
Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   328   e-104
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   324   e-104
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            326   e-104
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   328   e-104
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   325   e-103
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     325   e-103
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   324   e-103
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   323   e-103
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   324   e-103
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   323   e-103
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   321   e-102
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   320   e-101
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            316   e-100
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              316   e-100
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   308   2e-97
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   308   3e-96
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   303   6e-95
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   298   9e-93
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   291   1e-90
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   290   4e-90
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   288   3e-89
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   287   4e-89
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   285   7e-88
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   284   8e-88
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   283   2e-87
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            281   5e-87
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   281   9e-86
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   278   9e-86
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                275   2e-84
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   276   2e-84
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    271   8e-83
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   271   9e-83
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   270   4e-82
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   269   7e-82
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   265   8e-81
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   265   1e-80
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                266   1e-80
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   266   1e-80
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   266   1e-80
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   266   2e-80
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   262   7e-80
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   264   1e-79
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   263   2e-79
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   260   2e-79
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   263   2e-79
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   262   4e-79
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   261   8e-79
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   262   8e-79
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   261   9e-79
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   261   1e-78
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   260   2e-78
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   260   2e-78
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   261   2e-78
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   260   2e-78
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   260   2e-78
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   260   5e-78
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   259   7e-78
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   258   1e-77
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   258   2e-77
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   258   2e-77
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   257   3e-77
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   258   4e-77
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   257   4e-77
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   256   5e-77
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   256   5e-77
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   257   6e-77
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   255   1e-76
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    256   1e-76
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   254   2e-76
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   255   2e-76
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   254   2e-76
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   254   3e-76
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   255   3e-76
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   254   3e-76
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   254   4e-76
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   254   4e-76
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              254   5e-76
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   254   6e-76
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              254   1e-75
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   253   2e-75
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   253   2e-75
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   252   4e-75
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   251   4e-75
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   250   8e-75
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   250   8e-75
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   250   1e-74
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      251   1e-74
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   249   1e-74
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   250   2e-74
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   248   4e-74
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              248   5e-74
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   249   5e-74
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   250   5e-74
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   248   6e-74
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   248   6e-74
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   248   7e-74
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   248   8e-74
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   248   8e-74
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   248   9e-74
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   248   9e-74
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   248   1e-73
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   249   1e-73
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   247   1e-73
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   247   3e-73
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   246   3e-73
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   246   4e-73
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      246   4e-73
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   246   4e-73
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   246   5e-73
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   246   6e-73
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   245   1e-72
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   244   1e-72
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   244   1e-72
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   249   1e-72
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   245   1e-72
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   243   6e-72
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   244   7e-72
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   243   7e-72
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   243   8e-72
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   248   9e-72
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   243   9e-72
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   241   9e-72
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   242   1e-71
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              243   1e-71
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   241   1e-70
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   241   1e-70
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   239   1e-70
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   239   1e-70
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   239   2e-70
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   239   2e-70
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   239   2e-70
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   239   2e-70
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            238   3e-70
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   239   3e-70
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   238   4e-70
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   238   4e-70
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   238   5e-70
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   237   6e-70
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   239   6e-70
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   236   1e-69
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   236   2e-69
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   238   2e-69
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   236   2e-69
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   236   3e-69
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   236   3e-69
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   236   4e-69
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   234   4e-69
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   234   4e-69
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   235   5e-69
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   235   5e-69
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   235   8e-69
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   236   8e-69
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   233   1e-68
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   234   1e-68
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   234   1e-68
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   233   2e-68
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   234   2e-68
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   232   3e-68
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   232   3e-68
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   233   3e-68
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   234   3e-68
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   237   6e-68
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   233   7e-68
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   232   9e-68
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   231   1e-67
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   231   2e-67
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   229   2e-67
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   229   6e-67
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   229   6e-67
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   229   7e-67
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   229   9e-67
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   229   1e-66
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   228   1e-66
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   228   2e-66
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    226   2e-66
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   228   2e-66
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   228   2e-66
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   228   2e-66
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   227   3e-66
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   227   4e-66
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   227   4e-66
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   227   6e-66
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   228   8e-66
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   226   9e-66
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   226   1e-65
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   224   1e-65
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   225   1e-65
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   226   1e-65
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      224   3e-65
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      224   3e-65
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   224   4e-65
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   224   4e-65
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   223   7e-65
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   223   9e-65
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   223   1e-64
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   223   1e-64
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   224   2e-64
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              223   2e-64
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   222   4e-64
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   221   5e-64
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   218   6e-64
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   218   8e-64
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              223   1e-63
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   220   1e-63
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   225   1e-63
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   219   3e-63
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              218   3e-63
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   219   4e-63
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              218   4e-63
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...   223   6e-63
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   223   7e-63
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   223   9e-63
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   218   1e-62
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   218   1e-62
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   217   1e-62
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   222   1e-62
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   218   1e-62
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   216   2e-62
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   217   2e-62
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   216   3e-62
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   215   5e-62
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   220   6e-62
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    214   2e-61
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   218   4e-61
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   218   5e-61
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   213   5e-61
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                213   5e-61
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   216   2e-60
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   212   2e-60
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   211   9e-60
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   209   1e-59
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   209   1e-59
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   209   2e-59
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   209   2e-59
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   213   2e-59
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   213   3e-59
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              208   3e-59
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   211   1e-58
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   211   1e-58
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   211   1e-58
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   206   3e-58
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   205   7e-58
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   204   1e-57
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   201   2e-57
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   202   2e-57
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   204   3e-57
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              204   3e-57
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   202   5e-57
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                201   1e-56
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      199   1e-55
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   202   3e-55
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   197   5e-55
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   194   1e-53
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   197   1e-53
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   193   2e-53
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   192   3e-52
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   185   5e-51
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     179   2e-50
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     178   3e-50
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   182   1e-49
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   178   4e-48
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   170   1e-45
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   170   2e-45
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)         109   9e-27
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)    107   7e-25
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)     105   1e-24
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...    99   6e-23
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)         101   9e-23
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          83   7e-18
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      66   1e-12
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      51   6e-07
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    50   3e-06
NDAI0F04210 Chr6 (1018256..1018768) [513 bp, 170 aa] {ON}              45   1e-04
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    44   4e-04
TPHA0E03350 Chr5 (709592..711535) [1944 bp, 647 aa] {ON} Anc_1.1...    41   0.010
NCAS0B08350 Chr2 (1593557..1595395) [1839 bp, 612 aa] {ON} Anc_1...    40   0.011
Suva_11.49 Chr11 complement(105256..107115) [1860 bp, 619 aa] {O...    39   0.045
Skud_11.51 Chr11 complement(106683..108533) [1851 bp, 616 aa] {O...    38   0.084
TBLA0C05740 Chr3 complement(1391698..1393677) [1980 bp, 659 aa] ...    38   0.093
ZYRO0A08844g Chr1 (704383..705783) [1401 bp, 466 aa] {ON} highly...    37   0.096
YKL174C Chr11 complement(120380..122236) [1857 bp, 618 aa] {ON} ...    37   0.13 
CAGL0M08272g Chr13 complement(823019..824884) [1866 bp, 621 aa] ...    37   0.14 
SAKL0C05126g Chr3 complement(488745..490451) [1707 bp, 568 aa] {...    37   0.15 
NCAS0A04090 Chr1 (825742..827172) [1431 bp, 476 aa] {ON} Anc_2.407     37   0.18 
NDAI0E01810 Chr5 (359926..361353) [1428 bp, 475 aa] {ON} Anc_2.407     37   0.20 
NDAI0A00890 Chr1 complement(181903..183828) [1926 bp, 641 aa] {O...    36   0.22 
Smik_11.55 Chr11 complement(105857..107716) [1860 bp, 619 aa] {O...    36   0.27 
ZYRO0G18700g Chr7 (1542876..1544651) [1776 bp, 591 aa] {ON} simi...    36   0.36 
KLLA0A06666g Chr1 complement(603169..604851) [1683 bp, 560 aa] {...    35   0.44 
KAFR0F02620 Chr6 complement(511809..513215) [1407 bp, 468 aa] {O...    34   0.87 
Kwal_33.13806 s33 complement(401429..403078) [1650 bp, 549 aa] {...    34   0.96 
KAFR0G00390 Chr7 complement(115188..117011) [1824 bp, 607 aa] {O...    34   1.2  
TDEL0G02120 Chr7 complement(415216..416997) [1782 bp, 593 aa] {O...    34   1.4  
Ecym_8105 Chr8 (224611..226362) [1752 bp, 583 aa] {ON} similar t...    33   3.3  
SAKL0E04576g Chr5 complement(369959..371380) [1422 bp, 473 aa] {...    32   3.7  
TBLA0G00720 Chr7 complement(163147..164988) [1842 bp, 613 aa] {O...    32   4.0  
KLTH0F04576g Chr6 complement(404994..406643) [1650 bp, 549 aa] {...    32   5.0  
Kpol_1023.28 s1023 (59511..60923) [1413 bp, 470 aa] {ON} (59511....    31   8.0  

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score = 1026 bits (2653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 519/575 (90%), Positives = 519/575 (90%)

Query: 1   MSVYEVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHIS 60
           MSVYEVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHIS
Sbjct: 1   MSVYEVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHIS 60

Query: 61  MIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTS 120
           MIAI                    PASILIAYSFVGILVFFVMACLGEMATYIPLDGFTS
Sbjct: 61  MIAIGGSLGTGLLIGTGTALRTGGPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTS 120

Query: 121 YATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIV 180
           YATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIV
Sbjct: 121 YATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIV 180

Query: 181 IINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPY 240
           IINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPY
Sbjct: 181 IINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPY 240

Query: 241 SESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFY 300
           SESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFY
Sbjct: 241 SESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFY 300

Query: 301 IVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSA 360
           IVTIFLLGMCVAYNDPRLL            PFVVAIQNSGVRALPHIFNVCVLIFVFSA
Sbjct: 301 IVTIFLLGMCVAYNDPRLLAAAHASTSAAASPFVVAIQNSGVRALPHIFNVCVLIFVFSA 360

Query: 361 CNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIF 420
           CNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNA          AYMNVSSGSAQIF
Sbjct: 361 CNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNALFGCFLFCLLAYMNVSSGSAQIF 420

Query: 421 NYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLI 480
           NYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLI
Sbjct: 421 NYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLI 480

Query: 481 AFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAIDR 540
           AFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAIDR
Sbjct: 481 AFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAIDR 540

Query: 541 XXXXXXXXXXXXXXRLKNSKKSLKWFYEKYLGYIF 575
                         RLKNSKKSLKWFYEKYLGYIF
Sbjct: 541 EEAEGKIKEAEAKERLKNSKKSLKWFYEKYLGYIF 575

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  797 bits (2059), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 400/565 (70%), Positives = 448/565 (79%), Gaps = 8/565 (1%)

Query: 19  DLEKNTTSSLNSFEQEDDSN----KISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXX 74
           DLE N  +  N+ + +  ++     + DGK+DG RLKK+LKARHISMIAI          
Sbjct: 47  DLEVNDQTRQNTLDDDASADSDGYNVMDGKDDGTRLKKDLKARHISMIAIGGSLGTGLLI 106

Query: 75  XXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTSYATRYCDPALGFAV 134
                     PASILIAY+FVG LVFF MA LGEMA YIPLDGFTSYA+RYCDPALGFAV
Sbjct: 107 GTGTALRTAGPASILIAYTFVGTLVFFTMAALGEMAAYIPLDGFTSYASRYCDPALGFAV 166

Query: 135 GYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFE 194
           GY YLFKYFIITPNQLTA ALVIQYW+DR+TVNPGVWITIFLVVI+ INT+GV+YFGEFE
Sbjct: 167 GYSYLFKYFIITPNQLTAAALVIQYWVDRDTVNPGVWITIFLVVIIAINTIGVKYFGEFE 226

Query: 195 FWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSES---ITGSKGKF 251
           FWLSSFKIMVM GV++FLF+IMLGGGPNHDRLGFRYWK PGAFKPYS S   I GS GKF
Sbjct: 227 FWLSSFKIMVMIGVMIFLFVIMLGGGPNHDRLGFRYWKTPGAFKPYSSSVVNIEGSTGKF 286

Query: 252 VSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCV 311
           V+FV VFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLT++RI+ FY+ TIFLLGMCV
Sbjct: 287 VAFVNVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTVWRILFFYVATIFLLGMCV 346

Query: 312 AYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRS 371
           AY+DP LL            PFVVAIQNSGV  LPHIFNVCVL+FVFSACNSDLYVGTRS
Sbjct: 347 AYDDPLLLAAANAQTSAAASPFVVAIQNSGVDVLPHIFNVCVLMFVFSACNSDLYVGTRS 406

Query: 372 LYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFG 431
           LYSLA+DGKAPK+FAKTNRWGVPYNA          AYMNVSSGSA+IFNYFVNVVSIFG
Sbjct: 407 LYSLAVDGKAPKIFAKTNRWGVPYNAMGGCVLFCLLAYMNVSSGSAEIFNYFVNVVSIFG 466

Query: 432 ILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIG 491
           +LSW SILIT+I+F RA  AQ +DR++FAY APFQPYG+Y  LFFCVL+A IKNF+VF+G
Sbjct: 467 VLSWSSILITFIYFDRAVRAQGIDRSTFAYVAPFQPYGSYFALFFCVLLALIKNFSVFLG 526

Query: 492 -EFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAIDRXXXXXXXXXX 550
            EFDYK+FITGYIGLP+Y   + GYK+ YKTK VK  EADL S+K A+DR          
Sbjct: 527 NEFDYKTFITGYIGLPVYAFSFIGYKLYYKTKTVKPHEADLNSYKAAVDREEEEGKIKEA 586

Query: 551 XXXXRLKNSKKSLKWFYEKYLGYIF 575
               RLK+ KK L+WFYEKY+  IF
Sbjct: 587 ERKERLKHGKKDLEWFYEKYISSIF 611

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  764 bits (1972), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/571 (66%), Positives = 446/571 (78%), Gaps = 14/571 (2%)

Query: 19  DLEK-----NTTS----SLNSFEQEDDSNKIS----DGKEDGVRLKKELKARHISMIAIX 65
           DLEK     NTTS    +L+   Q+D S++ S    DGK DG+RLKKEL+ARH+SMIAI 
Sbjct: 11  DLEKIVSNSNTTSKDVENLDLSNQDDISSQESHLNIDGKHDGIRLKKELEARHVSMIAIG 70

Query: 66  XXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTSYATRY 125
                              P SILIAYSFVG LV+ VM CLGEMATYIPLDGFTSYA+RY
Sbjct: 71  GSLGTGLLIGTGTSLSLAGPVSILIAYSFVGFLVYIVMTCLGEMATYIPLDGFTSYASRY 130

Query: 126 CDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTV 185
           CDPALGFAVGY YLFKY IITPNQLTA ALV+QYW+ RE VNPGVWITIFLV+IV IN V
Sbjct: 131 CDPALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVNPGVWITIFLVIIVTINVV 190

Query: 186 GVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESIT 245
           GV++FGEFEFWLSSFK++VM  +I+ LF+IMLGGGP+HDRLGFR++K+PGAF+PYSE+I+
Sbjct: 191 GVKFFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLGFRFYKDPGAFRPYSEAIS 250

Query: 246 GSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIF 305
           GSKGKFVSFVAVFVYALFAYLG EL GIVAAE +NPRRN+PRAIKLT+YRI++FY+VTIF
Sbjct: 251 GSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPRAIKLTLYRIVVFYLVTIF 310

Query: 306 LLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDL 365
           LLGM VAYNDP LL            PFVVAI+N+G+  LPHIFN CVL+FVFSACNSDL
Sbjct: 311 LLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNAGIPVLPHIFNACVLMFVFSACNSDL 370

Query: 366 YVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVN 425
           YV +RSLY LAID KAPK+FAKTN+WGVPYN+          AYMNVSSGSAQ+FNYFVN
Sbjct: 371 YVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLLAYMNVSSGSAQVFNYFVN 430

Query: 426 VVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKN 485
           VVSIFG++SWI+ILITYI+F RA  AQ VD+++ AY AP    GAY  LFFC LIA IKN
Sbjct: 431 VVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLASKGAYFALFFCCLIALIKN 490

Query: 486 FTVFIG-EFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAIDRXXXX 544
           FTVF+G +FDYK+FITGYIG+P+++I +FGYK I  TK VK EEADLY+FKE ID     
Sbjct: 491 FTVFLGHKFDYKNFITGYIGIPVFIICFFGYKYIRGTKFVKPEEADLYTFKELIDLEEEE 550

Query: 545 XXXXXXXXXXRLKNSKKSLKWFYEKYLGYIF 575
                     ++++S K+ KWFYEK+LG+IF
Sbjct: 551 GKLWDAAQKEKMESSPKNFKWFYEKFLGWIF 581

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  758 bits (1957), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/562 (66%), Positives = 439/562 (78%), Gaps = 2/562 (0%)

Query: 16  DIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXX 75
           DI D++  +T S    + E   + + DGK++  RL+K+LKARHISMIAI           
Sbjct: 52  DINDMDNLSTVSSRLEDSEKQDDYMDDGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIG 111

Query: 76  XXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTSYATRYCDPALGFAVG 135
                    P S+ IAY+FVG+LVFF MA LGEMA+YIPLDGFTSYA+RYCDPALGFAVG
Sbjct: 112 TGNSLYTAGPMSMFIAYAFVGVLVFFTMAALGEMASYIPLDGFTSYASRYCDPALGFAVG 171

Query: 136 YCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEF 195
           Y YL KY I+ PNQLTA ALVIQYW+DRE VNPGVWITIFLV+IV +N +GV++FGEFEF
Sbjct: 172 YAYLCKYLILPPNQLTAAALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEF 231

Query: 196 WLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFV 255
           WLS+FK++VM G+I+ LF+IMLGGGP HDRLGFR++ +PGAFKPYS+SI GSKGKFV+FV
Sbjct: 232 WLSTFKVIVMIGLIILLFVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFV 291

Query: 256 AVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYND 315
           AV VYALFAYLGIELTGIVAAEA NPR++IP+AIKLTMYRII+FY+VTIFLLGMCVAY+D
Sbjct: 292 AVLVYALFAYLGIELTGIVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDD 351

Query: 316 PRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSL 375
           P L             P+VVAI NSG++ALPHIFN CVL+FVFSACNSDLYV +R+LY L
Sbjct: 352 PLLKKAKTSGTGAAASPYVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGL 411

Query: 376 AIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSW 435
           AID KAPK+FA TNRWGVPY +          AYM+VSSGSA+IFNYFVNVVSIFG+LSW
Sbjct: 412 AIDNKAPKIFAVTNRWGVPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSW 471

Query: 436 ISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIG-EFD 494
           ISILITY+ F+RA  AQNVDR+ FAYRAPFQPYG+Y TL FC+LIAFIKNFTVF+   FD
Sbjct: 472 ISILITYLCFFRAVKAQNVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFD 531

Query: 495 YKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAIDRXXXXXXXXXXXXXX 554
           YK+FITGYIG+P++VI YFGYK + KTK+ K EE DLY+FK AID               
Sbjct: 532 YKNFITGYIGIPVFVISYFGYKFVKKTKIWKPEEVDLYTFKAAIDEEEEQGKIADAERRE 591

Query: 555 RLKNSK-KSLKWFYEKYLGYIF 575
           RLKNSK K   WFYEK LG IF
Sbjct: 592 RLKNSKTKGWDWFYEKVLGNIF 613

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  747 bits (1929), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/563 (67%), Positives = 449/563 (79%), Gaps = 5/563 (0%)

Query: 18  IDLEKNTTSSLNSFE----QEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXX 73
           IDLE+N  SS +S        DDS  + DGK++  RL+K+LKARHISMIAI         
Sbjct: 46  IDLEENNVSSRSSTSTSPSARDDSFAVPDGKDENTRLRKDLKARHISMIAIGGSLGTGLL 105

Query: 74  XXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTSYATRYCDPALGFA 133
                      P ++LIAY+FVG+LVF+ MACLGEMA+YIPLDGFTSYA+RY DPALGFA
Sbjct: 106 IGTGTALLTGGPVAMLIAYAFVGLLVFYTMACLGEMASYIPLDGFTSYASRYVDPALGFA 165

Query: 134 VGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEF 193
           +GY YLFKYFI+ PNQLTA ALVIQYWI R+ VNPGVWITIFLVVIV IN VGV++FGEF
Sbjct: 166 IGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNPGVWITIFLVVIVAINVVGVKFFGEF 225

Query: 194 EFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVS 253
           EFWLSSFK+MVM G+IL LFIIMLGGGPNHDRLGFRYW++PGAFK YS +ITG KGKFVS
Sbjct: 226 EFWLSSFKVMVMLGLILLLFIIMLGGGPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVS 285

Query: 254 FVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAY 313
           FVAVFVY+LF+Y GIELTGIV +EAENPR+++P+AIKLT+YRII+FY+ T+FLLGMCVAY
Sbjct: 286 FVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAY 345

Query: 314 NDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLY 373
           NDPRLL            PFVVAIQNSG+  LPHIFN CVL+FVFSACNSDLYV +R+LY
Sbjct: 346 NDPRLLSTKGKSMSAAASPFVVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLY 405

Query: 374 SLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGIL 433
           +LAIDGKAPK+FAKT+RWGVPYNA          AYMNVSSGSA+IFNYFVNVVS+FGIL
Sbjct: 406 ALAIDGKAPKIFAKTSRWGVPYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGIL 465

Query: 434 SWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIG-E 492
           SWI+ILI YI+F +AC AQ +D++ FAY AP Q YGAY  LFFC+LIA IKNFTVF+G +
Sbjct: 466 SWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHK 525

Query: 493 FDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAIDRXXXXXXXXXXXX 552
           FDYK+FITGYIGLP+Y+I + GYK+IYKTK++K+ + DLY+FKE  DR            
Sbjct: 526 FDYKTFITGYIGLPVYIISWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRMKDQEK 585

Query: 553 XXRLKNSKKSLKWFYEKYLGYIF 575
             RLK++ K+++WFYEK+LG IF
Sbjct: 586 EERLKSNGKNMEWFYEKFLGNIF 608

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  743 bits (1918), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/563 (67%), Positives = 448/563 (79%), Gaps = 5/563 (0%)

Query: 18  IDLEKNTTSSLNSFE----QEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXX 73
           IDLE+N  SS +S        DDS  I+DGK++  RLKKELKARHISMIAI         
Sbjct: 44  IDLEENNVSSRSSTSTSPSARDDSFAIADGKDENTRLKKELKARHISMIAIGGSLGTGLL 103

Query: 74  XXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTSYATRYCDPALGFA 133
                      P ++LIAY+FVG+LVFF MACLGEMA+YIPLDGFTSYA+RY DPALGFA
Sbjct: 104 IGTGTALLTGGPVAMLIAYAFVGLLVFFTMACLGEMASYIPLDGFTSYASRYVDPALGFA 163

Query: 134 VGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEF 193
           +GY YLFKYFI+ PNQLTA ALVIQYWI R+ VNPGVWITIFLVVIV IN VGV++FGEF
Sbjct: 164 IGYTYLFKYFILPPNQLTAAALVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEF 223

Query: 194 EFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVS 253
           EFWLSSFK+MVM G+IL LFIIMLGGGP+HDRLGFRYW++PGAFK YS +ITGS GKF S
Sbjct: 224 EFWLSSFKVMVMLGLILLLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTS 283

Query: 254 FVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAY 313
           FVAVFVY+LF+Y GIELTGIV +EAENPR+++P+AIKLT+YRII+FY+ T+FLLGMCVAY
Sbjct: 284 FVAVFVYSLFSYTGIELTGIVCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAY 343

Query: 314 NDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLY 373
           NDPRLL            PFVVAIQNSG++ LPHIFN CVL+FVFSACNSDLYV +R+LY
Sbjct: 344 NDPRLLSTKGKSMSAAASPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLY 403

Query: 374 SLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGIL 433
           +LAIDGKAPK+FAKT++WGVPYNA          AYMNVSSGSA+IFNYFVNVVS+FGIL
Sbjct: 404 ALAIDGKAPKIFAKTSKWGVPYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGIL 463

Query: 434 SWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIG-E 492
           SWI+ILI YI+F +AC AQ +D++ FAY AP Q YGAY  L FC+LIA IKNFTVF+G +
Sbjct: 464 SWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHK 523

Query: 493 FDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAIDRXXXXXXXXXXXX 552
           FDYK+FITGYIGLP+Y++ + GYK+IYKTK++K+ + DLY+FKE  DR            
Sbjct: 524 FDYKTFITGYIGLPVYILSWAGYKLIYKTKVIKSTDVDLYTFKEIYDREEEEGRIKDQER 583

Query: 553 XXRLKNSKKSLKWFYEKYLGYIF 575
             RL+ + K+++WFYEK+LG IF
Sbjct: 584 EERLQRNGKNMEWFYEKFLGRIF 606

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  737 bits (1903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/563 (67%), Positives = 444/563 (78%), Gaps = 5/563 (0%)

Query: 18  IDLEKNTTSSLNSFE----QEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXX 73
           IDLE+N  SS +S        DDS  + DGK++  RL+K+LKARHISMIAI         
Sbjct: 44  IDLEENNVSSRSSTSTSPSARDDSFAVPDGKDETTRLRKDLKARHISMIAIGGSLGTGLL 103

Query: 74  XXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTSYATRYCDPALGFA 133
                      P S+LIAY FVG+LVFF MACLGEMA+YIPLDGFTSYA+RY DPALGFA
Sbjct: 104 IGTGTALLTGGPVSMLIAYGFVGLLVFFTMACLGEMASYIPLDGFTSYASRYVDPALGFA 163

Query: 134 VGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEF 193
           +GY YLFKYFI+ PNQLTA ALVIQYW+ R+ VNPGVWITIFLVVIV IN VGVR+FGEF
Sbjct: 164 IGYTYLFKYFILPPNQLTAAALVIQYWVSRDRVNPGVWITIFLVVIVAINIVGVRFFGEF 223

Query: 194 EFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVS 253
           EFWLSSFK+MVM G+IL LFIIMLGGGP+HDRLGFRYW++PGAFK YS +ITGSKGKFV+
Sbjct: 224 EFWLSSFKVMVMLGLILLLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSTAITGSKGKFVA 283

Query: 254 FVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAY 313
           F +VFVY+LF+Y GIELTGIV +EA+NPR+++P+AIKLT+YRII+FY+ T+FLLGMCVAY
Sbjct: 284 FASVFVYSLFSYTGIELTGIVCSEAKNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAY 343

Query: 314 NDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLY 373
           NDPRLL            PFVVAIQNSG++ LPHIFN CVL+FVFSACNSDLYV +R+LY
Sbjct: 344 NDPRLLSTKGKAMSAAASPFVVAIQNSGIKVLPHIFNGCVLVFVFSACNSDLYVSSRNLY 403

Query: 374 SLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGIL 433
           +LAIDGKAPK+FAKT++WGVPY A          AYMNVS+GSA+IFNYFVNVVS+FGIL
Sbjct: 404 ALAIDGKAPKIFAKTSKWGVPYYALMVSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGIL 463

Query: 434 SWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGE- 492
           SWI+ILI YI+F RAC AQ VD++ FAY AP Q YGAY  LFFC+LIA IKNFTVF+G  
Sbjct: 464 SWITILIVYIYFDRACRAQGVDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHT 523

Query: 493 FDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAIDRXXXXXXXXXXXX 552
           FDYK+FITGYIGLP+YV  + GYK+IYKTK+VK  +ADLY+ KE  DR            
Sbjct: 524 FDYKTFITGYIGLPIYVFSWVGYKLIYKTKVVKPADADLYTLKEIYDREEEQGKLQDQEK 583

Query: 553 XXRLKNSKKSLKWFYEKYLGYIF 575
             RL+ + K+L+WFYEK+LG IF
Sbjct: 584 EERLQRNGKNLEWFYEKFLGNIF 606

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/563 (65%), Positives = 446/563 (79%), Gaps = 5/563 (0%)

Query: 18  IDLEKNTTSSLNSF----EQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXX 73
           IDLE+N  SS +S        DDS  + DGK++  RL+K+LKARHISMIAI         
Sbjct: 45  IDLEENNVSSRSSTFTSPSARDDSFAVPDGKDETTRLRKDLKARHISMIAIGGSLGTGLL 104

Query: 74  XXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTSYATRYCDPALGFA 133
                      P ++LIAY+FVG+LVFF MACLGEMA+YIPLDGFTSYA+RY DPALGFA
Sbjct: 105 IGTGTALMTGGPVAMLIAYAFVGLLVFFTMACLGEMASYIPLDGFTSYASRYVDPALGFA 164

Query: 134 VGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEF 193
           +GY YLFKYFI+ PNQLTA ALVIQYW+ R+ VNPGVWITIF+VVIV IN +GV++FGEF
Sbjct: 165 IGYTYLFKYFILPPNQLTAAALVIQYWVSRDRVNPGVWITIFMVVIVAINVIGVKFFGEF 224

Query: 194 EFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVS 253
           EFWLSSFK++VM G+IL LFIIMLGGGP+HDRLGFRYW++PGAFK YS +I G KGKFVS
Sbjct: 225 EFWLSSFKVLVMLGLILLLFIIMLGGGPDHDRLGFRYWRDPGAFKEYSAAIGGGKGKFVS 284

Query: 254 FVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAY 313
           F+AVFVY+LF+Y GIELTGIV +EA+NPR+++P+AIKLT+YRII+FY+ T+FLLGMCVAY
Sbjct: 285 FLAVFVYSLFSYTGIELTGIVCSEAQNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAY 344

Query: 314 NDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLY 373
           NDPRL+            PFVVAIQNSG++ LPHIFN CVL+FVFSACNSDLYV +R+LY
Sbjct: 345 NDPRLISTKGKALSAAASPFVVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLY 404

Query: 374 SLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGIL 433
           +LAIDGKAPK+F+KTN+WGVPYNA          AYMNVS+GSA+IFNYFVNVVS+FGIL
Sbjct: 405 ALAIDGKAPKIFSKTNKWGVPYNALIFSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGIL 464

Query: 434 SWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIG-E 492
           SWI+ILI YI+F +AC AQ +D++ FAY AP Q YGAY  L FC+ IA IKNFTVF+G +
Sbjct: 465 SWITILIVYIYFDKACRAQGIDKSKFAYVAPGQRYGAYFALVFCIFIALIKNFTVFLGHK 524

Query: 493 FDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAIDRXXXXXXXXXXXX 552
           FDYK+FITGYIGLP+YV  + GYK+IYKTK++K+ + DLY+FKE  DR            
Sbjct: 525 FDYKTFITGYIGLPVYVFSWVGYKLIYKTKVIKSTDVDLYTFKEIYDREEEQGKIEDQEK 584

Query: 553 XXRLKNSKKSLKWFYEKYLGYIF 575
             RLK + K+++WFYEK+LG+IF
Sbjct: 585 EERLKKNGKNMEWFYEKFLGHIF 607

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 363/527 (68%), Positives = 422/527 (80%), Gaps = 1/527 (0%)

Query: 50  LKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEM 109
           LKK L+ARH+SMIAI                    PAS+ IAYSFVGILVFF MA +GEM
Sbjct: 99  LKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAAIGEM 158

Query: 110 ATYIPLDGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPG 169
           A+YIP+DGFTSYA+RY DPALGFAVGYCYLFKY I+ PNQLTA +LVIQYWIDR+TVNPG
Sbjct: 159 ASYIPMDGFTSYASRYVDPALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNPG 218

Query: 170 VWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFR 229
           VWITIFLVVIVIIN  GV++FGEFEFWLSSFK++VM G+IL +FI+MLGGGP+HDRLGFR
Sbjct: 219 VWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDHDRLGFR 278

Query: 230 YWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAI 289
           YW++PGAFKPYS++I GS GKFV+FV+VFVYALFAYLGIELTGIVAAEA NPR+++PRA+
Sbjct: 279 YWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRAV 338

Query: 290 KLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIF 349
           KLT++RI++FY+VTIFLLGMCVAYNDPRLL            PFVVAIQNSG+R LPHIF
Sbjct: 339 KLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIRVLPHIF 398

Query: 350 NVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAY 409
           N CVLIFVFSACNSDLYVG+RSLYSLA+DGKAP +F +T  WG+P+ +          AY
Sbjct: 399 NACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLAY 458

Query: 410 MNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYG 469
           MNVSSGSAQ+FNYFVNVVSIFG+LSWI I ITYI F RA   Q VDR+ FAY APFQPYG
Sbjct: 459 MNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPYG 518

Query: 470 AYITLFFCVLIAFIKNFTVFIGE-FDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEE 528
            Y +L +CV IAFIKNFTVF+G  FDYK+FITGYIGLP++VIFYFGYK I KTK+VK+ E
Sbjct: 519 TYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYIGLPVFVIFYFGYKFIKKTKIVKSHE 578

Query: 529 ADLYSFKEAIDRXXXXXXXXXXXXXXRLKNSKKSLKWFYEKYLGYIF 575
            DL++ KE  D+              RL+ +K SL+W YEK+LG IF
Sbjct: 579 VDLFTGKEVFDQQEIEGKILDQEKQIRLRENKFSLEWIYEKFLGNIF 625

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  728 bits (1879), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/569 (65%), Positives = 446/569 (78%), Gaps = 7/569 (1%)

Query: 8   KDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXX 67
           ++ +LI +D   LE+N +S+  S + E+DS  I DGK +G RLKK LKARH+SMIAI   
Sbjct: 32  QEEELINDD---LERNISSA--SSQDENDSYNI-DGKTEGTRLKKALKARHVSMIAIGGS 85

Query: 68  XXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTSYATRYCD 127
                            P S LIAY+FVG+LVFF MACLGEMATYIPLDGFTSYA+RYCD
Sbjct: 86  LGTGLLIGTGTSLALAGPVSTLIAYAFVGLLVFFTMACLGEMATYIPLDGFTSYASRYCD 145

Query: 128 PALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGV 187
           PALGFAVGY YLFKYFI+ PNQLTA ALVIQYW+D+E VNPGVW+TIFLVVIV IN  GV
Sbjct: 146 PALGFAVGYAYLFKYFILPPNQLTAAALVIQYWVDKEKVNPGVWVTIFLVVIVSINVFGV 205

Query: 188 RYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGS 247
           R+FGEFEFWLSSFK++VM G++L LFI+MLGGGP+HDRLGFRYW++PG+FK YSE+ITG 
Sbjct: 206 RFFGEFEFWLSSFKVLVMLGLMLLLFILMLGGGPDHDRLGFRYWRHPGSFKEYSETITGD 265

Query: 248 KGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLL 307
            G+FV+FV+VFVYA +AYLGIELTGIVAAEA+NPR++IP+AIKLTMYRI++FY+++IFLL
Sbjct: 266 TGRFVAFVSVFVYATYAYLGIELTGIVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLL 325

Query: 308 GMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYV 367
           GMCVAY+DP L+            PFVVAI NSG+ ALPHI N CVL+FVFSACNSDLYV
Sbjct: 326 GMCVAYDDPLLIKAKNSSTSAAASPFVVAIINSGINALPHIINACVLVFVFSACNSDLYV 385

Query: 368 GTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVV 427
            +RSLYSLAID KAPK+FAKTNRWG+PY A          AYM VSS SA+IFNYFVNVV
Sbjct: 386 SSRSLYSLAIDNKAPKIFAKTNRWGIPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVV 445

Query: 428 SIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFT 487
           SIFGILSWISILITYI F RA  AQ VD+++FAY APFQPYGA+ +LFFC LIA IKNFT
Sbjct: 446 SIFGILSWISILITYICFDRAVRAQGVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFT 505

Query: 488 VFIG-EFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAIDRXXXXXX 546
           VF+  +FDYK+FITGYIGLP++   YFGYK  YKTK++   + DLY+FK AID+      
Sbjct: 506 VFLNHQFDYKNFITGYIGLPVFFFCYFGYKFTYKTKVIDPLKVDLYTFKAAIDQEEEDGK 565

Query: 547 XXXXXXXXRLKNSKKSLKWFYEKYLGYIF 575
                   R+K + K+ +WFY+K+LG IF
Sbjct: 566 MADAEKAERIKQNGKNFEWFYDKFLGNIF 594

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  718 bits (1854), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/535 (66%), Positives = 428/535 (80%), Gaps = 1/535 (0%)

Query: 42  DGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFF 101
           DGK +G+RLKK L+ARH+SMIAI                    PASILI+YSFVG+LV+ 
Sbjct: 43  DGKHEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYT 102

Query: 102 VMACLGEMATYIPLDGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWI 161
           VMACLGEMA +IPLDGFTSYA+RY DPALGFAVGYCYLFKYFI+TPNQLTAGA+V+QYW+
Sbjct: 103 VMACLGEMAAFIPLDGFTSYASRYVDPALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYWV 162

Query: 162 DRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGP 221
            RE VNPGVWITIFLV+IV+INTVGVR+FGEFEFWLSS K++VM G+IL LFIIMLGGGP
Sbjct: 163 SREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGP 222

Query: 222 NHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENP 281
           NHDR GFRYW++PGAFKPYSE+I+GSKGKFVSF +VF  ALFAY G EL GIVAAEA+NP
Sbjct: 223 NHDRTGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNP 282

Query: 282 RRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSG 341
           RR++PRAIKLT+YRI+LFY+++I LLGM VAYNDP L+            PFVVAI+N+G
Sbjct: 283 RRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNAG 342

Query: 342 VRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXX 401
           +  LPHIFN CVL+FVFSACNSDLYV +R+LY LAID KAPK+FAKTN WGVPY +    
Sbjct: 343 IPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAVS 402

Query: 402 XXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAY 461
                 AYMNVSSGSAQIFNYFVNVVSIFG+LSWISILITY+ F++A IAQ  D++ F+Y
Sbjct: 403 VLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFSY 462

Query: 462 RAPFQPYGAYITLFFCVLIAFIKNFTVFIGE-FDYKSFITGYIGLPLYVIFYFGYKIIYK 520
            APFQP+  +++LFFC LI  IKN+TVF+G  FDYK+FI+GYIG+P+Y I Y GYK++++
Sbjct: 463 TAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVHR 522

Query: 521 TKLVKAEEADLYSFKEAIDRXXXXXXXXXXXXXXRLKNSKKSLKWFYEKYLGYIF 575
           +KL+K E+ DLY+FK AID               +LK+S K+L WFY+ +LG+IF
Sbjct: 523 SKLIKPEDVDLYTFKAAIDAEEEEGKLLELERKEQLKSSPKNLTWFYDTFLGWIF 577

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  719 bits (1855), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/570 (63%), Positives = 436/570 (76%), Gaps = 6/570 (1%)

Query: 7   TKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXX 66
           T++ +L+ +D   LE N + S ++ +Q D  N   DGK +G RLKK L+ R +SM+AI  
Sbjct: 33  TQERELLHDD---LENNISLSTSAEDQNDSYN--VDGKTEGTRLKKVLEGRVVSMVAIGG 87

Query: 67  XXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTSYATRYC 126
                             P S+LIAY+FVG+LVFF MA LGEMA+YIPLDGFTSYATRY 
Sbjct: 88  SLGTGLLIGTGNSLATAGPVSMLIAYAFVGLLVFFTMASLGEMASYIPLDGFTSYATRYA 147

Query: 127 DPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVG 186
           DPALGFAVGYCYLFKYFI+ PNQLTA ALVIQYWI RE VNPGVWITIFLVVIV INT+G
Sbjct: 148 DPALGFAVGYCYLFKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIFLVVIVAINTLG 207

Query: 187 VRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITG 246
           V++FGEFEFWLSSFK++VMF +I+ LFI+MLGGGPNHDRLGFR+WK+PGAF  YS +ITG
Sbjct: 208 VQFFGEFEFWLSSFKVLVMFALIILLFILMLGGGPNHDRLGFRHWKHPGAFNNYSPAITG 267

Query: 247 SKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFL 306
             GKFV+FV+VFVYA FAYLG EL GIV  EA NPR+++P+AIKLTMYRII+FY+++I L
Sbjct: 268 DTGKFVAFVSVFVYATFAYLGTELVGIVVGEARNPRKSVPKAIKLTMYRIIIFYLISILL 327

Query: 307 LGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLY 366
           LGMCV Y+DP LL            PFVVAI NSG++ LPHIFN CVL+FVFSACNSDLY
Sbjct: 328 LGMCVGYDDPLLLEAKTKSTSAAASPFVVAIVNSGIKVLPHIFNACVLVFVFSACNSDLY 387

Query: 367 VGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNV 426
           V +RSLYSLAID KAPK+FA+TNRWG+PY +          AYM+VSSGSA+IFNYFVNV
Sbjct: 388 VASRSLYSLAIDNKAPKIFARTNRWGIPYYSLGLSVLFCLLAYMSVSSGSAKIFNYFVNV 447

Query: 427 VSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNF 486
           VSIFG+LSWI IL+TY+ F RA  AQ +D+++F+Y AP Q YGAY  LFFC LIA IKNF
Sbjct: 448 VSIFGLLSWICILVTYLAFDRAVRAQGIDKSTFSYVAPGQRYGAYFALFFCSLIALIKNF 507

Query: 487 TVFIG-EFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAIDRXXXXX 545
           TVF+G +FDYK+FITGYIG+P++ I YFGYK+IYKTK++   E DLY+FK AID+     
Sbjct: 508 TVFLGHQFDYKTFITGYIGIPVFFISYFGYKLIYKTKIIDPLEVDLYTFKAAIDQEEEDG 567

Query: 546 XXXXXXXXXRLKNSKKSLKWFYEKYLGYIF 575
                    R+K + ++ +WFY+K+L  IF
Sbjct: 568 KLEDIARKERIKANGRNFEWFYDKFLSNIF 597

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  712 bits (1837), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/576 (61%), Positives = 441/576 (76%), Gaps = 6/576 (1%)

Query: 6   VTKDSKLIREDIIDLEKNTT--SSLNSFEQEDDSNKIS---DGKEDGVRLKKELKARHIS 60
           +  D+ + +++   L  N T    + + E E     +S   DGK +G+RLKKEL+ARH+S
Sbjct: 1   MNSDTSMEKKNAGVLYSNETLEEGIVTLESEGQVRSVSEGVDGKHEGIRLKKELEARHVS 60

Query: 61  MIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTS 120
           MIAI                    P SILI+YSFVG+LV+ VM+CLGEMA +IPLDGFTS
Sbjct: 61  MIAIGGSLGTGLLIGTGSSLASAGPVSILISYSFVGLLVYTVMSCLGEMAAFIPLDGFTS 120

Query: 121 YATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIV 180
           YA+RY DPA+GFAVGY YLFKYFI+TPNQLTAGA+V+Q+W+ R+ VNPGVWITIFL +IV
Sbjct: 121 YASRYVDPAVGFAVGYSYLFKYFIVTPNQLTAGAMVMQFWVSRDRVNPGVWITIFLALIV 180

Query: 181 IINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPY 240
           +INTVGVR+FGEFEFWLSS K++VM G+IL LFIIMLGGGPNHDR GFR+W++PGAFKPY
Sbjct: 181 LINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGGPNHDRTGFRFWRDPGAFKPY 240

Query: 241 SESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFY 300
           SE+I+GSKGKFVSF +VF  ALFAY G EL GIVAAEA+NPRR++PRAIKLT+YRI++FY
Sbjct: 241 SEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKNPRRSVPRAIKLTLYRIVVFY 300

Query: 301 IVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSA 360
           ++TI LLGM VAYNDPRLL            PFVVAI+N+ +  LPHIFNVCVL+FVFSA
Sbjct: 301 VITILLLGMTVAYNDPRLLKAKKMATSAAASPFVVAIENASIPVLPHIFNVCVLVFVFSA 360

Query: 361 CNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIF 420
           CNSDLYV +RSLY LAIDGKAP++FA TN+WGVPY +          AYMNVSSGSAQ+F
Sbjct: 361 CNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPYYSLGLSVLFCLLAYMNVSSGSAQVF 420

Query: 421 NYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLI 480
           NYFVNVVSIFG+LSWI+ILITYI F +A   Q  D++S +Y A FQP+  Y+ LFFC LI
Sbjct: 421 NYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGDKSSLSYTAAFQPWSTYVALFFCCLI 480

Query: 481 AFIKNFTVFIG-EFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAID 539
             IKN+TVF+G +FDYK+FI+GYIG+P+Y+I Y GYK++Y+TKL+K E+ DLY+FK+AID
Sbjct: 481 GLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVGYKVVYRTKLIKPEDVDLYTFKDAID 540

Query: 540 RXXXXXXXXXXXXXXRLKNSKKSLKWFYEKYLGYIF 575
                           ++NS K+ KWFYE +LG+IF
Sbjct: 541 AEEEEYKLLEKERLENMENSPKNFKWFYETFLGWIF 576

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 372/559 (66%), Positives = 435/559 (77%), Gaps = 5/559 (0%)

Query: 18  IDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXX 77
           ID+EK +T S+      DD+N+  DGK    RLKK+LKARH+SMIAI             
Sbjct: 34  IDIEKESTESV----ALDDTNEQFDGKCSDQRLKKDLKARHVSMIAIGGSLGTGLLIGTG 89

Query: 78  XXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTSYATRYCDPALGFAVGYC 137
                  P S+LI+YSFVG+LVFFVM+C+GEMA YIPLDGFTSYA+RYCDPALGFAVGY 
Sbjct: 90  NSLAVAGPVSMLISYSFVGVLVFFVMSCIGEMAAYIPLDGFTSYASRYCDPALGFAVGYA 149

Query: 138 YLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWL 197
           YL KYFI+ PNQLTA ALVIQYWI RE VNPGVWITI LVVIV+INT GV++FGEFEFWL
Sbjct: 150 YLVKYFILPPNQLTAAALVIQYWIPREKVNPGVWITIVLVVIVVINTFGVKFFGEFEFWL 209

Query: 198 SSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAV 257
           SSFK++VM G+I+ +FIIMLGG P HDRLGFRYWK+PGAFK YS+SI G  G+FVSFV+ 
Sbjct: 210 SSFKVIVMLGLIILMFIIMLGGTPTHDRLGFRYWKHPGAFKEYSKSIHGDIGRFVSFVSC 269

Query: 258 FVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPR 317
           FVY LF YLGIELTGIVAAEAENPR+NIP+AIKLTM+RII+FYI+TIFLLGMCV+ NDP 
Sbjct: 270 FVYGLFCYLGIELTGIVAAEAENPRKNIPKAIKLTMWRIIIFYIITIFLLGMCVSSNDPL 329

Query: 318 LLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAI 377
           LL            PFVVAI NSG+ ALPHIFN CVL+FVFSACNSDLYV +R+LYSLAI
Sbjct: 330 LLEAKTKSTSAAASPFVVAIVNSGIEALPHIFNACVLMFVFSACNSDLYVASRNLYSLAI 389

Query: 378 DGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWIS 437
           D KAPK+FAKTNR+G+PYN+          AYM+VSSGSA+IFNYFVNVVSI G+L+WIS
Sbjct: 390 DNKAPKIFAKTNRFGIPYNSLGVAVLFCLLAYMSVSSGSAKIFNYFVNVVSITGVLTWIS 449

Query: 438 ILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIG-EFDYK 496
           ILITYI F RA  AQ +D+++FAY AP QPYGAY +LFFC L+A IKNFTVF+  +FDY+
Sbjct: 450 ILITYICFDRAVRAQGIDKSTFAYVAPLQPYGAYFSLFFCCLLALIKNFTVFLNHKFDYR 509

Query: 497 SFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAIDRXXXXXXXXXXXXXXRL 556
           +FITGYIGLPL+ I YFGYK + KTK+ K EE DL+SFK AID+              R+
Sbjct: 510 NFITGYIGLPLFFICYFGYKFVKKTKIRKPEEVDLFSFKAAIDQEEEDGRIKDAATAERI 569

Query: 557 KNSKKSLKWFYEKYLGYIF 575
           K + K+ +WFYE YLG IF
Sbjct: 570 KKNGKNWEWFYETYLGKIF 588

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  707 bits (1824), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 352/581 (60%), Positives = 425/581 (73%), Gaps = 7/581 (1%)

Query: 2   SVYEVTKDSKLIREDII--DLEKNTTSSLNSFEQE-DDSNKISDGKEDGVRLKKELKARH 58
           S +E+T   K   +  I  DLE+N+ S  +S      D +   DGK +G RLKK LKARH
Sbjct: 13  SKFEMTDLQKQSDQVTISSDLEQNSISIASSRNSSIGDRDIFDDGKTEGFRLKKNLKARH 72

Query: 59  ISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGF 118
           +SMIAI                    P S+ I YSFVG+LVFF M+CLGEMA +IPLDGF
Sbjct: 73  VSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFVGVLVFFTMSCLGEMAAFIPLDGF 132

Query: 119 TSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVV 178
           TSYA+RY DPALGFAVGY YL KY I+  NQLTAGA+V+QYW+DR+T+NPGV+ITIFL++
Sbjct: 133 TSYASRYVDPALGFAVGYSYLCKYLILPANQLTAGAMVVQYWVDRDTLNPGVFITIFLIL 192

Query: 179 IVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFK 238
           IV IN  GV+ FGEFEFWLSSFK++VM G+IL +FIIMLGGGPNHDRLGFRYW++PG+FK
Sbjct: 193 IVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFIIMLGGGPNHDRLGFRYWRDPGSFK 252

Query: 239 PYSESITGS---KGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYR 295
           PYS SI       GKFVSF + FVYALF YLGIELTGIVAAEA+NPR+NIP+AIKLTMYR
Sbjct: 253 PYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELTGIVAAEAQNPRKNIPKAIKLTMYR 312

Query: 296 IILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLI 355
           II+FY++TI LL MCVAYNDP LL            PFVVAI+NSG+  LPHIFNVCVL 
Sbjct: 313 IIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAASPFVVAIENSGINILPHIFNVCVLA 372

Query: 356 FVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSG 415
           FV SA NSDLYV +RSLYSLAID KAPK F KTN+WG+PY +          AYMNVSS 
Sbjct: 373 FVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKWGIPYWSLAFSTAFSCLAYMNVSSS 432

Query: 416 SAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLF 475
           ++ +FNYFVN VSIFG++SWI IL+TYI F +AC AQ +D+++F Y AP+QPYGAY  LF
Sbjct: 433 ASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKAQGMDKSNFTYVAPWQPYGAYFALF 492

Query: 476 FCVLIAFIKNFTVFI-GEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSF 534
           FC ++A +KNFTVF+ G+FDYK+FITGYIG+P++ I + GYKI+YKTK  + EE DL + 
Sbjct: 493 FCCVLALVKNFTVFLGGQFDYKNFITGYIGIPVFFICFVGYKIVYKTKTHRPEEVDLVTL 552

Query: 535 KEAIDRXXXXXXXXXXXXXXRLKNSKKSLKWFYEKYLGYIF 575
           K  ID+              RLKN  K   WFY+++LG IF
Sbjct: 553 KALIDQEEEDGKIEDAEREERLKNGNKDWAWFYDRFLGKIF 593

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  677 bits (1747), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/587 (57%), Positives = 421/587 (71%), Gaps = 17/587 (2%)

Query: 5   EVTKDSKLIREDIIDLEKNTT-----------SSLNSFEQEDDSNKIS-----DGKEDGV 48
           E  +  +L  +D I +E+++              + S    D  N ++     DGK DG+
Sbjct: 18  EDIEKQQLFGDDNIVIERSSQLFYDGQSDSKVHGITSGHGSDVKNVVTHTSEFDGKHDGI 77

Query: 49  RLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGE 108
           RLKK L+ARH+SMIAI                    PA+ILIAY+FVG+LVFFVM+CLGE
Sbjct: 78  RLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFFVMSCLGE 137

Query: 109 MATYIPLDGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNP 168
           MA YIPLDGFTSY+TRY DPALGFAVGY YLFKY+II PNQLTAGALVIQYW+DR+ VNP
Sbjct: 138 MAAYIPLDGFTSYSTRYADPALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVNP 197

Query: 169 GVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGF 228
           GVWITI LV I+ IN +GVR+FGE E+++S+ KI VM G+I+ L ++  GGGPNH+ LGF
Sbjct: 198 GVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGGPNHEVLGF 257

Query: 229 RYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRA 288
           +YWKNPGAFK YS +ITG+KG+FVSF +VFV ALFAYLG EL GIV +E +NPR+ +P+A
Sbjct: 258 KYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPKA 317

Query: 289 IKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHI 348
           IKLTMYRII+FY+++IFLLGMCV +NDP L+            PFVVAI N+G+  LPHI
Sbjct: 318 IKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNAGIPVLPHI 377

Query: 349 FNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXA 408
            N C+LIFVFSA NSDLYV +RSLY LAID KAP++FAKTN+ GVPY +          A
Sbjct: 378 MNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALLA 437

Query: 409 YMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPY 468
           YMNVSSGS+++F YFVN VSIFG+LSWISILITYI F +A   Q +D+++ AY++P QPY
Sbjct: 438 YMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQPY 497

Query: 469 GAYITLFFCVLIAFIKNFTVFIGE-FDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAE 527
           GA+ +LFFC+LI  IKNF  F+G+ FDYKSFITGYIG+P Y+I Y GYK+ YKTK++ +E
Sbjct: 498 GAWFSLFFCILIGLIKNFPAFLGDTFDYKSFITGYIGIPTYIISYIGYKLWYKTKIIPSE 557

Query: 528 EADLYSFKEAIDRXXXXXXXXXXXXXXRLKNSKKSLKWFYEKYLGYI 574
           E DL SFKEA+D                L    K LKW YEK  G++
Sbjct: 558 EVDLVSFKEAVDLEEEEGKMLDEERAAHLAAHGKDLKWCYEKIFGWV 604

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  672 bits (1733), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 342/553 (61%), Positives = 410/553 (74%), Gaps = 23/553 (4%)

Query: 9   DSKLIR-----EDIIDLEKNTTSS---LNSFEQEDDSNK-------------ISDGKEDG 47
           DSK IR         D  K  T+S   LN   Q D S+K             I DGK +G
Sbjct: 3   DSKFIRFFSTISPKGDNAKEVTASKLALNIEVQSDQSSKSLCDSASDVLASEIGDGKYEG 62

Query: 48  VRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLG 107
           +RLKK+LK+RHISMIAI                    P S LIAY+FVGI+VFF MACLG
Sbjct: 63  IRLKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMVFFTMACLG 122

Query: 108 EMATYIPLDGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVN 167
           EMAT+IPLDGFTSYA+RYCDPALGFAVGY YL KYFI+ PNQLTA A+V+QYW+ R+TVN
Sbjct: 123 EMATFIPLDGFTSYASRYCDPALGFAVGYAYLIKYFILPPNQLTAAAMVMQYWVPRDTVN 182

Query: 168 PGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLG 227
           PG+W+T+   VI +IN  GVR+FGEFEFWLSS K+++M G+I+ LF+IMLGG  +HDRLG
Sbjct: 183 PGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLGGAGSHDRLG 242

Query: 228 FRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPR 287
           FRYWK+PGAF  YS+ I+GS GKFVSFVAV V  +FAYLGIELTGIVAAEA NPRR++P+
Sbjct: 243 FRYWKHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEASNPRRSVPK 302

Query: 288 AIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPH 347
           AIKLT YRI++FY+V+IFLLGMCV YND +L+            PF +AI N+G+  LP 
Sbjct: 303 AIKLTFYRILVFYVVSIFLLGMCVPYNDEKLV--TTNENSLTASPFSIAILNAGITVLPD 360

Query: 348 IFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXX 407
           IFN C+LIFVFSA NSDLYV +R+LYSLA+D KAPK+FA TNRWG+PYN+          
Sbjct: 361 IFNGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFVSCLFCLL 420

Query: 408 AYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQP 467
           AYM VSS SAQ+F YFVNVVSI G+L+WISILITYI F RA  AQ+VD+++FAY APFQP
Sbjct: 421 AYMTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTFAYVAPFQP 480

Query: 468 YGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAE 527
           YGAY++LFFC LIA IKNFTVF+G FDYK+FITGYIGLP++V+ YFGYKI  K+++  A 
Sbjct: 481 YGAYVSLFFCCLIAIIKNFTVFLGHFDYKTFITGYIGLPIFVLCYFGYKITCKSEIRSAR 540

Query: 528 EADLYSFKEAIDR 540
             DL S K  +DR
Sbjct: 541 YVDLVSQKSLVDR 553

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/537 (61%), Positives = 405/537 (75%), Gaps = 7/537 (1%)

Query: 42  DGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFF 101
           DGK  G+RLKK+L+ARH+SMIAI                    P +ILIAYS +G +VF 
Sbjct: 50  DGKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFT 109

Query: 102 VMACLGEMATYIPLDGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWI 161
           VM+CLGEMA YIPLDGFTSYATRY DPALGFAVGY YLFKY ++TPNQLTA ALV+QYW+
Sbjct: 110 VMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGYTYLFKYLVLTPNQLTAAALVMQYWV 169

Query: 162 DRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGP 221
            R  VNPGVWIT+FL VI+ IN VGV++FGEFEFWLSSFK++VM  V+  L +++LGGGP
Sbjct: 170 GRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGGP 229

Query: 222 NHDRLGFRYWKNPGAFKPYSE--SITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAE 279
           +H+RLGFRYWK+PG FKPYS   SI G KGKFVSF +VFVYALFAYLG EL GIVAAE +
Sbjct: 230 SHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAECK 289

Query: 280 NPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQN 339
           NPRRN+PRAIKLT+YRI++FY+ T+FLLG+ VAYNDP LL            P+VVAI+N
Sbjct: 290 NPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIKN 349

Query: 340 SGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXX 399
           +G+  LPHIFN CVL FVFSACNSDLYVG+RSLY LAID KAPK+FAKTN WGVPYN+  
Sbjct: 350 AGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSLA 409

Query: 400 XXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSF 459
                   AYMNVSS +  +F+YFVNV SIFG+LSWISILITYI F RA   Q +D+N+ 
Sbjct: 410 LCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNTL 469

Query: 460 AYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGE-FDYKSFITGYIGLPLYVIFYFGYKII 518
           +Y+APFQP  A+I L FC+++A +KNFTVF+G+ FDYK+FITGYIG+P+Y++ +  YKI+
Sbjct: 470 SYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYIGIPVYILCFVCYKIV 529

Query: 519 YKTKLVKAEEADLYSFKEAIDRXXXXXXXXXXXXXXRLKNSKKSLKWFYEKYLGYIF 575
           +KTK +K+   DL+++K AID               RLK  +K   W ++++  YIF
Sbjct: 530 HKTKWIKSANVDLFTYKTAID----LEEEEGKLEMMRLKEERKQHGWTWKQFYDYIF 582

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  653 bits (1685), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/558 (59%), Positives = 406/558 (72%), Gaps = 6/558 (1%)

Query: 22  KNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXX 81
           ++T SS +   Q  D N   DGK +G+RLKK+L+ARH+SMIAI                 
Sbjct: 33  RHTHSSTDQEAQSVDWNY--DGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLM 90

Query: 82  XXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTSYATRYCDPALGFAVGYCYLFK 141
              P SILIAYS +G +VF VM+CLGEMA YIPLDGFTSYATRY DPALGFAVG+ YLFK
Sbjct: 91  RAGPGSILIAYSIMGWVVFTVMSCLGEMAAYIPLDGFTSYATRYADPALGFAVGWAYLFK 150

Query: 142 YFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFK 201
           Y ++TPNQLTAGALVIQ+WI    V+PGVWIT+ L VIV+INTVGVR+FGEFEFWLSSFK
Sbjct: 151 YLVLTPNQLTAGALVIQFWIPAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFK 210

Query: 202 IMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSES---ITGSKGKFVSFVAVF 258
           ++VM  V++ L ++ LGGGP HDRLGFRYW +PGAFK YS+    I G  GKFV+F++VF
Sbjct: 211 VLVMLCVMILLLVLALGGGPTHDRLGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVF 270

Query: 259 VYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRL 318
           VYALFAYLG EL GIVAAE ++PRRN+PRAIKLT+YRI++FY+VTIFLLGMCVAYNDP L
Sbjct: 271 VYALFAYLGTELCGIVAAECKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLL 330

Query: 319 LXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAID 378
           +            P+VVAI+N+ +  LP++FN CVL FVFSACNSDLYVG+RSLY LAID
Sbjct: 331 MQASSAEVSAAASPYVVAIENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAID 390

Query: 379 GKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISI 438
           GKAPKLFA+TN+WGVPYNA          AYM+VS  +   F YFVNV SIFG++SW+SI
Sbjct: 391 GKAPKLFARTNKWGVPYNALACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSI 450

Query: 439 LITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIG-EFDYKS 497
           LITYI F RA  AQ + +++ +Y AP QPY  ++ L FC+ +A IKNF  FIG E D  +
Sbjct: 451 LITYICFDRAFRAQGIPKSTLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVDVPT 510

Query: 498 FITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAIDRXXXXXXXXXXXXXXRLK 557
           FITGYIGLP+Y+  + GYKI++KTK + ++E DL++FKEAID               +L 
Sbjct: 511 FITGYIGLPIYIFCFIGYKIVHKTKWIPSKEVDLFTFKEAIDLEEEECIRERALMKEQLA 570

Query: 558 NSKKSLKWFYEKYLGYIF 575
               S K  Y+  LG+IF
Sbjct: 571 KGGLSWKKIYDNVLGWIF 588

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  365 bits (938), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 194/508 (38%), Positives = 290/508 (57%), Gaps = 8/508 (1%)

Query: 34  EDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYS 93
           ED  +  S G     ++K+ LK RHISMIA+                    P   LIAY 
Sbjct: 26  EDAVSMESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYM 85

Query: 94  FVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTA 152
           F+G L + V   LGEMAT+IP+   FT +  R+  PALG A GY Y   + I    +L+ 
Sbjct: 86  FIGTLAYSVTQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSV 145

Query: 153 GALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFL 212
              +IQ+W D   V    WI IF V++ I N   V+Y+GE EFW++  K++ + G I++ 
Sbjct: 146 VGQIIQFWTD--AVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYA 203

Query: 213 FIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTG 272
           FI++ G G     +GFRYW+NPG + P   S   ++G+F+ +V+  + A F Y G EL G
Sbjct: 204 FIMVCGAG-KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVG 262

Query: 273 IVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXP 332
           I A EA NPR+ +PRAI    +RI+ FYI+++  +G+ V +NDP+L             P
Sbjct: 263 ITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKL---KSEDSYISSSP 319

Query: 333 FVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWG 392
           FV+AI+NSG + LPHIFN  +L  + SA NS++YVG+R  YS+A++G APK    T + G
Sbjct: 320 FVIAIENSGTKVLPHIFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSG 379

Query: 393 VPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQ 452
           +PY A          AY+  SSG++ +FN+ +N+ ++ G  +WI I I++I F +A   Q
Sbjct: 380 IPYAAVLTTSVLGFLAYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQ 439

Query: 453 NVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFY 512
            + R+   ++A F P+GAY   FF  +I  I+ FT F  +F    F T YI + L+ +F+
Sbjct: 440 GISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAPKFKVSDFFTAYISVMLFFVFW 499

Query: 513 FGYKIIYKTKL-VKAEEADLYSFKEAID 539
            G++I ++  L +K E+ DL + +  ID
Sbjct: 500 IGFQIWFRGPLFIKTEDIDLDTDRREID 527

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  360 bits (923), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 199/518 (38%), Positives = 287/518 (55%), Gaps = 8/518 (1%)

Query: 20  LEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXX 79
           LEK  T  L      +D  +  +  E    L +ELK R +S++ +               
Sbjct: 2   LEKKGTVVLERPASGEDECESEEIDEKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSA 61

Query: 80  XXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLD-GFTSYATRYCDPALGFAVGYCY 138
                P S+ IAY F G L+  V+  L EMA++ P+D GF+ Y  RY DPA GFA G+ Y
Sbjct: 62  LAKGGPISLFIAYLFTGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNY 121

Query: 139 LFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLS 198
             KY I+    LTA  LVI YW  R  VN GVW+T+  V +  +N + V+YFGE E  L+
Sbjct: 122 FLKYAIVLSANLTAFGLVIGYW--RPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLT 179

Query: 199 SFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVF 258
            FK++V+  V +   II  GG PNH   GFRYW+  GA  PY   + G  GKF+ + A  
Sbjct: 180 VFKLLVLVIVYITCLIITCGGAPNHTTTGFRYWRESGAL-PYL--VGGGTGKFLGWWACV 236

Query: 259 VYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRL 318
           V ++F ++G E+ GIV  E  NP++ IP++     +RI   Y+  +F+LG+ ++  + +L
Sbjct: 237 VQSIFGFMGSEMIGIVYGETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKL 296

Query: 319 LXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAID 378
           +            PFV+AI +SG++ LP+  N  +L+F+ S+ N+D+Y+ +R LY LA D
Sbjct: 297 VHAHSTDANAS--PFVIAISSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKD 354

Query: 379 GKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISI 438
           G APK+F   NR+ VP             AYMN    +A +F+Y  + VS+FGIL+W  I
Sbjct: 355 GAAPKIFLLVNRFKVPVVGCVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYI 414

Query: 439 LITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSF 498
           LI YI + RA  A+ +  +   +R  FQPY AY+TLFF  +I F   +  FI +F YK+F
Sbjct: 415 LIAYINYDRAIKAKGISIDDIPFRMWFQPYAAYVTLFFVTIITFFNGYNAFIIKFHYKTF 474

Query: 499 ITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKE 536
           IT YIG+   ++   GYK+ +KTK VK  E    +  E
Sbjct: 475 ITSYIGVFANILMVIGYKLYFKTKFVKPSEISFRTRNE 512

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  360 bits (924), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 198/529 (37%), Positives = 302/529 (57%), Gaps = 21/529 (3%)

Query: 5   EVTKDSKLIREDI-----IDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHI 59
           E+ K++ + +++      +   + T  + +S  +  +S+ +SD + +   LKK L  RHI
Sbjct: 4   EIKKEASVSKQEFNGMKEVKSNEETYRTSHSNLESQNSDVVSDYEHN---LKKGLSNRHI 60

Query: 60  SMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-F 118
            +IA+                    PA + +++  +  +V+ +M  L EM  Y+P  G  
Sbjct: 61  QLIALGGCIGTGLFVGTSSTLTQCGPAPLFLSFIIISTMVYCIMCTLAEMVCYLPQQGSV 120

Query: 119 TSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVV 178
               TRY DP+LGFA G+ Y + Y ++   +LTA A +++YW D+  V  GVWITIFL+V
Sbjct: 121 PELVTRYVDPSLGFAAGWNYAYSYAMLVATELTAAAGIVRYWTDQ--VPQGVWITIFLIV 178

Query: 179 IVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFK 238
           +V++N   VR++GE EFW +S KI+ +  +++   +I  GG PNHDR+GFRYW+NPGAF 
Sbjct: 179 VVVLNFSAVRFYGESEFWFASLKIICILALLVVSIVIFFGGAPNHDRVGFRYWRNPGAFG 238

Query: 239 PYSESITGSK-GKFVSFVAVFVYALFAY-LGIELTGIVAAEAENPRRNIPRAIKLTMYRI 296
            +   ITG   G+F+      + + FA+ L  EL G+   EA++ RRNI +A +  +YRI
Sbjct: 239 YH---ITGGNLGRFLDLWTAIIKSAFAFILSPELVGLACVEAKDTRRNIEKASRRFIYRI 295

Query: 297 ILFYIVTIFLLGMCVAYNDPRLLXXXXXXX-XXXXXPFVVAIQNSGVRALPHIFNVCVLI 355
           I FY+ +  ++G+ VA ND  LL             PFV  I NSG+  L H+ NV +L 
Sbjct: 296 IFFYLSSSLMIGVIVAKNDHNLLLALEENRPGAASSPFVQGIANSGIPVLNHVINVAILT 355

Query: 356 FVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSG 415
             +SA NS  Y  +RS+ +L+  G APK+F+K NR+GVPYNA          AY+NVSS 
Sbjct: 356 SAWSAGNSFFYASSRSILALSKQGDAPKIFSKINRFGVPYNAVFLCSLVACLAYLNVSST 415

Query: 416 SAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQN-VDRNSFAYRAPFQPYGAYITL 474
           S+++F +  N+ +I G + W  I + YI F +A +    +DR    YR+P QP+ AY   
Sbjct: 416 SSKVFQWLSNICTISGFIGWFLIGVAYIRFRKAILFNRLLDR--IPYRSPLQPFSAYFFT 473

Query: 475 FFCVLIAFIKNFTVFI-GEFDYKSFITGYIGLPLYVIFYFGYKIIYKTK 522
               +I     + VFI G +DYK F+T YI LP+++ FY G+K IYKT+
Sbjct: 474 IVVAIITLTNGYVVFIKGRWDYKDFLTSYISLPIFLAFYLGHKTIYKTR 522

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  361 bits (927), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 190/523 (36%), Positives = 302/523 (57%), Gaps = 12/523 (2%)

Query: 19  DLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXX 78
           +L ++ T+SL+  E+ D      + +    R+K+ LK RHI MIA+              
Sbjct: 77  NLHQHGTTSLHDDEESD----TEEAQYQDTRVKRALKQRHIGMIALGGTIGTGLFVGIAT 132

Query: 79  XXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYC 137
                 P   LIAY F+G +V+FV   LGEMAT+IP+    T ++ R+  PA G A GY 
Sbjct: 133 PLSNAGPVGSLIAYIFMGSVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYM 192

Query: 138 YLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWL 197
           Y F + I    +++    VIQYW   + V    WI IF V++ ++N   V+ +GEFEFW+
Sbjct: 193 YWFNWAITYAVEISVIGQVIQYWT--KAVPLAAWIGIFWVIVTLMNFFPVKVYGEFEFWI 250

Query: 198 SSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAV 257
           +S K++ + G +++  II+ GG  +   +GFRYW+NPG + P   S    + +F+ +V+ 
Sbjct: 251 ASIKVLAIMGYLIYALIIVCGGS-HQGPIGFRYWRNPGPWGPGIISDKTGEARFLGWVSS 309

Query: 258 FVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPR 317
            + A F Y G EL GI A EA NPR+++PRAI   ++RI LFYI+++F +G+ V +ND R
Sbjct: 310 LINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPFNDDR 369

Query: 318 LLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAI 377
           L             PFV++IQN+G RALP IFN  VL+ + SA NS++YVG+R LY+LA+
Sbjct: 370 L---ANDSAVIASSPFVISIQNAGTRALPDIFNAVVLLTIISAANSNVYVGSRVLYALAL 426

Query: 378 DGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWIS 437
            G APK+F+   ++GVPY            A++ V++ +   FN+ +N+ ++ G+ +W+ 
Sbjct: 427 TGNAPKIFSYVTKYGVPYMGVICTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLF 486

Query: 438 ILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKS 497
           I +++I F +A   + + R+   ++A   P+GAY   FF  +I FI+ F  F  +FD  +
Sbjct: 487 ISLSHIRFMQALKYRGISRDDLPFKAKLMPWGAYYASFFVTVIIFIQGFQAFTPKFDVST 546

Query: 498 FITGYIGLPLYVIFYFGYKIIYKTKLV-KAEEADLYSFKEAID 539
           F T YI L L  + + G ++ Y+ + + K E+ D+ S +  I+
Sbjct: 547 FFTSYISLILLAVLFSGCQLYYRCRFIWKVEDIDIDSDRREIE 589

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  358 bits (920), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 186/527 (35%), Positives = 301/527 (57%), Gaps = 7/527 (1%)

Query: 15  EDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXX 74
            D++   K T +      QE+ S   S    D   +K++LK RH+SMI++          
Sbjct: 27  SDVLHHRKETKNEGIFINQENMSEVESLYGNDDPDVKRDLKPRHMSMISLGGTIGTGLFM 86

Query: 75  XXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFA 133
                     P   L+AY F+G + F V   LGEMAT+IP+   FT Y  R+  PALG A
Sbjct: 87  GIASPIRVAGPVGSLLAYLFMGTIAFCVTQSLGEMATFIPVTSSFTMYTQRFLSPALGAA 146

Query: 134 VGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEF 193
            GY Y F + +    +L+    +IQYW     V   VWI +F +++   N + VR++GE 
Sbjct: 147 NGYLYWFSWCVTFALELSIIGQLIQYWT--FAVPLSVWIVVFWILLTASNMIPVRFYGEI 204

Query: 194 EFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVS 253
           EFW+++ K++ +FG +++  ++M+ GG +   LGFRYWKNPG +     S    + +F+ 
Sbjct: 205 EFWIAALKVLSIFGFLIYA-LVMVCGGSSEGALGFRYWKNPGPWGMGMISSNKYEARFLG 263

Query: 254 FVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAY 313
           +V+  + A F Y G EL GI A E++NPR+ +P+AI    +RI+ FYI+++F +G+ V Y
Sbjct: 264 WVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPY 323

Query: 314 NDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLY 373
            DPRL             PFV+AIQNSG + LP +FN  +L+ + SA NS++Y+G+R LY
Sbjct: 324 TDPRL--STTSDSDINTSPFVMAIQNSGTKVLPSVFNGVILVTILSAGNSNIYIGSRVLY 381

Query: 374 SLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGIL 433
            L+  G AP LF KTN+ GVP+ A          AY+N+S  + ++F++ + + ++ G  
Sbjct: 382 GLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAYLNISQNAKKVFDWLLTITAVAGFF 441

Query: 434 SWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEF 493
           +W+ I +++I F +    + + RN   ++A F P+GAY   FF  +I  I+ F  F  EF
Sbjct: 442 AWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWGAYYAAFFITVIILIQGFDSFAPEF 501

Query: 494 DYKSFITGYIGLPLYVIFYFGYKIIYKTKLV-KAEEADLYSFKEAID 539
            +  FI  YI + L+++ + G+++++KT+L+ + E+ D+ + +  ID
Sbjct: 502 VFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKEDVDIDTDRREID 548

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  354 bits (908), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 189/525 (36%), Positives = 291/525 (55%), Gaps = 9/525 (1%)

Query: 19  DLEKNTTSSLNSFEQEDDSNKI-SDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXX 77
           + EKN+   ++ F +  D   + S G     ++K+ LK RHISMIA+             
Sbjct: 10  EKEKNSEELVSEFSRSKDVVSLESLGSVKETQVKRALKPRHISMIALGGTIGTGLFISIS 69

Query: 78  XXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGY 136
                  P   LIAY F+G L + V   LGEMAT+IP+   F  +  R+  PALG A GY
Sbjct: 70  TPLSNAGPVGALIAYMFIGTLAYMVSQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGY 129

Query: 137 CYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFW 196
            Y   + I    +L+    VIQ+W D   V    WI I  VV+V  N   V+++GE EFW
Sbjct: 130 MYFLSWSITFALELSVVGQVIQFWTD--AVPLTAWIIILWVVLVSANLAPVKFYGEVEFW 187

Query: 197 LSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVA 256
           ++  K++ + G I++ FI++ G G     +GFRYW+NPG + P   S   ++G+F+ +V+
Sbjct: 188 IACIKVLAIVGFIIYAFIMVCGAG-KTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVS 246

Query: 257 VFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDP 316
             + A F Y G EL GI A EA NPR+ +PRAI    +RI+ FYI+++  +G+ V +NDP
Sbjct: 247 SLISAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILSLLFIGLLVPFNDP 306

Query: 317 RLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLA 376
           +L             PFV+AI+NSG + LPHIFN  +L  + SA NSD+Y+ +R LYS+ 
Sbjct: 307 KL---KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSDVYISSRVLYSMG 363

Query: 377 IDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWI 436
           ++G APK    T + G+PY A          AY+  S G++ +F++ +N+ ++ G  +W+
Sbjct: 364 LNGLAPKYLTWTTKSGIPYAAVLTTSLVGFLAYLESSHGASVVFDWLLNITAVAGFFAWM 423

Query: 437 SILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYK 496
            I + +I F +A   Q + R+   ++A F P+GAY   FF  +I  I+ FT F  +F+  
Sbjct: 424 LISVAHIRFMQALKHQGISRDDLPFKAKFMPWGAYYAAFFIGVIIIIQGFTAFAPKFNVS 483

Query: 497 SFITGYIGLPLYVIFYFGYKIIYKTKLV-KAEEADLYSFKEAIDR 540
            F T Y+ + L+   + G++I ++  L  K E+ DL + +  ID 
Sbjct: 484 DFFTAYVSVILFFAVWIGFQIWFRGPLFKKTEDIDLDTDRREIDN 528

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  355 bits (912), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 200/542 (36%), Positives = 299/542 (55%), Gaps = 13/542 (2%)

Query: 4   YEVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDG----VRLKKELKARHI 59
           Y   K    ++   I    + T+SL   +       I++ +E+       +K+ LK RHI
Sbjct: 56  YNTKKKHGSLQGGAIADVNSITNSLTRLQVVSHETDINEDEEEAHYEDKHVKRALKQRHI 115

Query: 60  SMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGF 118
            MIA+                    P   LIAY F+G +V+FV   LGEMAT+IP+    
Sbjct: 116 GMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTIVYFVTQSLGEMATFIPVTSSI 175

Query: 119 TSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVV 178
           T ++ R+  PA G + GY Y F + I    +++    VI+YW D+  V    WI IF V+
Sbjct: 176 TVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTDK--VPLAAWIAIFWVI 233

Query: 179 IVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFK 238
           I ++N   V+ +GEFEFW++S K++ + G +++  II+ GG  +   +GFRYW+NPGA+ 
Sbjct: 234 ITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALIIVCGGS-HQGPIGFRYWRNPGAWG 292

Query: 239 PYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIIL 298
           P   S   S+G+F+ +V+  + A F Y G EL GI A EA NPR+ +PRAI   ++RI+L
Sbjct: 293 PGIISSDKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVL 352

Query: 299 FYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVF 358
           FYI+++F +G+ V YND RL             PFV++IQN+G  ALP IFN  VLI V 
Sbjct: 353 FYIMSLFFIGLLVPYNDSRLSASSAVIASS---PFVISIQNAGTYALPDIFNAVVLITVV 409

Query: 359 SACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQ 418
           SA NS++YVG+R LYSLA  G APK F    R GVPY            A++ V++ +  
Sbjct: 410 SAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGVVCTAALGLLAFLVVNNNANT 469

Query: 419 IFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCV 478
            FN+ +N+ ++ G+ +W+ I + +I F +A   + + R+   ++A   PYGAY   FF  
Sbjct: 470 AFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGISRDDLPFKAKLMPYGAYYAAFFVT 529

Query: 479 LIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLV-KAEEADLYSFKEA 537
           +I FI+ F  F   F    F T YI L L  + + G +I YK + + K E+ D+ S +  
Sbjct: 530 VIIFIQGFQAFC-PFKVSEFFTSYISLILLAVVFIGCQIYYKCRFIWKLEDIDIDSDRRE 588

Query: 538 ID 539
           I+
Sbjct: 589 IE 590

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  351 bits (901), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 187/508 (36%), Positives = 284/508 (55%), Gaps = 8/508 (1%)

Query: 22  KNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXX 81
           KNT + +     +  S++   G  +   L +EL    +S++ +                 
Sbjct: 5   KNTVTVVEPTLSDSASSRDEGGSTNEATLSRELSPGVVSLLTLGSAVGTGLIIGSGTALA 64

Query: 82  XXXPASILIAYSFVGILVFFVMACLGEMATYIPLD-GFTSYATRYCDPALGFAVGYCYLF 140
              P SI +AY F G ++  V+  L EMA + P+D GF+ Y T+Y DPA GFA G+ Y  
Sbjct: 65  RGGPISIFLAYLFTGSILAVVIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNYFL 124

Query: 141 KYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSF 200
           KY I+    LTA  LVI YW  R  +N  VW+T+      ++N + VRYFG+ E +++  
Sbjct: 125 KYAIVLSANLTAFGLVIGYW--RPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVA 182

Query: 201 KIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVY 260
           K+ ++  + +   +I  GGGP+H  +GFRYW+  G F PY   + G+ GKF+ + A  + 
Sbjct: 183 KLTILLLIFIVCLVITCGGGPDHTTIGFRYWRESG-FLPYL--VKGNTGKFLGWWACVIQ 239

Query: 261 ALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLX 320
           ++F ++G E+ GI+  E  NPR+ IP+A +  + RI +FYI  +F+LG+ V+ ++ +L+ 
Sbjct: 240 SIFGFMGSEMIGIIYGETANPRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLVH 299

Query: 321 XXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGK 380
                      PFV+AI  SG++ LP   N  +L+F+ S+  +D+Y+ +R LY LA DG 
Sbjct: 300 AHSTDANAS--PFVIAISTSGIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGA 357

Query: 381 APKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILI 440
           APK+F + N+  +P             AYMN    +A +F Y  + VS+FGIL+W  IL+
Sbjct: 358 APKIFLRLNKHKIPMVGCVVGSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYILV 417

Query: 441 TYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFIT 500
            YI + R   +  V  +   +R PFQPY AYI LFF  +I F   ++ FI +F+YK FIT
Sbjct: 418 AYIHYDRVVKSHGVRLDEIPFRMPFQPYAAYIALFFVSVITFFNGYSAFILKFNYKLFIT 477

Query: 501 GYIGLPLYVIFYFGYKIIYKTKLVKAEE 528
            YIG+   V+   GYK+ YKTK VK EE
Sbjct: 478 SYIGIFANVLLVLGYKLYYKTKWVKPEE 505

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  352 bits (904), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 188/513 (36%), Positives = 296/513 (57%), Gaps = 8/513 (1%)

Query: 29  NSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASI 88
           ++F  E++     +G+     +K+ELK RHI MIA+                    P   
Sbjct: 63  DTFSMEENLQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGA 122

Query: 89  LIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITP 147
           LIAY F+G L F V   LGEMAT+IP+   FT ++ R+  PA G A GY Y F + I   
Sbjct: 123 LIAYLFMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFA 182

Query: 148 NQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFG 207
            +L+    VIQ+W  +  V    WI+IF V+I I+N   V+Y+GEFEFW++S K++ + G
Sbjct: 183 LELSVVGQVIQFWTHK--VPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIG 240

Query: 208 VILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLG 267
            +++ F ++ G G     +GFRYW+NPGA+ P   S   ++G+F+ +V+  + A F + G
Sbjct: 241 FLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQG 299

Query: 268 IELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXX 327
            EL GI A EA NPR+ +PRAIK  ++RI+ FYI ++  +G+ V YNDP+L         
Sbjct: 300 TELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL---TEATSY 356

Query: 328 XXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAK 387
               PF+VAIQNSG + LPHIFN  +L  + SA NS++YVG+R L+ L+ +  APK  ++
Sbjct: 357 VSTSPFIVAIQNSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSR 416

Query: 388 TNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYR 447
           T++ GVPY A          AYM  S+G  ++F + +N+  + G  +W+ I I++I F +
Sbjct: 417 TSKGGVPYIAVFATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQ 476

Query: 448 ACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPL 507
           A   + + R+   ++A   P  AY + FF ++I  I+ FT F  +F+  SF+  YI + L
Sbjct: 477 ALKYRGISRDELPFKAKLMPGLAYYSSFFMIIIIIIQGFTAFAPKFNGSSFLAAYISIFL 536

Query: 508 YVIFYFGYKIIYKTKLV-KAEEADLYSFKEAID 539
           ++  +  ++ I++ + + K E+ D+ S +  I+
Sbjct: 537 FIAVWILFECIFRCRFIWKIEDVDIDSDRRDIE 569

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  351 bits (900), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 190/544 (34%), Positives = 305/544 (56%), Gaps = 12/544 (2%)

Query: 4   YEVTKDSKLIREDIIDLE---KNTTSSLNSFEQ-EDDSNKISDGKEDGVR-LKKELKARH 58
           YE+   S +  E+ +D +   +N T ++ +  + EDD+ K ++      R +K++LK RH
Sbjct: 15  YEINSSSIIKEEEFVDEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRH 74

Query: 59  ISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DG 117
           I MIA+                    P   LI+Y F+G +++ V   LGEM T+IP+   
Sbjct: 75  IGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSS 134

Query: 118 FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLV 177
           F+ +A R+  PALG   GY Y   +      +L+    VIQYW   E V    WI IF  
Sbjct: 135 FSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWT--EAVPLAAWIVIFWC 192

Query: 178 VIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAF 237
           ++  +N   V+Y+GEFEF ++S K++ + G I+F F ++ G G +   +GFRYW+NPGA+
Sbjct: 193 LLTSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAW 252

Query: 238 KPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRII 297
            P   S   ++G+F+ +V+  + A F Y G EL GI A EA NPR+ +PRAIK  + RI+
Sbjct: 253 GPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRIL 312

Query: 298 LFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFV 357
           +FYI+++F +G+ V YNDP+L             PF+++I+NSG + LP IFN  VLI +
Sbjct: 313 VFYILSLFFIGLLVPYNDPKL---DSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITI 369

Query: 358 FSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSA 417
            SA NS++Y+G+R LYSL+ +  AP+  +   R GVPY +          A++ VS+GS 
Sbjct: 370 LSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSG 429

Query: 418 QIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFC 477
           + FN+ +N+  + G  +W+ I  ++I F +A   + + R+   Y+A   P+ AY   FF 
Sbjct: 430 KAFNWLLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFI 489

Query: 478 VLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLV-KAEEADLYSFKE 536
            LI  I+ FT F   F    F+  YI + L++  +  +++ +K +L+ K ++ D+ S + 
Sbjct: 490 ALIVLIQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRR 549

Query: 537 AIDR 540
            I+ 
Sbjct: 550 QIEE 553

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  350 bits (899), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 194/551 (35%), Positives = 304/551 (55%), Gaps = 20/551 (3%)

Query: 1   MSVYEVTKDSKLIREDII-------DLEKNTT--SSLNSFEQEDDSNKISDGKEDGVRLK 51
           +S YE+   S +  E++I       D E+     SS+N+    D + +       G  +K
Sbjct: 12  VSQYEINSISTIKEEELICARYDGQDTEEAVAGKSSINN----DSAKETETSPRKGGEVK 67

Query: 52  KELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMAT 111
           ++LK RHI MIA+                    P   LI+Y F+G +++ V   LGEMAT
Sbjct: 68  RKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMAT 127

Query: 112 YIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGV 170
           +IP+   F+ +A R+  PALG   GY Y   +      +L+    +IQYW D   V    
Sbjct: 128 FIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTD--AVPLVA 185

Query: 171 WITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRY 230
           WI IF  ++ ++N   V+Y+GEFEF ++S K++ + G I F F I+ G G +   +GFRY
Sbjct: 186 WIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSGGPIGFRY 245

Query: 231 WKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIK 290
           W+NPGA+ P   S   ++G+F+ +V+  + A F Y G EL GI A EA NPRR +PRAIK
Sbjct: 246 WRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRRAVPRAIK 305

Query: 291 LTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFN 350
             + RI++FYI+++F +G+ V YNDP+L             PF+++I+NSG + LP IFN
Sbjct: 306 KVVVRILVFYILSLFFIGLLVPYNDPKL---DSEGTFVSSSPFMISIENSGTKVLPDIFN 362

Query: 351 VCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYM 410
             VLI + SA NS++Y+G+R LYSL+ +  AP+  +   + GVPY A          A++
Sbjct: 363 AVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSAFGFLAFL 422

Query: 411 NVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGA 470
             S+GS ++FN+ +N+  + G  +W+ I +++I F +A   + + R+   YRA   P+ A
Sbjct: 423 ETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRARMMPFLA 482

Query: 471 YITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLV-KAEEA 529
           Y   FF  LI  I+ FT F   F    FI  YI + L++  +  +++ +K + V K ++ 
Sbjct: 483 YYASFFIALIVLIQGFTAFAPTFQPIDFIAAYISVFLFIAIWLLFQVWFKCRFVWKLQDV 542

Query: 530 DLYSFKEAIDR 540
           D+ S +  I+ 
Sbjct: 543 DIDSDRRDIEE 553

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  350 bits (898), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 187/534 (35%), Positives = 297/534 (55%), Gaps = 8/534 (1%)

Query: 8   KDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXX 67
            DS     +  +L +    +  S  Q +D     D   +   +K+ LK RHI MIA+   
Sbjct: 24  NDSDSHNSNTGELGRRKRKTSVSSTQYEDLATEKDELLEHHDVKRSLKQRHIGMIALGGT 83

Query: 68  XXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYC 126
                            P   L+AY F+G +VF V   LGEMAT+IP+   F+ +A R+ 
Sbjct: 84  IGTGLFIGIATPLANAGPVGALVAYLFMGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFL 143

Query: 127 DPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVG 186
            PALG A GY Y   +      +L+    +IQ+W  +  V    WI+IF V++   N   
Sbjct: 144 SPALGAANGYMYFLSWCFTFALELSVVGQIIQFWTFK--VPLAAWISIFWVLLTAFNMFP 201

Query: 187 VRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITG 246
           V+++GEFEFW++S K++ + G +++   I+ G G     +GFRYW+NPGA  P   S   
Sbjct: 202 VKFYGEFEFWIASIKVLALMGFLIYSLCIVCGAGKTGP-IGFRYWRNPGAMGPGIISSNT 260

Query: 247 SKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFL 306
            + +F+ +V+  + A F Y G EL GI A EA NPR+ +PRAI+  + RI+LFYI ++F 
Sbjct: 261 GEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIRKVLIRILLFYIGSLFF 320

Query: 307 LGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLY 366
           +G+ V YNDP+L             PF++ IQN+G R LPHIFN  +L  + SA NS++Y
Sbjct: 321 IGLTVPYNDPKL---TSTDSYVSSSPFIITIQNAGTRVLPHIFNAVILTTIISAGNSNVY 377

Query: 367 VGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNV 426
           VG+R L+S+A +G APK  AKT   GVPY +          +YM +S+G A+ FN+ +N+
Sbjct: 378 VGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVLAISAFGSLSYMELSTGGAKAFNWLLNI 437

Query: 427 VSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNF 486
             + G  +W+ I  +++ F +A   + + R+   Y+A + P+ AY  +FF V+I  I+ F
Sbjct: 438 TGVAGFFAWLLISCSHVRFMQALKHRGISRDDLPYKALWMPWLAYYAIFFMVVIILIQGF 497

Query: 487 TVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLV-KAEEADLYSFKEAID 539
           T F   F  + F+  YI + L+++F+  ++I ++ +++ K E+ D+ + +  I+
Sbjct: 498 TSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYFRCRIIWKLEDVDIDTDRREIE 551

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  350 bits (899), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 191/493 (38%), Positives = 284/493 (57%), Gaps = 8/493 (1%)

Query: 49  RLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGE 108
           R+K+ LK RHI MIA+                    P   LIAY F+G +++FV   LGE
Sbjct: 90  RVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQSLGE 149

Query: 109 MATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVN 167
           MAT+IP+    T ++ R+  PA G A GY Y F + I    +++    VIQYW  +  V 
Sbjct: 150 MATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFK--VP 207

Query: 168 PGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLG 227
              WI IF V+I ++N   V+ +GEFEFW++S K++ + G +++  II+ GG  +   +G
Sbjct: 208 LAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGS-HQGPIG 266

Query: 228 FRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPR 287
           FRYW+NPGA      S    + +F+ +V+  + A F Y G EL GI A EA NPR+++PR
Sbjct: 267 FRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 326

Query: 288 AIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPH 347
           AI   ++RI+LFYI+++F +G+ V YNDPRL             PFV++IQN+G + LP 
Sbjct: 327 AINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIASS---PFVISIQNAGTKVLPD 383

Query: 348 IFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXX 407
           IFN  VL+ V SA NS++YVG+R LY+LA  G APK FA   R GVPY            
Sbjct: 384 IFNAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLL 443

Query: 408 AYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQP 467
           A++ V+  +   FN+ +N+ ++ G+ +W+ I + +I F +A   + + R+   ++A F P
Sbjct: 444 AFLVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMP 503

Query: 468 YGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTK-LVKA 526
           +GAY   FF  +I FI+ F  F  +FD   F T YI L L V+ + G ++ Y+ + L K 
Sbjct: 504 WGAYYASFFVTVIIFIQGFQAFAPKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLWKL 563

Query: 527 EEADLYSFKEAID 539
           E+ D+ S +  ID
Sbjct: 564 EDIDIDSDRREID 576

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  350 bits (899), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 185/519 (35%), Positives = 293/519 (56%), Gaps = 8/519 (1%)

Query: 23  NTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXX 82
           N  +  ++F  E+D     +G+     +K+ELK RHI MIA+                  
Sbjct: 57  NGVNGQDTFSMEEDIQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTN 116

Query: 83  XXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFK 141
             P   LI+Y F+G L + V   LGEMAT+IP+   FT ++ R+  PA G A GY Y F 
Sbjct: 117 AGPVGALISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFS 176

Query: 142 YFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFK 201
           + +    +L+    VIQ+W     V    WI+IF V+I  +N   V+Y+GEFEFW++S K
Sbjct: 177 WAVTFALELSVVGQVIQFWT--YAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIK 234

Query: 202 IMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYA 261
           ++ + G +++ F ++ G G     +GFRYW+NPGA+ P   S   ++ +F+ +V+  + A
Sbjct: 235 VIAIIGFLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINA 293

Query: 262 LFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXX 321
            F + G EL GI A EA NPR+ +PRAIK  ++RI+ FYI ++  +G+ V YNDP+L   
Sbjct: 294 AFTFQGTELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL--- 350

Query: 322 XXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKA 381
                     PF++AI+NSG + LPHIFN  +L  + SA NS++YVG+R L+ L+    A
Sbjct: 351 TSATSYVSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLA 410

Query: 382 PKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILIT 441
           PK F+KT + GVPY A          AYM  S+G  ++F + +N+  + G  +W+ I ++
Sbjct: 411 PKFFSKTTKGGVPYIAVFATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVS 470

Query: 442 YIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITG 501
           +I F +A   + + R+   ++A   P  AY   FF V+I  I+ FT F   F+  +F+  
Sbjct: 471 HIRFMQALKYRGISRDELPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAA 530

Query: 502 YIGLPLYVIFYFGYKIIYKTKLV-KAEEADLYSFKEAID 539
           YI + L++  +  +++I++ + V K E+ D+ S +  I+
Sbjct: 531 YISVFLFLAIWILFELIFRCRFVWKIEDVDIDSDRRDIE 569

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  349 bits (895), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 198/543 (36%), Positives = 310/543 (57%), Gaps = 13/543 (2%)

Query: 1   MSVYEVTKDSKLIREDIIDLEKNTTSSLNS--FEQEDDSNKISDGKEDGVRLKKELKARH 58
           M +    K  +L + +I  +E+  +SSL     EQ+   +  S  +E G+  ++ LK RH
Sbjct: 1   MEMQSFEKQPQLHKNEIKVMEEGESSSLADGVLEQQSQIDTASS-QERGI--QRALKPRH 57

Query: 59  ISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DG 117
           +SMIA+                    P   LI+Y F+G L FFV   LGEMAT+IP+   
Sbjct: 58  VSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLFMGSLAFFVTQSLGEMATFIPVASS 117

Query: 118 FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLV 177
           FT +  R+  PALG A GY Y F + I    +L+    +IQYW     V    WI IF V
Sbjct: 118 FTVFTRRFLSPALGAANGYMYCFSWCITFALELSIVGEIIQYWT--LGVPNAAWIIIFWV 175

Query: 178 VIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAF 237
            I + N V V+++GEF+FW++  K++ + G +++   ++ G G     +GFRYW+NPG +
Sbjct: 176 PISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCMVCGAGKTGP-VGFRYWRNPGPW 234

Query: 238 KPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRII 297
                S + S+G+F+ +V+  V A F Y G EL G+ A E+ NPR+ +P+AI+    RI+
Sbjct: 235 GDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAGESANPRKTVPKAIRKVFLRIL 294

Query: 298 LFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFV 357
           LFY+ ++F +G+ V +NDP+L             PF++AIQNSG RALP IFN  +L  +
Sbjct: 295 LFYVGSLFFIGLLVPFNDPKL---DSTANYSASSPFIIAIQNSGTRALPDIFNAVILTTI 351

Query: 358 FSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSA 417
            SA NS++YVG+R LY LA +G APK+  + NR GVPY             Y++VSSGSA
Sbjct: 352 ISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVGIVSLFGFLGYLSVSSGSA 411

Query: 418 QIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFC 477
           + F++ +N+ +I G  +W+ I + +I F +A   Q + R+   ++A   P+GAY   FF 
Sbjct: 412 KAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDLPFKAKLMPWGAYYAAFFI 471

Query: 478 VLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLV-KAEEADLYSFKE 536
           +LI  I+ FT F  +F+  +F   Y+ + L++  +  +++I+K++L+ K E+ D+ S + 
Sbjct: 472 LLIIIIQGFTAFAPKFNVSNFFAAYVSVFLFIAVWVIFQVIFKSRLIHKVEDVDIDSDRR 531

Query: 537 AID 539
            I+
Sbjct: 532 EIE 534

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  348 bits (893), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 186/512 (36%), Positives = 290/512 (56%), Gaps = 12/512 (2%)

Query: 22  KNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXX 81
           +  T+  +  E+ED       G  D  R+K+ LK RHI MIA+                 
Sbjct: 43  RTVTNVCDGLEEEDAEEA---GYHD-TRVKRALKQRHIGMIALGGTIGTGLFVGIATPLS 98

Query: 82  XXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLF 140
              P   LIAY F+G +V+F+   LGEMAT+IP+    T ++ R+  PA G A GY Y F
Sbjct: 99  NAGPVGSLIAYLFMGSIVYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWF 158

Query: 141 KYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSF 200
            + I    +++    VIQ+W     V    WI IF V + ++N   V+ +GE EFW++S 
Sbjct: 159 NWAITYAVEISVIGQVIQFW--TSAVPLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASI 216

Query: 201 KIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVY 260
           K++ + G +++  +I+ GG  +   +GFRYW+NPG + P   S   ++G+F+ +V+  + 
Sbjct: 217 KVIAIVGYLIYALVIVCGGS-SQGPIGFRYWRNPGPWGPGIISDDKNEGRFLGWVSSLIN 275

Query: 261 ALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLX 320
           A F Y G EL GI A EA NPR+++PRAI   ++RI++FYI+++F +GM V +NDPRL  
Sbjct: 276 AAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIVIFYIMSLFFVGMLVPFNDPRL-- 333

Query: 321 XXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGK 380
                      PFV++IQN+G R LPHIFN  V++ + SA NS++YVG+R LY+L+  G 
Sbjct: 334 -ASNVAVIASSPFVISIQNAGTRVLPHIFNAVVMLTIISAANSNVYVGSRVLYALSQTGN 392

Query: 381 APKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILI 440
           APK F    R GVPY            A++ V++ +   FN+ +N+ ++ G+ +W+ I +
Sbjct: 393 APKQFGYVTRHGVPYLGVIATSLLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISL 452

Query: 441 TYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFIT 500
           ++I F +A   + + R+   ++A   P+GAY   FF  +I FI+ F  F  +FD   F T
Sbjct: 453 SHIRFMQALKFRGISRDDLPFKAKLMPWGAYYAAFFVTVIIFIQGFEAFSPKFDVSGFFT 512

Query: 501 GYIGLPLYVIFYFGYKIIYKTK-LVKAEEADL 531
            YI L + V+   G ++ Y+ + L K E+ D+
Sbjct: 513 AYISLIILVVLLIGCQLYYRCRFLWKLEDIDI 544

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  349 bits (895), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 188/493 (38%), Positives = 284/493 (57%), Gaps = 9/493 (1%)

Query: 49  RLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGE 108
            +K+ LK RHI MIA+                    P   LI+Y F+G +V+F+   LGE
Sbjct: 106 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQSLGE 165

Query: 109 MATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVN 167
           MAT+IP+    T ++ R+  PA G A GY Y F + I    +++    VIQYW D+  V 
Sbjct: 166 MATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDK--VP 223

Query: 168 PGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLG 227
             VWI IF V+I ++N   V+ +GEFEFW++S K++ + G +++  +I+ GG  +   +G
Sbjct: 224 LAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-HQGPIG 282

Query: 228 FRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPR 287
           FRYW+NPGA+ P   S   ++G+F+ +V+  + A F Y G EL GI A EA NPR+ +PR
Sbjct: 283 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 342

Query: 288 AIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPH 347
           AI   ++RI+LFYI+++F +G+ V YN+PRL             PFV++IQN+G  ALP 
Sbjct: 343 AINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASSAVIASS---PFVISIQNAGTYALPD 399

Query: 348 IFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXX 407
           IFN  VLI V SA NS++YVG+R LYSLA  G APK F    + GVPY            
Sbjct: 400 IFNAVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLL 459

Query: 408 AYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQP 467
           A++ V++ +   FN+ +N+ ++ G+ +W+ I + +I F +A   + + R+   ++A   P
Sbjct: 460 AFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMP 519

Query: 468 YGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLV-KA 526
           YGAY   FF  +I FI+ F  F   F    F T YI L L  + + G ++ YK + + K 
Sbjct: 520 YGAYYAAFFVTVIIFIQGFQAFC-PFKVSDFFTSYISLILLAVVFTGCQLYYKCRFIWKL 578

Query: 527 EEADLYSFKEAID 539
           E+ D+ + +  I+
Sbjct: 579 EDIDIDTDRREIE 591

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  347 bits (890), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 185/535 (34%), Positives = 294/535 (54%), Gaps = 7/535 (1%)

Query: 8   KDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXX 67
           K+ +L+     + + +   + NS  + D +            ++++LK RHI MIA+   
Sbjct: 24  KEKELVDAQYEEQDTSAAIAANSSIENDGAKGTETSPRSRGEVQRKLKERHIGMIALGGT 83

Query: 68  XXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYC 126
                            P   LI+Y F+G +++ V   LGEMAT+IP+   F+ +A R+ 
Sbjct: 84  IGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFL 143

Query: 127 DPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVG 186
            PALG   GY Y   +      +L+    +IQYW     V    WI IF  ++ ++N   
Sbjct: 144 SPALGATNGYMYWLSWCFTFALELSVLGQIIQYWT--HAVPLAAWIVIFWCLLTLMNMFP 201

Query: 187 VRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITG 246
           V+Y+GEFEF ++S K++ + G I+F F I+ G G     +GFRYW+NPGA+ P   S   
Sbjct: 202 VKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIGFRYWRNPGAWGPGIISSNK 261

Query: 247 SKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFL 306
           ++G+F+ +V+  + A F Y G EL GI A EA NPR+ +PRAIK  + RI++FYI+++F 
Sbjct: 262 NEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVIRILVFYILSLFF 321

Query: 307 LGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLY 366
           +G+ V YNDP+L             PF+++I+NSG + LP IFN  VLI +FSA NS++Y
Sbjct: 322 IGLLVPYNDPKL---DSDGTFVSASPFMISIENSGTKVLPDIFNAVVLITIFSAGNSNVY 378

Query: 367 VGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNV 426
           +G+R LYSL+ +  APK  +   R GVPY A          A++  S+GS + FN+ +N+
Sbjct: 379 IGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAFLETSAGSGKAFNWLLNI 438

Query: 427 VSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNF 486
             + G  +W+ I  ++I F +A   + + R+   Y+A   P+ AY   FF  LI  I+ F
Sbjct: 439 TGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFLAYYASFFIALIVLIQGF 498

Query: 487 TVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLV-KAEEADLYSFKEAIDR 540
           T F   F    F+  YI + L+ I +  +++ +K +L+ K ++ D+ S +  I+ 
Sbjct: 499 TAFAPTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKLQDIDIDSDRREIEE 553

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  348 bits (894), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 193/531 (36%), Positives = 293/531 (55%), Gaps = 32/531 (6%)

Query: 14  REDIIDLEK---NTTSSLNSFEQED-------DSNKISDGKEDGVRLKKELKARHISMIA 63
           ++D I +EK   N ++S N   +ED       + +   DG  +  +LK+ L++RH+ +IA
Sbjct: 60  KDDAIRMEKISKNQSASSNGTIREDLIMDVDLEKSPSVDGDSEPHKLKQGLQSRHVQLIA 119

Query: 64  IXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTSYA- 122
           +                    PA + I+Y  +  +++ +M  LGEM  ++P DG  S   
Sbjct: 120 LGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDSAGS 179

Query: 123 -----TRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLV 177
                TRY DP+LGFA G+ Y + Y I+   + TA + V++YW     V  GVWITIFL 
Sbjct: 180 TANLVTRYVDPSLGFATGWNYFYCYVILVAAECTAASGVVEYWT--TAVPKGVWITIFLC 237

Query: 178 VIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAF 237
           V+VI+N   V+ +GE EFW +S KI+ + G+I+  FI+  GGGPNHDRLGFRYW++PGAF
Sbjct: 238 VVVILNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQHPGAF 297

Query: 238 KPYSESITGSKGKFVSFVAVFVYALFAY-LGIELTGIVAAEAENPRRNIPRAIKLTMYRI 296
             +     GS G F       +   FA+ LG EL  + +AE  + RRNI +A +  ++R+
Sbjct: 298 AHHLTG--GSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFVWRL 355

Query: 297 ILFYIVTIFLLGMCVAYNDPRLLXXXXXXX-XXXXXPFVVAIQNSGVRALPHIFNVCVLI 355
           I FY++    + + V YNDP L+             PFV+ IQN+G++ LPHI N C+L 
Sbjct: 356 IFFYVLGTLAISVIVPYNDPTLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHIINGCILT 415

Query: 356 FVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSG 415
             +SA N+ ++  TRSL ++A  G+APK   + N+WGVPY A          AY+NVSS 
Sbjct: 416 SAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINKWGVPYVAVGVSFLCSCLAYLNVSSS 475

Query: 416 SAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPF----QPYGAY 471
           +A +FN+F N+ +I G L W+   I Y+ F +A     +  N    R PF    QPY  +
Sbjct: 476 TADVFNWFSNISTISGFLGWMCGCIAYLRFRKA-----IFYNGLYDRLPFKTWGQPYTVW 530

Query: 472 ITLFFCVLIAFIKNFTVFIGEF-DYKSFITGYIGLPLYVIFYFGYKIIYKT 521
            +L    +I     + +FI ++     FI  YI LP++++ +FG+K+  +T
Sbjct: 531 FSLIVIGIITITNGYAIFIPKYWRVADFIAAYITLPIFLVLWFGHKLYTRT 581

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  347 bits (889), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 189/535 (35%), Positives = 298/535 (55%), Gaps = 11/535 (2%)

Query: 7   TKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXX 66
           +K +K      I LE  T  S + F +E +     +G      +K+ LKARHISMIA+  
Sbjct: 21  SKKAKGNNGSEIALESITPDSGDEFPEEHEQ----EGDYHETEVKRALKARHISMIALGG 76

Query: 67  XXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRY 125
                             P   LIAY F+G +V+ +   LGEMAT+IP+    T ++ R+
Sbjct: 77  TIGTGLFIVIASPLRTAGPVGSLIAYIFMGTVVYSITQSLGEMATFIPVTSSVTVFSKRF 136

Query: 126 CDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTV 185
             PA G A GY Y F + I    +L+    +I YW     V  G WITIF +++ ++N  
Sbjct: 137 LSPAFGVANGYMYWFNWAITFAVELSVVGQIINYWTS--VVPLGAWITIFWIIVTLLNFF 194

Query: 186 GVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESIT 245
            VR++GE EFW++S K++ + G +++ FI++ GG  +   +GFR W+NPG +     S  
Sbjct: 195 PVRFYGEIEFWIASVKVITIVGYLIYAFIVVCGGS-SQGPIGFRNWRNPGPWGTGVISSN 253

Query: 246 GSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIF 305
            ++ +F+ +V+  + A F Y G EL GI A E++NPR+ +P+AI    +RI+ FYI+++F
Sbjct: 254 QTEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPKAINKVFFRILFFYILSLF 313

Query: 306 LLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDL 365
            +G+ V YNDPR+             PFV++I+N+G + LP IFN  VL+ V SA NS++
Sbjct: 314 FVGLLVPYNDPRM--DNTSDTDVNASPFVISIRNAGTKILPDIFNAVVLVTVVSAANSNV 371

Query: 366 YVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVN 425
           Y+G+R +YSLA  G APK F   NR GVP             A++ V++ +   FN+ VN
Sbjct: 372 YIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMVTALMGLMAFLVVNNNAKAAFNWLVN 431

Query: 426 VVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKN 485
           + ++ G+ +W+ I + +I F +    + + R++  ++A F P+ AY    F  +I FI+ 
Sbjct: 432 ISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALPFKAKFMPWAAYYAASFVFVIIFIQG 491

Query: 486 FTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTK-LVKAEEADLYSFKEAID 539
           +T F  +FD   F T YI L L ++ + G +I YK + L K E+ D+ + +  ID
Sbjct: 492 YTAFSPKFDVTQFFTAYISLMLMLVVFIGCQIYYKCRFLWKLEDIDIDTNRREID 546

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  348 bits (892), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 189/493 (38%), Positives = 284/493 (57%), Gaps = 9/493 (1%)

Query: 49  RLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGE 108
            +++ LK RHI MIA+                    P   LIAY F+G +V+FV   LGE
Sbjct: 105 HVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQSLGE 164

Query: 109 MATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVN 167
           MAT+IP+    T ++ R+  PA G + GY Y F + I    +++    VI+YW  +  V 
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTK--VP 222

Query: 168 PGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLG 227
            GVWI IF V+I ++N   V+ +GEFEFW++S K++ + G +++  +I+ GG      +G
Sbjct: 223 LGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGS-KQGPIG 281

Query: 228 FRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPR 287
           FRYW+NPGA+ P   S   ++G+F+ +V+  + A F Y G EL GI A EA NPR+ +PR
Sbjct: 282 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 341

Query: 288 AIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPH 347
           AI   ++RI+LFYI+++F +G+ V Y DPRL             PFV++IQN+G  ALP 
Sbjct: 342 AINKVVFRIVLFYIMSLFFIGLLVPYTDPRLSASSAVIASS---PFVISIQNAGTYALPD 398

Query: 348 IFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXX 407
           IFN  VLI V SA NS++YVG+R LYSLA  G APK F    + GVPY            
Sbjct: 399 IFNAIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLL 458

Query: 408 AYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQP 467
           A++ V++ +   FN+ +N+ ++ G+ +W+ I +++I F +A   + + R+   ++A F P
Sbjct: 459 AFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMP 518

Query: 468 YGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLV-KA 526
           YGAY   FF  +I FI+ F  F   F    F T YI L L  + + G ++ YK + + K 
Sbjct: 519 YGAYYASFFVTVIIFIQGFQSFC-PFRVADFFTSYISLILLAVVFTGCQLYYKCRFIWKL 577

Query: 527 EEADLYSFKEAID 539
           E+ D+ S +  I+
Sbjct: 578 EDIDIDSDRREIE 590

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  347 bits (889), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 183/513 (35%), Positives = 291/513 (56%), Gaps = 8/513 (1%)

Query: 29  NSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASI 88
           ++F   D       G+     +K+ELK RHI MIA+                    P   
Sbjct: 63  DTFSMGDVIRDEDQGEVRNAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGA 122

Query: 89  LIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITP 147
           LI+Y F+G L + V   LGEMAT+IP+   FT ++ R+  PA G A GY Y F + I   
Sbjct: 123 LISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFA 182

Query: 148 NQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFG 207
            +L+    VI++W ++  V    WI+IF V+I I+N   V+Y+GEFEFW++S K++ + G
Sbjct: 183 LELSVVGQVIEFWTNK--VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIG 240

Query: 208 VILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLG 267
            +++ F ++ G G     +GFRYW+NPGA+ P   S   ++G+F+ +V+  + A F + G
Sbjct: 241 FLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQG 299

Query: 268 IELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXX 327
            EL GI A EA NPR+ +PRAIK  ++RI+ FYI ++  +G+ V YNDP+L         
Sbjct: 300 TELVGITAGEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL---TTATSY 356

Query: 328 XXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAK 387
               PF++AI+NSG + LPHIFN  +L  + SA NS++YVG+R L+ L+ +  APK  ++
Sbjct: 357 VSVSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSR 416

Query: 388 TNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYR 447
           T + GVPY A          AYM  S+G  ++F + +N+  + G  +W+ I I++I F +
Sbjct: 417 TTKGGVPYIAVFITAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQ 476

Query: 448 ACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPL 507
           A   + + R+   ++A   P  AY    F ++I  I+ FT F  +FD   F+  YI + L
Sbjct: 477 ALKYRGISRDELPFKAKLMPGLAYFAATFMIIIILIQGFTAFAPKFDGIDFLAAYISIFL 536

Query: 508 YVIFYFGYKIIYKTKLV-KAEEADLYSFKEAID 539
           ++  +  ++II++ + + K E+ D+ S +  I+
Sbjct: 537 FLAIWILFEIIFRCRFIWKIEDVDIDSDRRDIE 569

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  346 bits (888), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 185/518 (35%), Positives = 292/518 (56%), Gaps = 9/518 (1%)

Query: 8   KDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXX 67
           KD+K   E    + +   S + +       + + +G      +K+ LK RHISMIA+   
Sbjct: 42  KDTKSTDEKTRVVSQ--VSPMRTGSPNVSIDYMDEGNVQDAEVKRALKPRHISMIALGGT 99

Query: 68  XXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYC 126
                            P   LIAY F+G + +FV   LGEMAT+IP+   FT +  R+ 
Sbjct: 100 IGTGLFIGISSPLADAGPVGALIAYMFMGTIAYFVTQSLGEMATFIPVTSSFTVFTQRFL 159

Query: 127 DPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVG 186
            PA G A GY Y F + I    +L+    +IQ+W     V  G WI IF V++   N   
Sbjct: 160 SPAFGVANGYLYWFSWCITFALELSVVGQIIQFWT--FAVPLGAWIAIFWVILTTSNLFP 217

Query: 187 VRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITG 246
           V+Y+GE EFW++  K++ + G I++ FI++ G G     +GFRYW+NPG + P   S   
Sbjct: 218 VKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAG-KTGPVGFRYWRNPGPWGPGIISKDV 276

Query: 247 SKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFL 306
           ++G+F+ +V+  + A F Y G EL GI A E++NPRR +PRAI    +RI+ FYI+++  
Sbjct: 277 NEGRFLGWVSSLINAAFTYQGTELVGITAGESKNPRRTVPRAINKVFFRILFFYILSLLF 336

Query: 307 LGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLY 366
           +G+ V +NDP+L             PFV+AI+NSG + LPHIFN  +L  + SA NS++Y
Sbjct: 337 IGLLVPFNDPKL---KSEDSYISSSPFVIAIENSGTKVLPHIFNAVILSTIISAGNSNIY 393

Query: 367 VGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNV 426
           VG+R LY LA +  APK+FA+  + GVPY +          AY+N+S+ + ++F++ +N+
Sbjct: 394 VGSRVLYGLAKNKLAPKVFARATKDGVPYISVLGTAAFGFLAYLNLSNSAQKVFDWLLNI 453

Query: 427 VSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNF 486
            +I G  +W+ I + +I F +    +N+ RN   ++A F P+GAY + FF  LI  I+ F
Sbjct: 454 TAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLPFKAKFMPWGAYYSAFFISLIIIIQGF 513

Query: 487 TVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLV 524
           T F  +F+  +F   YI + L++  +  ++I ++T+ +
Sbjct: 514 TAFAPKFNVSNFFAAYISVFLFLAIWVVFQIRFRTRFI 551

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  345 bits (886), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 191/513 (37%), Positives = 291/513 (56%), Gaps = 19/513 (3%)

Query: 41  SDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVF 100
           SD  +    LKK LK+RHI +IA+                    PA +  +Y  + ++++
Sbjct: 42  SDAPQGDHTLKKGLKSRHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIY 101

Query: 101 FVMACLGEMATYIPLDGFT------SYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGA 154
            VM  LGEM  Y+P DG +         TRY DP+LGFA G+ Y + Y I+   + TA +
Sbjct: 102 PVMNALGEMVCYLPGDGSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAAS 161

Query: 155 LVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFI 214
            V+QYW     V  G WITIFL V+V++N   V+++GE EFW +S KI+ + G++   FI
Sbjct: 162 GVVQYW--TTAVPKGAWITIFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFI 219

Query: 215 IMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAY-LGIELTGI 273
           +  GGGP+HDRLGFRYW+ PGAF  +  S  G+ G+F+      +   FA+ LG EL  +
Sbjct: 220 LFWGGGPHHDRLGFRYWQKPGAFAYHITS--GNTGRFLDIWTGVIKGGFAFILGPELVAL 277

Query: 274 VAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRL-LXXXXXXXXXXXXP 332
            +AEA++ RRNI +A +  +YR+I FY+ +   +G  VAYND  L              P
Sbjct: 278 TSAEAQDARRNIQKASRRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSP 337

Query: 333 FVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWG 392
           FV+ IQN+G++ LPHI NVC+L   +S+ NS ++  +RSL S++ +G APK+  + NR+G
Sbjct: 338 FVIGIQNAGIKVLPHIINVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFG 397

Query: 393 VPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQ 452
           VPY A          AY+NVSS +A +F +F N+ +I G + WI I I Y+ F +A   Q
Sbjct: 398 VPYAAVALTSLLSCIAYLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQ 457

Query: 453 NV-DRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI-GEFDYKSFITGYIGLPLYVI 510
           N+ +R  F  + PFQPYG +  +    +I     + +FI   ++   FI  Y+ LP++++
Sbjct: 458 NLYERVPF--KTPFQPYGTWFFIIAVSVICLTNGYAIFIPANWNVSDFIAAYVTLPIFLV 515

Query: 511 FYFGYKI---IYKTKLVKAEEADLYSFKEAIDR 540
            + G+K+    +KT  +   E D+ +  + I+ 
Sbjct: 516 LWIGHKLWTRTWKTWAIPVPEIDVTTGLKEIEE 548

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  347 bits (889), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 186/544 (34%), Positives = 307/544 (56%), Gaps = 17/544 (3%)

Query: 6   VTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKED-------GVRLKKELKARH 58
           VT D++++ +   D + +  +S+N +       +IS  + D         ++K+ LK RH
Sbjct: 53  VTYDNEILEKK--DSKSDIFTSVNRYASHPSEARISSDEYDHQEAEFKDTKVKRALKPRH 110

Query: 59  ISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DG 117
           I MIA+                    P   LIAY F+G +V+FV   LGEMAT+IP+   
Sbjct: 111 IGMIALGGTIGTGLFIGISDPLQKSGPVGSLIAYIFMGTVVYFVTQALGEMATFIPVTSS 170

Query: 118 FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLV 177
            T +++R+  PA G + GY Y F + I    +++    VI++W  +  V    WI+IF V
Sbjct: 171 ITVFSSRFLSPAFGVSNGYLYWFNWAITYAVEISVVGQVIEFWTTK--VPLAAWISIFWV 228

Query: 178 VIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAF 237
           ++  +N   V  +GE EFW++S K++ + G +++  +I+ GG      +GFRYW++  A 
Sbjct: 229 LVTALNFFPVSVYGEIEFWVASVKVLAIVGYLIYALVIVCGGS-KQGPIGFRYWRHGYAM 287

Query: 238 KPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRII 297
                S   ++ +F+ +VA  + A F Y G EL GI A EA NPR+++PRAI   ++RI+
Sbjct: 288 GGGMISKDKNEARFLGWVASLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIV 347

Query: 298 LFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFV 357
           +FYI+++F +G+ V YNDP+L             PFV++I+N+G RALPHIFN  ++I +
Sbjct: 348 IFYILSLFFIGLLVPYNDPKL---NSATSYIASSPFVISIENAGTRALPHIFNAIIMITI 404

Query: 358 FSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSA 417
            SA NS++YV +R LYSLA+ G APK+FA+    GVP+            A++ V++ + 
Sbjct: 405 ISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPFLGVIVTALMGLLAFLVVNNNAN 464

Query: 418 QIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFC 477
           + FN+ +N+ ++ G+ +W+ I ++++ F  A   + + R+   ++A F PYG+Y   FF 
Sbjct: 465 EAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGISRDDLPFKARFMPYGSYYACFFI 524

Query: 478 VLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLV-KAEEADLYSFKE 536
            +I FI+ FT F  +FD  SF T YI L L  + + G ++ Y+ +   K E+ D+ + + 
Sbjct: 525 TVIIFIQGFTAFSPKFDVASFFTAYISLILLAVLFIGCQLYYRCRFFWKVEDIDIDTDRR 584

Query: 537 AIDR 540
            ID 
Sbjct: 585 EIDE 588

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  346 bits (888), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 185/493 (37%), Positives = 282/493 (57%), Gaps = 9/493 (1%)

Query: 49  RLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGE 108
            +K+ LK RHI MIA+                    P   LIAY F+G +++F+   LGE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 109 MATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVN 167
           MAT+IP+    T ++ R+  PA G + GY Y F + I    +++    VIQYW D+  V 
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDK--VP 222

Query: 168 PGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLG 227
              WI IF V+I ++N   V+ +GEFEFW++S K++ + G +++  +I+ GG  +   +G
Sbjct: 223 LAAWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGS-HQGPIG 281

Query: 228 FRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPR 287
           FRYW+NPGA+ P   S   S+G+F+ +V+  + A F Y G EL GI A EA NPR+ +PR
Sbjct: 282 FRYWRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 341

Query: 288 AIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPH 347
           AI   ++RI++FYI+++F +G+ V YN+PRL             PFV++IQN+G  ALP 
Sbjct: 342 AINKVVFRIVIFYIMSLFFIGLLVPYNEPRL---SPSSAVIASSPFVISIQNAGTYALPD 398

Query: 348 IFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXX 407
           IFN  VLI V SA NS++YVG+R LYSLA  G APK F    + GVPY            
Sbjct: 399 IFNAVVLITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLL 458

Query: 408 AYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQP 467
           A++ V++ +   FN+ +++ ++ G+ +W+ I + +I F +A   + + R+   ++A   P
Sbjct: 459 AFLVVNNNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMP 518

Query: 468 YGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLV-KA 526
           YGAY   FF  +I FI+ F  F   F    F T YI L L  + +   ++ YK + + K 
Sbjct: 519 YGAYYASFFVTIIIFIQGFQAFC-PFSVSEFFTSYISLILLAVVFISCQLYYKCRFIWKL 577

Query: 527 EEADLYSFKEAID 539
           E+ D+ S +  I+
Sbjct: 578 EDIDIDSDRREIE 590

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  345 bits (885), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 182/493 (36%), Positives = 283/493 (57%), Gaps = 8/493 (1%)

Query: 49  RLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGE 108
           ++K+ LK RH+ MIA+                    P   LIAY F+G +++F+   LGE
Sbjct: 92  QVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQSLGE 151

Query: 109 MATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVN 167
           MAT+IP+    T ++ R+  PA G A GY Y F + I    +++    VI+YW D+  V 
Sbjct: 152 MATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDK--VP 209

Query: 168 PGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLG 227
              WI IF V+I ++N   V+ +GE EFW++  K++ + G +L+  II+ GG  +   +G
Sbjct: 210 LAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGS-SQGPIG 268

Query: 228 FRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPR 287
           FRYW+NPG + P   S   + G+F+ +V+  + A F Y G EL GI A EA NPR+ +PR
Sbjct: 269 FRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 328

Query: 288 AIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPH 347
           AI   ++RI LFYI+++F +GM V YND RL             PFV++IQN+G + LP 
Sbjct: 329 AINKVVFRIALFYIMSLFFIGMLVPYNDERL---ASTSAVIASSPFVISIQNAGTKVLPD 385

Query: 348 IFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXX 407
           IFN  V+I + SA NS++YVG+R LY+LA+ G APK FA   R+GVPY            
Sbjct: 386 IFNAIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGLL 445

Query: 408 AYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQP 467
           A++ V++ +   FN+ +N+ ++ G+ +W+ I I++I F +A   + + R+   ++A   P
Sbjct: 446 AFLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLMP 505

Query: 468 YGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLV-KA 526
           +GAY   FF  +I FI+ F  F   +D  +F T YI L +  + + G +I Y+ +   + 
Sbjct: 506 FGAYYATFFVTVIIFIQGFQAFSPHWDTTAFFTSYISLIILAVLFIGCQIFYRCRFFWRV 565

Query: 527 EEADLYSFKEAID 539
           E+ D+ S +  I+
Sbjct: 566 EDIDIDSDRREIE 578

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  346 bits (887), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 193/538 (35%), Positives = 293/538 (54%), Gaps = 32/538 (5%)

Query: 4   YEVTKDSKLIREDIIDLEKNTTSSLNSFEQED-------DSNKISDGKEDGVRLKKELKA 56
           Y+  KD  +  E I    KN ++S N   +ED       + +   +G  +  +LK+ L++
Sbjct: 60  YDNEKDDAIRMEKI---SKNHSASSNGTIREDLIMDVDVEKSPSVEGDNEPHKLKQGLQS 116

Query: 57  RHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLD 116
           RH+ +IA+                    PA + I+Y  +  +++ +M  LGEM  ++P D
Sbjct: 117 RHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGD 176

Query: 117 GFTSYA------TRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGV 170
           G  S        TRY D +LGFA G+ Y + Y I+   + TA + V++YW     V  GV
Sbjct: 177 GSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWT--TAVPKGV 234

Query: 171 WITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRY 230
           WITIFL V+V++N   V+ +GE EFW +S KI+ + G+I+  FI+  GGGPNHDRLGFRY
Sbjct: 235 WITIFLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRY 294

Query: 231 WKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAY-LGIELTGIVAAEAENPRRNIPRAI 289
           W++PGAF  +     GS G F       +   FA+ LG EL  + +AE  + RRNI +A 
Sbjct: 295 WQHPGAFAHHLTG--GSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNISKAS 352

Query: 290 KLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXX-XXXXXPFVVAIQNSGVRALPHI 348
           +  ++R+I FY++    + + V YNDP L+             PFV+ IQN+G++ LPHI
Sbjct: 353 RRFVWRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHI 412

Query: 349 FNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXA 408
            N C+L   +SA N+ ++  TRSL ++A  G+APK   + NRWGVPY A          A
Sbjct: 413 INGCILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRINRWGVPYVAVGVSFLCSCLA 472

Query: 409 YMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPF--- 465
           Y+NVSS +A +FN+F N+ +I G L W+   I Y+ F +A     +  N    R PF   
Sbjct: 473 YLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKA-----IFYNGLFDRLPFKTW 527

Query: 466 -QPYGAYITLFFCVLIAFIKNFTVFIGEF-DYKSFITGYIGLPLYVIFYFGYKIIYKT 521
            QPY  + +L    +I     + +FI ++     FI  YI LP++++ +FG+K+  +T
Sbjct: 528 GQPYTVWASLIVVGIITLTNGYAIFIPKYWKIADFIAAYITLPIFLVLWFGHKLYTRT 585

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  345 bits (884), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 189/521 (36%), Positives = 290/521 (55%), Gaps = 14/521 (2%)

Query: 27  SLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPA 86
           S +  E E D +      ED  ++K+ELK RHI MIA+                    P 
Sbjct: 62  SRSRVEPEHDEDAEEADYEDK-QVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGPV 120

Query: 87  SILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFII 145
             LIAY F+G +V+FV   LGEMAT+IP+    T ++ R+  PA G A GY Y F + I 
Sbjct: 121 GALIAYIFMGSIVYFVTQALGEMATFIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAIT 180

Query: 146 TPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVM 205
              +++    VIQYW D   V    WI IF V++ ++N   V+ +GE EFW++  K++ +
Sbjct: 181 FAVEISVVGQVIQYWTD--AVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAI 238

Query: 206 FGVILFLFIIMLGGGPNHDRLGFRYWKNPGAF----KPYSESITGSK--GKFVSFVAVFV 259
            G +L+  II+ GG      +GFRYW+NPGA+        E I  SK  G+F+ +VA  +
Sbjct: 239 VGYLLYALIIVCGGSKKQGPIGFRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVASLI 298

Query: 260 YALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLL 319
            A F Y G EL GI A EA NPR+ +PRAI   ++RI+LFYI+++F +G+ V + D RL 
Sbjct: 299 NAAFTYQGTELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSRL- 357

Query: 320 XXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDG 379
                       PFV++I+N+G + LP IFN  V++ V SA NS++YVG+R LYSLA   
Sbjct: 358 --SDDTTVIASSPFVISIENAGTKILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTK 415

Query: 380 KAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISIL 439
            APK+FA+  R GVP+            A++ V + +   FN+ V++ ++ G+ +W+ I 
Sbjct: 416 VAPKIFARVTRQGVPFMGVICTSLLGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFIS 475

Query: 440 ITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFI 499
           + ++ F +    + + R+   ++A F P+G+Y   F+  +I F++ F  F   FD  +F 
Sbjct: 476 LAHVRFMQVLKQRGISRDDLPFKAKFMPWGSYYAAFWVFVIIFVQGFQAFSPHFDVTTFF 535

Query: 500 TGYIGLPLYVIFYFGYKIIYKTK-LVKAEEADLYSFKEAID 539
           T YI L L  + + G ++ Y+ + L K E+ D+ S +  I+
Sbjct: 536 TDYISLILLAVVFIGAQLYYRCRFLWKLEDVDIDSDRREIE 576

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  343 bits (881), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 183/513 (35%), Positives = 290/513 (56%), Gaps = 8/513 (1%)

Query: 29  NSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASI 88
           ++F  ED      +G+     +K+ELK RHI MIA+                    P   
Sbjct: 63  DTFSMEDGIGDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGA 122

Query: 89  LIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITP 147
           LI+Y F+G L + V   LGEMAT+IP+   FT ++ R+  PA G A GY Y F + I   
Sbjct: 123 LISYLFMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFA 182

Query: 148 NQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFG 207
            +L+    VIQ+W  +  V    WI+IF V+I I+N   V+Y+GEFEFW++S K++ + G
Sbjct: 183 LELSVVGQVIQFWTYK--VPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIG 240

Query: 208 VILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLG 267
            +++ F ++ G G     +GFRYW+NPGA+ P   S   ++G+F+ +V+  + A F + G
Sbjct: 241 FLIYCFCMVCGAGVTGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQG 299

Query: 268 IELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXX 327
            EL GI A EA NPR+++PRAIK  ++RI+ FYI ++  +G+ V YNDP+L         
Sbjct: 300 TELVGITAGEAANPRKSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKL---TQSTSY 356

Query: 328 XXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAK 387
               PF++AI+NSG + LPHIFN  +L  + SA NS++YVG+R L+ L+ +  APK  ++
Sbjct: 357 VSTSPFIIAIENSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSR 416

Query: 388 TNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYR 447
           T + GVPY A          AYM  S+G  ++F + +N+  + G  +W+ I I++I F +
Sbjct: 417 TTKGGVPYIAVFVTAAFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQ 476

Query: 448 ACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPL 507
           A   + + R+   ++A   P  AY    F  +I  I+ FT F  +F+  SF   YI + L
Sbjct: 477 ALKYRGISRDELPFKAKLMPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFL 536

Query: 508 YVIFYFGYKIIYKTKLV-KAEEADLYSFKEAID 539
           ++  +  ++ I++ + + K  + D+ S +  I+
Sbjct: 537 FLAVWILFQCIFRCRFIWKIGDVDIDSDRRDIE 569

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  342 bits (877), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 194/517 (37%), Positives = 288/517 (55%), Gaps = 25/517 (4%)

Query: 16  DIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXX 75
            + +L+  + S+LN+   E         K +   LK+ L++RHI +IA+           
Sbjct: 22  QVFELDTESLSALNTGGSESQ-------KREPHTLKQGLQSRHIQLIALGGVIGTGLFVG 74

Query: 76  XXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTS------YATRYCDPA 129
                    PA +L +Y  + ++++ VM  LGEM  Y+P  G  S        +RY DP+
Sbjct: 75  TSSTLSTCGPAGLLTSYIIISLVIYPVMNALGEMVCYLPGSGTDSGGSISKLVSRYADPS 134

Query: 130 LGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNP-GVWITIFLVVIVIINTVGVR 188
           LGFA G+ Y + Y I+   + TA + V+ YW    TV P   WITIFL V+ ++N   V+
Sbjct: 135 LGFATGWNYYYCYVILIAAECTAASGVVTYW---TTVVPKAAWITIFLGVVTMLNFGPVK 191

Query: 189 YFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSK 248
           ++GE EFW +  KI+ + G++   FI+  GGGP+HDRLGFRYW+ PGAF  +    TG+ 
Sbjct: 192 FYGESEFWFAILKILCIVGLLFVSFILFWGGGPSHDRLGFRYWQKPGAFAYHIT--TGNT 249

Query: 249 GKFVSFVAVFVYALFAY-LGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLL 307
           G+F+      +   FA+ LG EL  + ++EA + RRNI +A +   YR+I FY+ +   +
Sbjct: 250 GRFLDVWTGVIKGGFAFILGPELVAVTSSEAMDQRRNIEKASRRFAYRLIFFYVASALAI 309

Query: 308 GMCVAYNDPRLL-XXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLY 366
           G+ VA NDP L              PFV+AIQN+ ++ LPHI N C+L   +S+ NS ++
Sbjct: 310 GVIVAQNDPVLRDALASGKAGAASSPFVIAIQNAHIKILPHIINACILSSAWSSGNSFMF 369

Query: 367 VGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNV 426
             +RSL S+A DG APK+F K NR GVPYNA          AY+NVSSGSA+ F +F N+
Sbjct: 370 AASRSLLSMAEDGVAPKMFKKINRAGVPYNAVAVSAAFSCLAYLNVSSGSAKAFTWFSNI 429

Query: 427 VSIFGILSWISILITYIFFYRACIAQNV-DRNSFAYRAPFQPYGAYITLFFCVLIAFIKN 485
            +I G + WI I + Y+ F +A   + + DR  F  ++PFQPYG Y  +    +I     
Sbjct: 430 STISGFIGWICIGVAYLRFRKAIFFRGLYDRVPF--KSPFQPYGTYFFIIVVSIICLTNG 487

Query: 486 FTVFIGEF-DYKSFITGYIGLPLYVIFYFGYKIIYKT 521
           +  FI  F     F+  YI LP++V+ + G+KI  +T
Sbjct: 488 YATFIPRFWKGADFVAAYITLPVFVVLWVGHKIYTRT 524

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  342 bits (878), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 188/550 (34%), Positives = 305/550 (55%), Gaps = 22/550 (4%)

Query: 5   EVTKDSKLIREDI--IDLEKNTTSSLNSFEQEDDSNKISDGKE-DG----------VRLK 51
           ++  D K+  + +  +  + +  S   S  +   ++++ DG E DG           ++K
Sbjct: 34  DIVPDEKIRLQKLKHVSTQADVHSVTGSLTRSRLNSRVDDGAESDGSDELEAEVHETKVK 93

Query: 52  KELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMAT 111
           + LK RHI MIA+                    P   LIAY F+G +++FV   LGEMAT
Sbjct: 94  RALKQRHIGMIALGGTIGTGLFVGISTPLSVAGPVGSLIAYIFMGTIIYFVTQSLGEMAT 153

Query: 112 YIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGV 170
           +IP+    T ++ R+  PA G A GY Y F + I    +++    VIQYW   + V    
Sbjct: 154 FIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWT--KAVPLAA 211

Query: 171 WITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRY 230
           WI IF V++ ++N   V+ +GE EFW++  K++ + G +++  +I+ GG  +   +GFRY
Sbjct: 212 WIAIFWVLVTLMNFFPVKVYGEVEFWIAFVKVLAIVGYLIYALVIVCGGS-HQGPIGFRY 270

Query: 231 WKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIK 290
           W++PGAF P   S   + GKF+ +VA  + A F Y G EL GI A EA NPR+ +PRAI 
Sbjct: 271 WRHPGAFGPGIISKNKNTGKFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVPRAIN 330

Query: 291 LTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFN 350
             ++RI+LFYI+++F +GM + YND RL             PFV++I+N+  + LP IFN
Sbjct: 331 KVVFRIVLFYIMSLFFIGMLLPYNDKRL---SAQDAVIASSPFVISIKNAHTKVLPDIFN 387

Query: 351 VCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYM 410
             V++ V SA NS++YVG+R LY+LA+ G APK F+   R+GVPY            A++
Sbjct: 388 AVVMVTVMSAANSNVYVGSRVLYALALTGNAPKQFSYVTRYGVPYLGVVCTASLGLLAFL 447

Query: 411 NVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGA 470
            V++ +   FN+ +N+ ++ G+ +W+ I + +I F +A   + + R+   ++A   P+GA
Sbjct: 448 VVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKLMPWGA 507

Query: 471 YITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTK-LVKAEEA 529
           Y   FF  +I FI+ +  F   +D  +F T YI L L  +   G ++ Y+ + L+K E+ 
Sbjct: 508 YYAAFFVTVIIFIQGYQAFC-PWDVSTFFTSYISLILLAVLVVGCQLYYRGRFLLKLEDI 566

Query: 530 DLYSFKEAID 539
           D+ + +  I+
Sbjct: 567 DIDTDRREIE 576

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  340 bits (873), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 183/521 (35%), Positives = 287/521 (55%), Gaps = 9/521 (1%)

Query: 5   EVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAI 64
           E TK S  + + + D   + T  + S   ++   +  +G      +K+ LK RHISMIA+
Sbjct: 13  ENTKPS--VSKKLEDYVSSETLPIYSHSGDNAPCEKGEGDCRETEVKRALKPRHISMIAL 70

Query: 65  XXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYAT 123
                               P   LIAY F+G +V+FV   LGEMAT+IP+    T ++ 
Sbjct: 71  GGTIGTGLFVGIASPLSESGPVGALIAYIFIGSIVYFVTQSLGEMATFIPVTSSITVFSK 130

Query: 124 RYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIIN 183
           R+  PA G A GY Y F + I    ++     VIQYW D   V    WI IF V++ + N
Sbjct: 131 RFLSPAFGVANGYMYWFNWAITYAVEIAVVGQVIQYWTD--AVPLAAWIAIFWVLVTLAN 188

Query: 184 TVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSES 243
              V+++GE EFW++S K++ + G +++  +I+ GG  +   +GFRYW+NPG + P   S
Sbjct: 189 FFPVKFYGEVEFWVASVKVIAIVGYLIYALVIVCGGS-HQGPIGFRYWRNPGPWGPGIIS 247

Query: 244 ITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVT 303
              ++G+F+ +V+  + A F Y G EL GI A EA NPR+ +PRAI    +RI+ FYI++
Sbjct: 248 KDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAINKVFFRILFFYILS 307

Query: 304 IFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNS 363
           +F +G+ V Y+D RL             PFV++IQN+G + LPHIFN  V+I + SA NS
Sbjct: 308 LFFIGLLVPYDDLRL---SNTTAVIASSPFVISIQNAGTKVLPHIFNAIVMITIISAANS 364

Query: 364 DLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYF 423
           ++YVG+R LYSLA+ G APK F    + GVPY            A++ V++ + + FN+ 
Sbjct: 365 NVYVGSRVLYSLALSGNAPKQFGYVTKQGVPYLGVIVTALLGLLAFLVVNNNANEAFNWL 424

Query: 424 VNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFI 483
           VN+ ++ G+ +W+ I ++++ F +    + + R    ++A   P+GAY   FF  +I  I
Sbjct: 425 VNISTLAGLCAWLFISLSHVRFMQCLKHRGISREDLPFKAKLMPWGAYYAAFFIGVIIII 484

Query: 484 KNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLV 524
           + F  F  +F    F T YI L L  + + G ++ Y+ + +
Sbjct: 485 QGFKAFTPKFRVSDFFTSYISLILLAVLFLGCQLFYRCRFI 525

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  340 bits (873), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 185/530 (34%), Positives = 295/530 (55%), Gaps = 11/530 (2%)

Query: 16  DIIDLEKNTTSSLNSFEQ---EDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXX 72
           D   L + T S  +   Q   E    +I++G+     +K+ELK RHI MIA+        
Sbjct: 22  DDYPLHRRTNSVHSIPSQITIESQEEEIANGQIREAEVKRELKQRHIGMIALGGTIGTGL 81

Query: 73  XXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALG 131
                       P   LIAY F+G LV+ V   LGEMAT+IP+   FT ++ R+  P+ G
Sbjct: 82  FIGLSTPLTNAGPVGALIAYLFMGTLVYSVTQSLGEMATFIPVTSSFTVFSQRFLSPSFG 141

Query: 132 FAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFG 191
            A GY Y F + I    +L+    +IQ+W     +    WI+IF V++V +N   VR++G
Sbjct: 142 AANGYMYWFSWAITFALELSVVGQIIQFWTSAVPIV--AWISIFWVLLVAMNMFPVRFYG 199

Query: 192 EFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKF 251
           EFEFW++S K++ + G +++   ++ G G     +GFRYW+NPG   P   +   ++ KF
Sbjct: 200 EFEFWVASIKVLAIMGFLIYCLCMVCGAGVTGP-VGFRYWRNPGPMGPGIIAKNLNEAKF 258

Query: 252 VSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCV 311
           + +V+  + A F Y G EL GI A EA NPR+++PRAIK  ++RI+ FYI ++F +G+ V
Sbjct: 259 LGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLV 318

Query: 312 AYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRS 371
            YNDP+L             PF+++IQNSG   LPHIFN  +L  + SA NS++YVG+R 
Sbjct: 319 PYNDPKL---TSDDSYVAASPFIISIQNSGTPILPHIFNAVILSTIISAANSNVYVGSRI 375

Query: 372 LYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFG 431
           ++ L+    AP++ ++TN+ GVP+ +          AYM  S+G    FN+ +N+  + G
Sbjct: 376 MFGLSKSKLAPRILSRTNKNGVPWVSVIFTGLFGALAYMETSTGGEAAFNWLLNITGVAG 435

Query: 432 ILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIG 491
             SW+ I I+++ F +A   + + R+   ++A F P  AY  +FF  LI  I+ FT F  
Sbjct: 436 FFSWLFISISHVRFMQALEYRGISRDDLPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCP 495

Query: 492 EFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLV-KAEEADLYSFKEAIDR 540
            FD   F+  YI   L++  +  +++ ++ +L+ K E+ D+ + +  I+ 
Sbjct: 496 SFDGIDFLAAYISCFLFIAIWIVFQLWFRCRLIWKIEDVDIDTDRRDIEE 545

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  338 bits (868), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/526 (36%), Positives = 300/526 (57%), Gaps = 11/526 (2%)

Query: 14  REDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXX 73
           R D +D   + T       + D    I +  +    L++  K RH+ M+AI         
Sbjct: 13  RVDTLDTGNSDTQQNGEVYELDFQEAIGESSQT---LQRGFKQRHVDMLAIAGAIGTGLV 69

Query: 74  XXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLD-GFTSYATRYCDPALGF 132
                      P S+LIA+ F G L+  V+  L EMA++ P+D  F+ YATRY DPALGF
Sbjct: 70  IGTGTALKRGGPGSLLIAFIFTGSLLIGVLMSLAEMASFAPMDKSFSGYATRYVDPALGF 129

Query: 133 AVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGE 192
           A G+ Y  KY I   ++L+A  L++QYW  RE ++  ++I +FLVV++ +N + ++++GE
Sbjct: 130 ATGWNYFLKYAIALASELSAIGLLVQYW--REDLSIAIFIVVFLVVLLSLNFMNIKFYGE 187

Query: 193 FEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFV 252
            EFW +  K +V+    +   ++  GGGP+ + +GFRYW+   AF PY   + G+ G+F+
Sbjct: 188 VEFWSALLKFLVLIICFVTGLVLTCGGGPSKETIGFRYWREY-AFVPYL--VKGTTGRFL 244

Query: 253 SFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVA 312
            + A  + + +AY+G E  G+V  EA NP++ IP A +  ++RI  FYIV + +LG+ ++
Sbjct: 245 GWWACVIQSCYAYIGSETIGVVFGEAPNPKKTIPAATRNVIFRITGFYIVGVLILGLIIS 304

Query: 313 YNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSL 372
            +D  L             PFV+A  N+G++ LP   N  +++F+ SA N+ LYV +R+ 
Sbjct: 305 PHDKTL--ANAKTSDASGSPFVIAFTNAGIKGLPSFINAMLIMFIASAANTALYVCSRTA 362

Query: 373 YSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGI 432
           Y LA DG APK+F   NR+GVP+N           ++MN+S+ S+ IF Y  + V++FG 
Sbjct: 363 YGLAKDGMAPKIFLAQNRYGVPFNGCLLAGLISLLSFMNISNSSSVIFGYLTSSVTVFGT 422

Query: 433 LSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGE 492
           L+W+S+LI+YI + RA +  +V R+   +R  FQPY AY+ LFF  LI F   ++ FI  
Sbjct: 423 LNWLSVLISYIGYERARVFHDVPRDRIPFRMWFQPYSAYVCLFFVSLIIFFNGYSAFIAG 482

Query: 493 FDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAI 538
           F YKSFI  YIG+ +++     +K   K+   + E+      +EAI
Sbjct: 483 FKYKSFIVSYIGIAVFIGNTLFWKFWKKSAATRPEDLRSIMVEEAI 528

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  340 bits (871), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 195/554 (35%), Positives = 298/554 (53%), Gaps = 38/554 (6%)

Query: 19  DLEKNTTSSLNSFEQE----------------DDSNKISDGKEDGV---RLKKELKARHI 59
           + EK TT++ N F+Q+                  +N+  +G +D     +L++ L ARHI
Sbjct: 6   EKEKETTTNGNLFDQKTGQVLEIDLESLTPEGSSTNRGINGNKDAKLEGKLQQGLSARHI 65

Query: 60  SMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFT 119
            +IA+                    PA + I+Y  +  +++ +M   GEM  Y+P +G  
Sbjct: 66  QLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIISTVLYPIMNAFGEMVCYLPGNGDD 125

Query: 120 SYAT------RYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWIT 173
           S  +      RY DP+L FA G+ Y + Y I+   + TA + V++YW D   V    WIT
Sbjct: 126 SAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAAECTAASGVVKYWTD--AVPTAAWIT 183

Query: 174 IFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKN 233
           IFL ++V++N   V+Y+GE EFW +S K++ + G+I+  FI+  GGGPNHDRLGFRYWKN
Sbjct: 184 IFLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGLIILSFILFWGGGPNHDRLGFRYWKN 243

Query: 234 PGAFKPYSESITGSK-GKFVSFVAVFVYALFAY-LGIELTGIVAAEAENPRRNIPRAIKL 291
           PG F   +  ITG   G F+   +  +   FA+ LG EL  + ++E ++ RRNI +A K 
Sbjct: 244 PGGF---AHHITGGNLGNFLDVYSGIIKGAFAFILGPELIALASSECKDQRRNIMKASKR 300

Query: 292 TMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXX-XXXXXPFVVAIQNSGVRALPHIFN 350
            ++R++ FYI+    + + VA NDP L              PFV+ IQN+G++ LPHI N
Sbjct: 301 FVWRLMFFYILGALSISVIVASNDPALTSALASGKPGAGSSPFVIGIQNAGIKILPHIIN 360

Query: 351 VCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYM 410
            C+L   +SA N+ ++  +RSL ++A +G+APK+F K NR+GVP+ A          AY+
Sbjct: 361 ACILTSAWSAGNAFMFASSRSLLTMASNGQAPKIFGKINRFGVPWVAVTFSALISCLAYL 420

Query: 411 NVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGA 470
           NVSS +A +F +F N+ +I G + W   L+ Y+ F R  I  N   N   Y   FQ Y  
Sbjct: 421 NVSSSTADVFAWFTNISTISGFIGWDCGLVAYLRF-RKAIKYNGLENRLPYAPRFQQYMV 479

Query: 471 YITLFFCVLIAFIKNFTVFIGEF-DYKSFITGYIGLPLYVIFYFGYKII---YKTKLVKA 526
           + ++    L+ F   + VFI  F +   FI  YI LPL+V+ + G+KI    +K      
Sbjct: 480 WWSILVVTLVIFTNGYQVFIPRFWNVSDFIAAYITLPLFVVLWIGHKIYTRDFKKWWYPV 539

Query: 527 EEADLYSFKEAIDR 540
           EE D+ +    I+ 
Sbjct: 540 EEIDVVTGLTEIEE 553

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  340 bits (871), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 190/493 (38%), Positives = 280/493 (56%), Gaps = 10/493 (2%)

Query: 34  EDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYS 93
           E+D +  + G  +  ++K+ELK RHI MIA+                    P   LIAY 
Sbjct: 88  EEDID--ATGVVEEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYI 145

Query: 94  FVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTA 152
           F+G LVF V   LGEMAT+IP+   FT +A+R+     G A GY Y F + I    +L+ 
Sbjct: 146 FMGTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSV 205

Query: 153 GALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFL 212
              VI++W  +  V    WI+IF V+IVI+N   V+ +GEFEFW++S K++ + G I++ 
Sbjct: 206 VGQVIEFWTFK--VPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYC 263

Query: 213 FIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTG 272
             ++ G G     +GFRYW++PG + P   S   ++ +F+ +V+  + A F Y G EL G
Sbjct: 264 LCMVCGAGIT-GPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVG 322

Query: 273 IVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXP 332
           I A EA NPR+++PRAIK    RI+LFYI+++F +G+ V YNDP+L             P
Sbjct: 323 ITAGEAANPRKSVPRAIKKVSVRILLFYILSLFFIGLLVPYNDPKL---SSTDSYVSASP 379

Query: 333 FVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWG 392
           F++AIQNSG + LPHIFN  +L  + SA NS++YVG+R LY L+    APK F KT R G
Sbjct: 380 FIIAIQNSGTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQKT-RNG 438

Query: 393 VPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQ 452
           VP+ A          AYM  S+G    FN+ +N+  + G  +W+SI I++I F +    +
Sbjct: 439 VPFIAVLFTAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHR 498

Query: 453 NVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFY 512
            + R+   Y+A   P  AY   FF  LI  I+ FT F  +FD  +F+T YI   L++  Y
Sbjct: 499 GMSRDDLPYKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIY 558

Query: 513 FGYKIIYKTKLVK 525
              +  ++T+L +
Sbjct: 559 IVAQCYFRTRLWR 571

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  342 bits (876), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 192/534 (35%), Positives = 292/534 (54%), Gaps = 28/534 (5%)

Query: 4   YEVTKDSKLIREDIIDLEKNTTSSLNSFEQED---DSNKISDGKEDGVRLKKELKARHIS 60
           YE  KD  +  E I    KN ++S N   +E+   + +  +DG     RLK+ L++RH+ 
Sbjct: 116 YEAEKDDAIRMEKI---SKNQSASSNGTVREELDLEKSPSADGDAGPHRLKQGLQSRHVQ 172

Query: 61  MIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTS 120
           +IA+                    PA + I+Y  +  +++ +M  LGEM  ++P DG  S
Sbjct: 173 LIALGGAIGTGLLVGTSSTLHTCGPAGLFISYIIISAVIYPIMCALGEMVCFLPGDGSDS 232

Query: 121 YA------TRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITI 174
                   TRY D +LGFA G+ Y + Y I+   + TA + V++YW     V  GVWITI
Sbjct: 233 AGSSANLVTRYVDASLGFATGWNYYYCYVILVAAECTAASGVVEYWT--TAVPKGVWITI 290

Query: 175 FLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNP 234
           FL V+V++N   V+ +GE EFW +S KI+ + G+I+  FI+  GGGP HDRLGFRYW++P
Sbjct: 291 FLCVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFRYWQHP 350

Query: 235 GAFKPYSESITGSKGKFVSFVAVFVYALFAY-LGIELTGIVAAEAENPRRNIPRAIKLTM 293
           G+F  +     GS G F       +   FA+ LG EL  + +AE  + RRNI +A +  +
Sbjct: 351 GSFAHHLAG--GSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKASRRFV 408

Query: 294 YRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXX-XXXXXPFVVAIQNSGVRALPHIFNVC 352
           +R+I FY++    + + V YNDP L+             P+V+ IQN+G++ LPHI N C
Sbjct: 409 WRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKPGAGSSPYVIGIQNAGIKVLPHIINGC 468

Query: 353 VLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNV 412
           +L   +SA N+ ++  TRSL ++A  G+APK   K NR+GVPY A          AY+NV
Sbjct: 469 ILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRFGVPYVAVGVSFLCSCLAYLNV 528

Query: 413 SSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPF----QPY 468
           SS +A +FN+F N+ +I G L WI   I Y+ F +A     +  N    R PF    QPY
Sbjct: 529 SSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKA-----IFFNGLYDRLPFKTWGQPY 583

Query: 469 GAYITLFFCVLIAFIKNFTVFIGEF-DYKSFITGYIGLPLYVIFYFGYKIIYKT 521
             + +L    +I     + +FI ++ +   FI  YI LP++++ + G+K+  +T
Sbjct: 584 TVWFSLTVVSIITITNGYAIFIPKYWNVADFIAAYITLPIFLVLWLGHKLYTRT 637

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  338 bits (868), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 188/527 (35%), Positives = 297/527 (56%), Gaps = 14/527 (2%)

Query: 19  DLEKNTTSSLNSFEQEDDSNKISDGKEDG----VRLKKELKARHISMIAIXXXXXXXXXX 74
            L  N + + NS     D + +SD +E G     R+K+ LK RHI MIA+          
Sbjct: 60  QLSYNVSVADNSSAANGDLD-LSDTEEAGHVQDTRVKRALKQRHIGMIALGGTIGTGLFV 118

Query: 75  XXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFA 133
                     P   LIAY F+G +++F+   LGEMAT+IP+    T ++ R+  PA G  
Sbjct: 119 GISTPLGNAGPVGALIAYIFMGSIIYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVT 178

Query: 134 VGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEF 193
            GY Y F + I    +++    VIQYW D   V    WI IF V + ++N   V+ +GE 
Sbjct: 179 NGYMYWFNWAITYAVEISVVGQVIQYWTD--AVPLAAWIAIFWVFVTLLNFFPVKVYGEV 236

Query: 194 EFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVS 253
           EFW++S K++ + G +++  +I+ GG  +   +GFRYW+NPG + P   S   ++G+F+ 
Sbjct: 237 EFWVASIKVLAIIGYLIYALVIVCGGS-SQGPIGFRYWRNPGPWGPGIISKDVNEGRFLG 295

Query: 254 FVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAY 313
           +V+  + A F Y G EL GI A EA NPR+++PRAI   ++RI LFYI+++F +G+ V Y
Sbjct: 296 WVSSLINAAFTYQGTELVGITAGEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPY 355

Query: 314 NDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLY 373
           ND  L             PFV++IQN+G  ALP IFN  V++ + SA NS++YVG+R LY
Sbjct: 356 NDHTL---SSGDSYIASSPFVISIQNAGTYALPDIFNAVVMLTIISAANSNVYVGSRVLY 412

Query: 374 SLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGIL 433
           +LA  G APK FA   + GVP+            A++ V++ +   FN+ +N+ ++ G+ 
Sbjct: 413 ALAQTGNAPKQFAYVTKHGVPWLGVIVTASLGLLAFLVVNNNANTAFNWLINISTLAGLC 472

Query: 434 SWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEF 493
           +W  I +++I F +A   + + R+   ++A   P+GAY + FF  +I FI+ F  F   +
Sbjct: 473 AWFFIALSHIRFMQALKYRGISRDDLPFKAKLMPWGAYYSAFFVFVIIFIQGFEAFT-PW 531

Query: 494 DYKSFITGYIGLPLYVIFYFGYKIIYKTK-LVKAEEADLYSFKEAID 539
           D  +F T YI L L V+ + G ++ Y+ + L+K E+ D+ + +  I+
Sbjct: 532 DTTTFFTSYISLILLVVVFIGCQLYYRCRFLLKVEDIDIDTDRREIE 578

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  337 bits (865), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 184/517 (35%), Positives = 289/517 (55%), Gaps = 15/517 (2%)

Query: 15  EDIIDLEKNTTSSLNSFEQEDDSNKISD--GKEDGVRLKKELKARHISMIAIXXXXXXXX 72
           +D +   K+   +L + +  DDS+++ D  G      +K+ LK RH+SMIA+        
Sbjct: 38  DDPLRFSKDNNLTLEAID--DDSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGL 95

Query: 73  XXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALG 131
                       P   LIA+  +G L + V   LGEMAT+IP+   FT ++ R+  PA+G
Sbjct: 96  FISISGPLWNAGPVGSLIAFMLIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVG 155

Query: 132 FAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFG 191
            A GY Y F + I    +L+    +IQYW D   +    WI IF V++V  N   V+++G
Sbjct: 156 AANGYMYWFSWAITFALELSIVGQIIQYWTDAVPLE--AWIAIFWVLLVSFNMFPVKWYG 213

Query: 192 EFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITG---SK 248
           EFEFW++S K++ + G +++   ++ G GP    +GFRYW+ PG   P+   I     +K
Sbjct: 214 EFEFWVASIKVIAIIGFLIYSLCMVCGAGP-EGPIGFRYWRKPG---PWGNGIIAKNVNK 269

Query: 249 GKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLG 308
            +F+ +V+  + A F Y G EL GI A E +NPR+ +PRAI    +RI++FYI ++F +G
Sbjct: 270 ARFLGWVSSLISAAFTYQGTELVGITAGETKNPRKAVPRAINKVFFRILIFYIGSLFFIG 329

Query: 309 MCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVG 368
           + V YNDP+L             PF++AI N     LPHIFN  +L  + SA NS++YVG
Sbjct: 330 LLVPYNDPKL-EGSDNGSYIAQSPFLIAILNCRTPVLPHIFNAVILTTIISAGNSNVYVG 388

Query: 369 TRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVS 428
           +R L+ L+ +  APK F+KT + GVP+ A          AY+NVS+ + ++F++ +N+ +
Sbjct: 389 SRILFGLSKNNLAPKFFSKTTKHGVPFIAVLITAVFGFLAYLNVSNDAQEVFDWLLNITA 448

Query: 429 IFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTV 488
           I G ++W+ I I++I F +    + + R+   Y+A F PY AY   FF  +I  I+ FT 
Sbjct: 449 IAGFITWLLISISHIRFMQTLKHRGISRDDLPYKAKFMPYAAYYAAFFITVIIIIQGFTA 508

Query: 489 FIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVK 525
           F   F+   F   YI + L+ I +  ++ IY+TKL +
Sbjct: 509 FAPHFNVSDFFAAYISVFLFFIVWAIFQTIYRTKLFR 545

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  337 bits (864), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 189/529 (35%), Positives = 293/529 (55%), Gaps = 21/529 (3%)

Query: 28  LNSFEQEDDSNKISDGKED--GVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXP 85
           ++ F     + K S    D  G  LK+ LK+RH+ +IA+                    P
Sbjct: 51  VDVFSLSSSTEKHSPHYTDMTGHELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGP 110

Query: 86  ASILIAYSFVGILVFFVMACLGEMATYIP-----LDGFTSY-ATRYCDPALGFAVGYCYL 139
           A + I+Y  +  +++ +M  +GEM  Y+P      +GF +Y   +Y D +LGFA  + Y 
Sbjct: 111 AGLFISYCIISSVIYPIMQGIGEMVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYY 170

Query: 140 FKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSS 199
           + Y I+   + TA + V++YW    +V    WITIFL  +VI+N   V+++GE EFW +S
Sbjct: 171 YCYVILVAAECTAASGVVEYWTT--SVPKAAWITIFLAAVVILNFTAVKFYGESEFWFAS 228

Query: 200 FKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFV 259
            KI+ + G+I+  FI+  GGGPNHDRLGFRYW+NPG F  +     GS G F+      +
Sbjct: 229 IKILCIVGLIILSFILFWGGGPNHDRLGFRYWQNPGGFAHHIRG--GSFGSFLDIYTGII 286

Query: 260 YALFAY-LGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRL 318
              FA+ LG E+  + ++E E+ RRNI +A +  ++R++ FYI+    + + VAYNDP L
Sbjct: 287 KGGFAFILGPEMIAMTSSEVEDQRRNIAKAARRFVWRLMFFYILGALSISVIVAYNDPAL 346

Query: 319 LXXXXXXX-XXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAI 377
                         PFV+ IQN+G++ LPHI N C+L   +SA N+ ++  +RSL ++A 
Sbjct: 347 ENALAQNKPGAGSSPFVIGIQNAGIKVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQ 406

Query: 378 DGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWIS 437
           +G+AP++FAK NRWGVPY A          AY+N SS +A +FN+F N+  I G + WI 
Sbjct: 407 NGQAPRIFAKVNRWGVPYYAVGLSSAISCLAYLNCSSSTADVFNWFSNISVISGFIGWIC 466

Query: 438 ILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEF-DYK 496
           + I YI F++A +   + ++   Y A   PY  Y  L    +I     + VFI  F D K
Sbjct: 467 VCIAYIRFHKAILFHGM-QSRLPYTARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAK 525

Query: 497 SFITGYIGLPLYVIFYFGYKI----IYKTKLVKA-EEADLYSFKEAIDR 540
           +F+  YI LP++ + + G+++    I+  K  K+ EE D+ +  E I+ 
Sbjct: 526 NFVAAYITLPVFWVLWIGHRVYRRKIFTLKWWKSIEEIDVVTGVEEIEE 574

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  337 bits (863), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 190/520 (36%), Positives = 291/520 (55%), Gaps = 23/520 (4%)

Query: 16  DIIDLE-KNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXX 74
           + +D+E + +TSS    E+  D +  +D   +   L++ LK+RHI MIA+          
Sbjct: 42  EFVDVESQQSTSSATISEKLGDGDGDADPFANEGSLQQGLKSRHIQMIALGGAIGTGLFV 101

Query: 75  XXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTSYAT------RYCDP 128
                     PA + I+Y  +  +V+ +M   GEM  Y+P +G  +  +      RY D 
Sbjct: 102 GTSSTLALCGPAGLFISYIIISSVVYPIMCGFGEMVCYLPGNGNDASGSAAHLVARYVDK 161

Query: 129 ALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVR 188
           +LGFA  + Y + Y I+   + TA + V++YW     V  GVWI IFL ++VI+N   V+
Sbjct: 162 SLGFATAWNYYYCYIILVAAECTAASGVVEYWT--VAVPKGVWILIFLGIVVILNFGPVK 219

Query: 189 YFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSK 248
           Y+GE EFW +S KI+ + G+I+  FI+  GGGPNHDRLGFRYW+ PGAF  +   + G  
Sbjct: 220 YYGEAEFWFASIKILCIVGLIILSFILFWGGGPNHDRLGFRYWQRPGAFTEHI--MKGGF 277

Query: 249 GKFVSFVAVFVYALFAY-LGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLL 307
           G+F+   +  +   FA+ LG EL  + +AE E+ RRNI +A +  ++R++ FY++    +
Sbjct: 278 GRFLDIYSGVIKGGFAFILGPELVCLTSAECEDQRRNIAKAARRFIWRLMFFYVLGTLAI 337

Query: 308 GMCVAYNDPRLLXXXXXXX-XXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLY 366
            + VAYNDP L+             PFV+ IQN+G+R LPHI N C+L   +SA N+ ++
Sbjct: 338 SVIVAYNDPSLVSALASGKPGAGSSPFVIGIQNAGIRVLPHIINACILSSAWSAGNAFMF 397

Query: 367 VGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNV 426
             TRSL ++A +G AP++F K NR+GVPY A          A++NVSS +A +FN+F N+
Sbjct: 398 ASTRSLLTMARNGDAPRVFGKINRFGVPYVAISLSGGLSCLAFLNVSSSTADVFNWFSNI 457

Query: 427 VSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPF----QPYGAYITLFFCVLIAF 482
            +I G + WI   + YI F +A     +  N    R PF    QPY  Y +LF   LI  
Sbjct: 458 STISGFIGWICGCVAYIRFRKA-----IFFNGMYDRLPFKTWGQPYAVYYSLFVISLITL 512

Query: 483 IKNFTVFIGE-FDYKSFITGYIGLPLYVIFYFGYKIIYKT 521
              +  FI + +    F+  YI LP++V+ + G+K+  +T
Sbjct: 513 TNGYATFIPKNWKGSDFVAAYITLPIFVVLWVGHKLWTRT 552

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  337 bits (864), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 183/521 (35%), Positives = 287/521 (55%), Gaps = 14/521 (2%)

Query: 21  EKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXX 80
           ++ +T  L S + E     + +GK     +K+ LK RH+SMIA+                
Sbjct: 92  DEPSTDPLGS-DTESGEGDMQEGK-----VKRALKPRHVSMIALGGTIGTGLFVGIASPL 145

Query: 81  XXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYL 139
               P   LIAY F+G +V+FV   +GEMAT+IP+    T +++R+  PA G A GY Y 
Sbjct: 146 SYSGPVGALIAYIFMGTVVYFVTQSMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYW 205

Query: 140 FKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSS 199
           F + I    +L+    VI+YW   E V    WI IF V++ + N   V+++GE EFW++S
Sbjct: 206 FNWAITFAVELSVTGQVIEYWT--EAVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVAS 263

Query: 200 FKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFV 259
            K++ + G +++  +I+ GG      +GFRYW+NPG +     S    +G+F+ +VA  +
Sbjct: 264 IKVLAIVGYLIYALVIVCGGS-KQGPIGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLI 322

Query: 260 YALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLL 319
            A F Y G EL GI A EA NPRR +PRAI    +RI+ FYI+++F +G+ V YN   L 
Sbjct: 323 NASFTYQGTELVGITAGEAANPRRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSL- 381

Query: 320 XXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDG 379
                       PFV++IQN+G RALP IFN  VL+ + SA NS++YVG+R L+SLA  G
Sbjct: 382 --DKTTTVIASSPFVISIQNAGTRALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTG 439

Query: 380 KAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISIL 439
            APK+F+     GVP+            A++ V+  + + FN+ +N+ ++ G+ +W+ I 
Sbjct: 440 IAPKVFSSVTPQGVPFMGVIVTSLLGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFIS 499

Query: 440 ITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFI 499
           I++I F +    + + R+   +++   PYGAY   F+  +I F++ F  F   F    F 
Sbjct: 500 ISHIRFMQCLKQRGISRDDLPFKSKLMPYGAYYAAFWVTVIIFVQGFQAFSPHFKVTEFF 559

Query: 500 TGYIGLPLYVIFYFGYKIIYKTKLV-KAEEADLYSFKEAID 539
           T YI L L V+ + G ++ Y+ +   + E+ D+ S +   D
Sbjct: 560 TSYISLMLLVVVFCGAQLFYRCRFFNRLEDIDIDSDRREAD 600

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  336 bits (862), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 187/507 (36%), Positives = 284/507 (56%), Gaps = 9/507 (1%)

Query: 35  DDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSF 94
           D+S   + GK    ++K+ LK RH+ MIA+                    P   LIAY F
Sbjct: 87  DESGLPAKGKFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIF 146

Query: 95  VGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAG 153
           +G +V+FV   LGEMAT+IP+    T +  R+  PALG + GY Y F + I    +L+  
Sbjct: 147 MGSVVYFVTQSLGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVT 206

Query: 154 ALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLF 213
             +IQYW  +  V    WI IF V++ ++N   V+ +GE EFW+SS K++ + G +++  
Sbjct: 207 GQIIQYWTYK--VPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYAL 264

Query: 214 IIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGI 273
           +I+ GG      +GFRYW++  AF     S    + +F+ +V+  + A F Y G EL GI
Sbjct: 265 VIVCGGS-RQGPIGFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGI 323

Query: 274 VAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPF 333
            A EA NPR+ +PRAI   ++RI LFYI+++F +G+ V YND RL             PF
Sbjct: 324 SAGEAANPRKTVPRAINKVIFRIALFYILSLFFIGLLVPYNDKRL---SDGSAIIASSPF 380

Query: 334 VVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGV 393
           V+++ N+G  ALP IFN  +LI V SA NSD+Y+ +R LY+LA  G APK F   NR+GV
Sbjct: 381 VISMLNAGTSALPDIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGV 440

Query: 394 PYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQN 453
           PY            A++ VS+ +   FN+ +N+ ++ G+ +W  I   +I F +A   + 
Sbjct: 441 PYLGVFVTCLVGWLAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKG 500

Query: 454 VDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYF 513
           + R+   ++A F P+GAY   FF  LI FI+ +  F   +D KSF T YI L L+ + Y 
Sbjct: 501 ISRDDLPFKARFMPWGAYYAAFFVGLIIFIQGYDAFT-PWDTKSFFTSYISLILFGVLYL 559

Query: 514 GYKIIYKTK-LVKAEEADLYSFKEAID 539
           G  I Y+ + L+K E+ D+ + ++ ++
Sbjct: 560 GCLIYYRGRLLIKIEDIDIDTDRKEVE 586

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  334 bits (856), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 182/502 (36%), Positives = 281/502 (55%), Gaps = 8/502 (1%)

Query: 40  ISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILV 99
           + +G+     +K+ LK RHI MIA+                    P   LIAY F+  LV
Sbjct: 67  VKEGQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATLV 126

Query: 100 FFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQ 158
           + V+  LGEMAT+IP+   FT +++R+  PA G A GY Y F + I    +L+    +I+
Sbjct: 127 YSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQIIE 186

Query: 159 YWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLG 218
           +W     V    WITIF V++ + N   V+Y+GEFEFW++  K++ + G I++   ++ G
Sbjct: 187 FW--TTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCG 244

Query: 219 GGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEA 278
            G     +GFRYW+NPGA+ P   S   ++G+F+ +V+  + A F Y G EL GI A EA
Sbjct: 245 AGITGP-VGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEA 303

Query: 279 ENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQ 338
            NPR+++PRAIK  ++RI++FY      +G+ V YNDP+L             PF++AI+
Sbjct: 304 ANPRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKL---NSSDSYVSSSPFIIAIE 360

Query: 339 NSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAX 398
           NSG + LPHIFN  VL  + SA NS++YVG+R +Y LA    AP  F +TN  GVPY A 
Sbjct: 361 NSGTKVLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAV 420

Query: 399 XXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNS 458
                    AYM +S+G A  FN+ +N+  + G  +W+ I   +I F +A   + + R+ 
Sbjct: 421 FFTSAFGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDD 480

Query: 459 FAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKII 518
             ++A F P+ AY  LFF V+I  I+ FT F   F    F   Y+ + L++  + G +I 
Sbjct: 481 LPFKAKFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIW 540

Query: 519 YKTKLV-KAEEADLYSFKEAID 539
           ++ ++  + +E D+ + +  I+
Sbjct: 541 FRCRIFHRLDEVDIDTDRRDIE 562

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  332 bits (852), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 187/520 (35%), Positives = 284/520 (54%), Gaps = 14/520 (2%)

Query: 22  KNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXX 81
           +N  S  NS   EDD   + +G+     +K+ LK RH+SMIA+                 
Sbjct: 32  QNGGSGHNS-SFEDDEGDLQEGQ-----VKRALKPRHVSMIALGGTIGTGLFVGIASPLS 85

Query: 82  XXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLF 140
              P   LIAY F+G +V+FV   +GEMAT+IP+    T ++ R+  PA G A GY Y F
Sbjct: 86  SAGPVGALIAYIFMGSIVYFVTQSMGEMATFIPVTSSITVFSNRFLSPAFGVANGYMYWF 145

Query: 141 KYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSF 200
            + I    +++    VIQYW   + V    WI IF V I + N   VR++GE EFW++S 
Sbjct: 146 NWAITYAVEISVIGQVIQYW--TKAVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASI 203

Query: 201 KIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVY 260
           K++ + G +L+  II+ GG      +GFRYW+NPG +     S    KG+F+ +VA  + 
Sbjct: 204 KVIAIVGYLLYALIIVCGGS-KQGPIGFRYWRNPGPWGDGIISGDKDKGRFLGWVASLIN 262

Query: 261 ALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLX 320
           A F Y G EL GI A EA NPR+ +P+AI    +RI+ FYI+++F +G+ V YN P L  
Sbjct: 263 ASFTYQGTELVGITAGEAANPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPGL-- 320

Query: 321 XXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGK 380
                      PFV++IQ++G R LP IFN  VL+ + SA NS++YVG+R L+SLA  G 
Sbjct: 321 -DKHTSVIASSPFVISIQSAGTRILPDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGI 379

Query: 381 APKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILI 440
           APK F+     GVPY            A++ V   + + FN+ +N+ ++ G+ +W+ I I
Sbjct: 380 APKQFSYVTNQGVPYLGVICTALLGLLAFLVVDDNANEGFNWLINISTLAGLCAWLFISI 439

Query: 441 TYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFIT 500
           ++I F +    + + R+   +++   PYGAY   F+  +I F++ F  F  +F    F T
Sbjct: 440 SHIRFMQCLKQRGISRDDLPFKSKLMPYGAYYAAFWVAVIIFVQGFQAFCPKFKVAEFFT 499

Query: 501 GYIGLPLYVIFYFGYKIIYKTKLV-KAEEADLYSFKEAID 539
           GYI L L  + +   ++ Y+ +   + E+ D+ S +  ID
Sbjct: 500 GYISLILLAVVFCLAQLYYRCRFFNRLEDIDIDSDRREID 539

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  333 bits (855), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 189/531 (35%), Positives = 296/531 (55%), Gaps = 21/531 (3%)

Query: 19  DLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXX 78
           +L+  + + ++S + E +  +  +       LK+ LK+RHI +IA+              
Sbjct: 65  ELQTTSPTIIDSIDDEAEKEQGKERSSSNGELKQGLKSRHIQLIALGGTIGTSLLVGTSS 124

Query: 79  XXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTSYAT------RYCDPALGF 132
                 PA + I+Y  +   V+ +M  LGEM  ++P +G  S  +      +Y DP+LGF
Sbjct: 125 ALANCGPAGLFISYLIISTFVYPIMNALGEMVCFLPGNGSDSAGSAAHLVHKYVDPSLGF 184

Query: 133 AVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGE 192
           A  + Y + + I+   +++A + VI+YW   E V  G WITIFL +IVI+N + V  +GE
Sbjct: 185 AASWNYYYCFVILVAAEVSAASGVIEYWAWAEHVPKGAWITIFLSLIVILNFLPVNVYGE 244

Query: 193 FEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDR-LGFRYWKNPGAFKPYSESITGSKG-K 250
            EFW +S KI+ + G+I+  FI+  GGGP  D  LGFRYWKNPG+F   +  ITG  G  
Sbjct: 245 SEFWFASIKILCITGLIILSFILFWGGGPKSDGILGFRYWKNPGSF---AHHITGGGGGN 301

Query: 251 FVSFVAVFVYALFAY-LGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGM 309
           F+      +   F+  LG EL  + ++E  + RRNI +A K  ++R++ FYI+    +G+
Sbjct: 302 FLDIYTGIIKGGFSVILGPELVCLTSSECADQRRNIAKASKRFVWRLMFFYILGSLSIGV 361

Query: 310 CVAYNDPRLLXXXXXXXXXX-XXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVG 368
            VAYNDP L              PFV+ IQN+G+RA+PHI N C+L   +SA N+ ++  
Sbjct: 362 IVAYNDPVLQNALAQSKAGAGSSPFVIGIQNAGIRAVPHIVNFCILTSAWSAGNAYMFAS 421

Query: 369 TRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVS 428
           +RSL ++A +G APK+F + N+ GVPY A          AY+NVSS +A +FN+F N+ +
Sbjct: 422 SRSLLTMARNGNAPKIFCRINQLGVPYTAVGASLLLSCLAYLNVSSSTADVFNWFSNIST 481

Query: 429 IFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTV 488
           I G + WI   + YI F R  I  N   +   +RA  Q Y  + +LF+  LI     + +
Sbjct: 482 ISGFIGWICACVAYIRF-RKAITYNKLTHRIPFRAKGQQYTIWYSLFWVSLITLTNGYAI 540

Query: 489 FIGE-FDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKA-----EEADLYS 533
           FI   ++ K FI  YI LP++++ + G+K+  +T L+KA     ++ D+Y+
Sbjct: 541 FIPRNWNVKDFIAAYITLPIFIVLWIGHKVFTRT-LLKAWLRPIDKIDVYT 590

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  333 bits (853), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 184/511 (36%), Positives = 288/511 (56%), Gaps = 11/511 (2%)

Query: 34  EDDSNKISDGKEDGVR---LKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILI 90
           +  +N  +   E+ V+   +K+ LK RHI+MIA+                    P   LI
Sbjct: 74  QSATNTGTLCTEEHVKHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALI 133

Query: 91  AYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQ 149
           AY FVG ++F V   LGEM T+IP+   FT ++ R+  PA G A GY Y F + +    +
Sbjct: 134 AYIFVGTIIFSVTQSLGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVE 193

Query: 150 LTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVI 209
           L+    VIQ+W     V    WI IF  ++ + N   V+Y+GE EFW++  K++ + G +
Sbjct: 194 LSVLGKVIQFWTT--AVPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFL 251

Query: 210 LFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIE 269
           +F   I  G GP H   GFRYW++PGA+ P   +   S+ +F+ +V+  + A F Y G E
Sbjct: 252 IFCLCITSGAGP-HGPFGFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGTE 310

Query: 270 LTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXX 329
           L GI A EA NPR+ +P+AIK  + RI+ FY+ ++F +GM V +NDP+L           
Sbjct: 311 LVGITAGEAANPRKAVPKAIKKVILRILFFYVGSLFFIGMLVPFNDPKL---TSATSFVS 367

Query: 330 XXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTN 389
             PF++AIQNSGV  LP IFN  +LI + SA NS++YVG+R L+ LA    AP+ F +T 
Sbjct: 368 SSPFIIAIQNSGVSLLPSIFNGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTT 427

Query: 390 RWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRAC 449
           + GVP+ A          A++ +++   ++FN+ +++V+I G  +W+ I +++I F +A 
Sbjct: 428 KTGVPFVAVLFTSLFGSLAFLELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKAL 487

Query: 450 IAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYV 509
             + + RNS  ++A F P+ AY    F +LI  I+ FT F   F+   F+  YI L L+V
Sbjct: 488 EYRGISRNSLPFKAIFMPWLAYYATAFIILIILIQGFTAFAPRFNVSDFVASYISLLLFV 547

Query: 510 IFYFGYKIIYKTKLV-KAEEADLYSFKEAID 539
           I +  ++ + K ++  K E+ DL S ++ I+
Sbjct: 548 IIWGVFQAMKKCRIFWKVEDIDLDSDRKDIE 578

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  332 bits (851), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 191/520 (36%), Positives = 284/520 (54%), Gaps = 31/520 (5%)

Query: 8   KDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXX 67
           KDS L +     L  ++ +S NS E ED +N           LK+ LK+RH+ +IA+   
Sbjct: 48  KDSGLNKV----LTVSSDTSTNSLE-EDYTNT----------LKQGLKSRHVQLIALGGC 92

Query: 68  XXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTSYAT---- 123
                            PA + IAY  +  +++ +M  +GEM  Y+P DG  S  +    
Sbjct: 93  IGTGLFVGTSSTLHTCGPAGLFIAYCIISSVIYPIMNAVGEMVCYLPGDGHDSAGSVTHL 152

Query: 124 --RYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVI 181
             RY D +L FA G+ Y + Y I+   + TA A V++YW     V    WITIFL +I +
Sbjct: 153 VKRYVDESLAFATGWNYFYCYVILVAAECTAAAGVVEYWT--LAVPKAAWITIFLAIIFL 210

Query: 182 INTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYS 241
           +N   V+YFGE EFW +S KI+ + G+I+  FI+  GGGP+HDRLGFRYWKNPGAF  + 
Sbjct: 211 LNMSSVKYFGETEFWFASIKILCIMGLIILSFILFWGGGPSHDRLGFRYWKNPGAFAHHV 270

Query: 242 ESITGSKGKFVSFVAVFVYALFAY-LGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFY 300
               GS G F+   +  +   FA+ LG EL  + ++E  + RRNI +A K  +YR++ FY
Sbjct: 271 TD--GSLGNFLDIYSGIIKGAFAFILGPELVALTSSECSDQRRNIAKASKRFIYRLMFFY 328

Query: 301 IVTIFLLGMCVAYNDPRLLXXXXXXX-XXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFS 359
           I+    +G+ VA+NDP L              PFV+ IQN+G+  LPHI N C+L   +S
Sbjct: 329 ILGTLAIGVIVAWNDPVLASALSNNTPGAGSSPFVIGIQNAGIEVLPHIINACILTSAWS 388

Query: 360 ACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQI 419
           + N+ ++  +RSL+++A +G APK+F + N++GVPY A          AY+N SS +A++
Sbjct: 389 SGNAFMFASSRSLFTMAQNGTAPKIFGRINKYGVPYMAVILSTLISCLAYLNASSSAARV 448

Query: 420 FNYFVNVVSIFGILSWISILITYIFFYRACIAQNV-DRNSFAYRAPFQPYGAYITLFFCV 478
           F +  N+ +I G L WI   I Y+ F +A    N+ DR  F  +   QPY    +L    
Sbjct: 449 FTWLSNISTISGFLGWICACIAYLRFRKAIFYNNLYDRMPF--KTWGQPYLILWSLTVVS 506

Query: 479 LIAFIKNFTVFIGEF-DYKSFITGYIGLPLYVIFYFGYKI 517
           +I     +  FI +F +   FI  YI LP+++  Y G+K+
Sbjct: 507 IITITNGYQTFIPKFWNVSDFIAAYITLPIFLALYVGHKV 546

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  332 bits (852), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 187/553 (33%), Positives = 296/553 (53%), Gaps = 31/553 (5%)

Query: 11  KLIREDIIDLEKNTTSSLNSFEQEDDSNKISDG---------------------KEDGVR 49
           ++I+ +I++ +K   +  N F    D + I+D                      +     
Sbjct: 43  EIIKNEILEKDKKKIAHTNQFSS--DIHSITDSLARSRLPHLGDDDDEEDAEEAQYHDTE 100

Query: 50  LKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEM 109
           +K+ LK RHI MIA+                    P   LIAY F+G +++ +   LGEM
Sbjct: 101 VKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQSLGEM 160

Query: 110 ATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNP 168
           AT+IP+    T ++ R+  PA G A GY Y F + I    +++    VI+YW  +  V  
Sbjct: 161 ATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTKK--VPL 218

Query: 169 GVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGF 228
             WI IF V + ++N   V+ +GE EFW++  K++ + G +L+  II+ GG  +   +GF
Sbjct: 219 AAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGS-SQGPIGF 277

Query: 229 RYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRA 288
           RYW+NPG +     S   +  +F+ +V+  + A F Y G EL GI A EA NPR+++PRA
Sbjct: 278 RYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPRA 337

Query: 289 IKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHI 348
           I   ++RI LFYI+++F +G+ V Y+DPRL             PFV++IQN+G + LP I
Sbjct: 338 INKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDSAVVASS---PFVISIQNAGTKILPDI 394

Query: 349 FNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXA 408
           FN  V+I V SA NS++YVG+R LY+LA  G APK FA   R GVPY            A
Sbjct: 395 FNAIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGLLA 454

Query: 409 YMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPY 468
           ++ V++ +   FN+ +N+ ++ G+ +W+ I I++I F +A   + + R+   ++A F P+
Sbjct: 455 FLVVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFMPW 514

Query: 469 GAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLV-KAE 527
            AY   FF  +I FI+ F  F   FD  +F T YI L +  + + G +I Y+ +   K E
Sbjct: 515 AAYYATFFVTVIIFIQGFQAFSPHFDVTAFFTAYISLIILAVLFIGCQIYYRCRFFWKLE 574

Query: 528 EADLYSFKEAIDR 540
           + D+ + +  I+ 
Sbjct: 575 DIDIDTDRREIEE 587

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  332 bits (850), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 179/500 (35%), Positives = 289/500 (57%), Gaps = 8/500 (1%)

Query: 42  DGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFF 101
           +G      +K++LK RHI MIA+                    P   LIAY F+  +VF 
Sbjct: 89  EGVVKEAEVKRQLKQRHIGMIALGGTIGTGLFIGIATPLGNAGPVGALIAYLFMATIVFS 148

Query: 102 VMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYW 160
           V   LGEMAT+IP+   FT +++R+  PA+G A GY Y F + +    +L+    +IQ+W
Sbjct: 149 VTQSLGEMATFIPVTSSFTVFSSRFLSPAIGAANGYMYWFSWAVTFALELSVVGQIIQFW 208

Query: 161 IDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGG 220
                V    WI I+ V++ I+N   V+++GEFEFW++S K++ + G +++   ++ G G
Sbjct: 209 T--HAVPLSAWIVIWWVILTIMNLFPVKFYGEFEFWVASIKVLAIIGFLIYCLCMVCGAG 266

Query: 221 PNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAEN 280
                +GFRYW+NPG + P   S   ++G+F+ +V+  + A F Y G EL GI A EA N
Sbjct: 267 VTGP-VGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 325

Query: 281 PRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNS 340
           PR+ +PRAIK   +RI++FYI+++F +G+ V Y+D +L             PF++AI+NS
Sbjct: 326 PRKTVPRAIKKVTFRILIFYILSLFFIGLLVPYDDEKL---TSTDSYISASPFIIAIENS 382

Query: 341 GVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXX 400
           G + LPHIFN  +L  + SA NS++YVG+R L+ LA    APK F  T+R GVPY +   
Sbjct: 383 GTKILPHIFNAVILSTIISAGNSNVYVGSRILFGLAKTKLAPKWFGYTSRGGVPYYSVFF 442

Query: 401 XXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFA 460
                  A++ VSSG A+ FN+ +N++S+ G  +W+ I I ++ F +A   + + R+   
Sbjct: 443 TSSFGALAFLEVSSGGAKAFNWLLNIISVAGFFAWLLISIAHVRFMQALKHRGISRDDLP 502

Query: 461 YRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYK 520
           ++A F P+ AY ++FF  +I  I+ FT F   F+   F+  YI + L+   +  +++ ++
Sbjct: 503 FKARFMPHLAYYSIFFMTIIIIIQGFTAFAPTFNGSDFVAAYISIFLFFFLWLCFQLYFR 562

Query: 521 TKLV-KAEEADLYSFKEAID 539
           +KL+   EE D+ + +  +D
Sbjct: 563 SKLLWTVEEVDIDTDRRDVD 582

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  329 bits (844), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 188/529 (35%), Positives = 292/529 (55%), Gaps = 19/529 (3%)

Query: 22  KNTTSSLNSFEQEDDS-----NKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXX 76
           K     ++SF+ + +      + + D +E    +K+ELK RHISMIA+            
Sbjct: 2   KLNQPQVHSFQVDSNDTPTTISTLDDDQEKQQDVKRELKKRHISMIALGGTIGTGLFLGI 61

Query: 77  XXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRYCDPALGFAVG 135
                   P   LIAY F+G +VF V   LGEM T+IP+   FT +A R+  PA G A G
Sbjct: 62  ARPLIIAGPIGALIAYLFMGTVVFSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANG 121

Query: 136 YCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEF 195
           Y Y F + +    +L+    +IQ+W     V    WI+I  V++ I N   VR +GE EF
Sbjct: 122 YMYWFSWAMTFALELSVVGQIIQFW--TMAVPLAAWISIVWVLLTISNLFPVRIYGEIEF 179

Query: 196 WLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGS---KGKFV 252
           W++S K++ + G I++   I+ G G     +GFRYWKNPG   P+   I  S   + +F 
Sbjct: 180 WIASVKVLAILGFIIYGICIICGAGVTGP-VGFRYWKNPG---PWGMGIISSNVNEARFF 235

Query: 253 SFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVA 312
            +V+  + A F + G EL GI A E + PR+ +P+AIK  ++RI++FYI ++ ++G+ V 
Sbjct: 236 GWVSSLINAAFTFQGTELVGITAGEVQEPRKTVPKAIKKVVFRILVFYIGSLLVIGLLVP 295

Query: 313 YNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSL 372
           YNDP+L             PF++ IQN+G + LPHIFN  +LI + SA NS++Y+G+R L
Sbjct: 296 YNDPKL---QSNDSYVSSSPFIITIQNAGTKILPHIFNAVILITIISAGNSNVYIGSRIL 352

Query: 373 YSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGI 432
           Y LA +  APK F  T++ GVPY            AYM  ++G  + F + +N+V + G 
Sbjct: 353 YGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMFGSLAYMETTTGGDKAFTWLLNIVGVAGF 412

Query: 433 LSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGE 492
            +W+ I  ++I F +A   + + RN   Y+A   P+ AY  +FF V+I  I+ FT F  +
Sbjct: 413 FAWLLISCSHIRFMKALKQRGISRNDLPYKAMLMPWLAYYAVFFMVIIIVIQGFTSFAPK 472

Query: 493 FDYKSFITGYIGLPLYVIFYFGYKIIYKTKLV-KAEEADLYSFKEAIDR 540
           F   +F   YI + L++IF+  ++I +K +LV K ++ DL + +  I+ 
Sbjct: 473 FKVANFFAAYISVFLFIIFWVAFQIWFKCRLVWKLQDVDLDTDRRDIEE 521

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  330 bits (846), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 196/547 (35%), Positives = 295/547 (53%), Gaps = 19/547 (3%)

Query: 6   VTKDSK-LIREDIIDLEKNTTSSLNSFEQED--------DSNKISDGKED--GVRLKKEL 54
           VTK  K +   D   L K + +  +S E  D        D  +  +G+ D     +K+ L
Sbjct: 18  VTKSIKGMFSTDSGTLSKRSKAGEDSIELSDVQVSSELYDHAESEEGEGDFHETEVKRAL 77

Query: 55  KARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIP 114
           K RH+SMIA+                    P   LIAY F+G +V+FV   LGEMAT+IP
Sbjct: 78  KPRHVSMIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYIFMGSVVYFVTQSLGEMATFIP 137

Query: 115 L-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWIT 173
           +    T ++ R+  PA G A GY Y F + I    +L+    +I YW D   V    WI 
Sbjct: 138 VTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVELSVLGQIINYWTD--AVPLAAWIA 195

Query: 174 IFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKN 233
           IF V++   N   V+++GEFEF ++S K++ + G +L+  II+ GG  +   +GFRYW+N
Sbjct: 196 IFWVLLTAANFFPVKWYGEFEFCVASIKVIAIVGYLLYALIIVCGGS-SQGPIGFRYWRN 254

Query: 234 PGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTM 293
           PG +   + +   +K +F+ +V   V A F Y G EL GI A EA NPR+ +P+AI    
Sbjct: 255 PGPWGTGTIAKNVNKARFLGWVGSLVNASFTYQGTELVGITAGEASNPRKTVPKAINKVF 314

Query: 294 YRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCV 353
           +RI++FYI ++F +G+ V YN P+L             PFV++IQN+G + LP IFN  V
Sbjct: 315 FRILVFYIGSLFFVGLLVPYNSPQL---ESNSAVIASSPFVISIQNAGTKVLPDIFNAVV 371

Query: 354 LIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVS 413
           L+ + SA NS++YVG+R LYSLA+ G APK F+   + GVPY            A++  +
Sbjct: 372 LVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGVICTALLGLLAFLATN 431

Query: 414 SGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYIT 473
             +   FN+ +N+ ++ G+ +W  I + +I F +    + + R+S  ++A   P+GAY  
Sbjct: 432 ENANTAFNWLINISTLAGLCAWFFISVAHIRFMQCLKLRGISRDSLPFKAKLMPWGAYYA 491

Query: 474 LFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTK-LVKAEEADLY 532
            FF  LI FI+ FT F   FD   F T YI L L V+ +   ++ Y+ + L K E+ D+ 
Sbjct: 492 AFFVGLIVFIQGFTAFAPRFDVSEFFTAYISLILLVVLFILCQLYYRCRFLTKIEDIDID 551

Query: 533 SFKEAID 539
           S +  ID
Sbjct: 552 SDRREID 558

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  328 bits (841), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 182/513 (35%), Positives = 285/513 (55%), Gaps = 11/513 (2%)

Query: 32  EQEDDSNKISDGKEDGVR---LKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASI 88
           + E D +   DG++  VR   +K+ LK RHI MIA+                    P  +
Sbjct: 53  DNEYDVDDSVDGEKGEVRSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGM 112

Query: 89  LIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITP 147
           LIAY F+  + F VM  LGEMATYIP+   F+ ++ R+  PA G A GY Y F + I   
Sbjct: 113 LIAYLFMATIAFSVMQSLGEMATYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFA 172

Query: 148 NQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFG 207
            +L+    ++QYW  +  V    WI+IF V+I  +N   V+++GEFEFW++  K++ + G
Sbjct: 173 LELSVIGQIVQYWTFKVPV--AAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVG 230

Query: 208 VILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLG 267
            I++ FI++ G G     +GFRYW++  AF     S   ++ +F+ +V+  + A F Y G
Sbjct: 231 FIIYCFIMVCGAG-KTGPVGFRYWRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQG 289

Query: 268 IELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXX 327
            EL GI A EA NPR+ +P++IK T++RI++FYI ++  +G+ V +ND  L         
Sbjct: 290 TELVGITAGEAANPRKTVPKSIKRTLWRILIFYIFSLLFVGLLVPFNDHGL---QDSRSY 346

Query: 328 XXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAK 387
               PF++AI+NSG +ALP IFN  +L  V SA NSD+YVG+R +YS+A +  AP + AK
Sbjct: 347 AASSPFILAIKNSGTKALPDIFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAK 406

Query: 388 TNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYR 447
            ++ GVPY A          AY+  SS  A +FN+ +N+  + G  SW  I  +++ F +
Sbjct: 407 ASKGGVPYAAVLFTSAIGALAYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMK 466

Query: 448 ACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPL 507
           A   + + RN   ++A F P+ A  + FF  LI  ++ FT F   F    F+  YI + L
Sbjct: 467 ALKQRGISRNDLPFKASFMPWIAIYSFFFMTLIILVQGFTCFTPHFQASDFVASYISVGL 526

Query: 508 YVIFYFGYKIIYKTK-LVKAEEADLYSFKEAID 539
           + + +  ++I ++   LV   E D+ + +  +D
Sbjct: 527 FFVIWAVFQIWFRCPLLVPIAEIDIDTDRRDVD 559

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  327 bits (838), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 183/515 (35%), Positives = 283/515 (54%), Gaps = 16/515 (3%)

Query: 23  NTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXX 82
            T  S  S E+ +     S G E    L K L++RHI +IA+                  
Sbjct: 23  KTPHSRTSLEELETQ---SAGSEYNT-LHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHN 78

Query: 83  XXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRYCDPALGFAVGYCYLFK 141
              A +L+++  +  +V+ +M  L EM  Y+P  G      +RY DP+LGFA G+ Y + 
Sbjct: 79  CGAAPLLLSFILISTIVYPIMCSLAEMICYLPQQGSVPELVSRYVDPSLGFATGWNYAYA 138

Query: 142 YFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFK 201
           Y I+   +L+A A V+ YW +   V    WITIFLVV+V +N   V+Y+GE EFW +S K
Sbjct: 139 YAILVAAELSAAASVVSYWDN--PVPMAAWITIFLVVVVGLNFTAVKYYGEAEFWFASIK 196

Query: 202 IMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESIT-GSKGKFVSFVAVFVY 260
           ++ + G+++   +I  GG PNHDR GFRYWKNPG   P++ S+  GS G+F+      + 
Sbjct: 197 LICILGLLVVSVVIFFGGAPNHDRTGFRYWKNPG---PFAMSLAPGSTGRFLDVWRAVIK 253

Query: 261 ALFAY-LGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLL 319
           + FA+ L  EL GI   EA++ RRN  +A +  +YRII FY+    ++G+ ++  DP+L+
Sbjct: 254 SAFAFILSPELIGIACVEAQDTRRNTEKASRRFIYRIIFFYVSCALMIGVILSRTDPKLI 313

Query: 320 XXXXXXXX-XXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAID 378
                        PFV  I N+G+  L H+ NV +L   +SA NS +Y  TR + +LA +
Sbjct: 314 EALETGAPGAASSPFVQGIANAGIPVLDHVINVAILSSAWSAGNSFMYASTRMVLALARE 373

Query: 379 GKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISI 438
           G APK   K NR+GVPYNA          AY+NV + SA +F +  N+ +I G + W ++
Sbjct: 374 GNAPKFLTKINRYGVPYNAVIVCTLVACLAYLNVKTTSANVFQWLSNICTISGFIGWFAM 433

Query: 439 LITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI-GEFDYKS 497
            I +I F R  +  N+ ++   Y+ P QPY AY   F  V++     F VF+ G ++   
Sbjct: 434 GIAFIRFRRGIVFNNL-QSRIPYQGPLQPYIAYYFTFMTVVVCLTNGFHVFLKGRWNVVD 492

Query: 498 FITGYIGLPLYVIFYFGYKIIYKTKL-VKAEEADL 531
           F+  Y+ LP+Y++ Y G+K+ ++T+  +  E+ D+
Sbjct: 493 FVAAYVTLPIYLVLYLGHKLWFRTRWYIPVEQIDV 527

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  328 bits (840), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 180/521 (34%), Positives = 289/521 (55%), Gaps = 9/521 (1%)

Query: 4   YEVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIA 63
           YE    S ++      L  +  S  +S   ++D   +  G      +K+ELK RHI MIA
Sbjct: 45  YETGSSSIVVDGSSRHLHGSHGS--HSVSGDEDEPYVDQGVVQDAEVKRELKQRHIGMIA 102

Query: 64  IXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYA 122
           +                    P   LIAY F+  +VF V   LGEMAT+IP+   FT ++
Sbjct: 103 LGGTIGTGLFIGISTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEMATFIPVTSSFTVFS 162

Query: 123 TRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVII 182
           +R+  P++G A GY Y F + I    +L+    +IQ+W D   V    WI I+  ++ I+
Sbjct: 163 SRFISPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTD--AVPLSAWIVIWWFILTIM 220

Query: 183 NTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSE 242
           N   V+++GEFEFW++S K++ + G +++   ++ G G     +GFRYW+NPG + P   
Sbjct: 221 NMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVT-GPVGFRYWRNPGPWGPGII 279

Query: 243 SITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIV 302
           S   ++G+F+ +V+  + A F Y G EL GI A EA NPR+ +PRAIK   +RI++FYI+
Sbjct: 280 SSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVSFRILIFYIL 339

Query: 303 TIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACN 362
           ++F +G+ V ++DP+L             PF++AIQNSG + LPHIFN  +L  + SA N
Sbjct: 340 SLFFIGLLVPFDDPKLSSDDSYVSSS---PFIIAIQNSGTKVLPHIFNAVILSTIISAGN 396

Query: 363 SDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNY 422
           S++YVG+R ++ LA    AP+ F  T + GVPY A          A++ VSSG A+ FN+
Sbjct: 397 SNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNW 456

Query: 423 FVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAF 482
            +N+V + G  +W+ I I ++ F +    + + R+   ++A   P+ AY  +FF ++I  
Sbjct: 457 LLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAYYAIFFMIIIII 516

Query: 483 IKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKL 523
           I+ FT F   F+   F+  YI + L+   +  +++ ++ KL
Sbjct: 517 IQGFTAFAPTFNGSDFVAAYISVFLFFFLWVSFQLYFRCKL 557

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  324 bits (831), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 170/458 (37%), Positives = 267/458 (58%), Gaps = 7/458 (1%)

Query: 85  PASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYF 143
           P   LI+Y F+G +++ V   LGEMAT+IP+   F+ +A R+  PALG   GY Y   + 
Sbjct: 25  PVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWC 84

Query: 144 IITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIM 203
                +L+    +IQYW D   V    WI IF  ++ ++N   V+Y+GEFEF ++S K++
Sbjct: 85  FTFALELSVLGQIIQYWTD--AVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVI 142

Query: 204 VMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALF 263
            + G I++ F ++ G G     +GFRYW+NPGA+ P   S   ++G+F+ +V+  + A F
Sbjct: 143 ALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAF 202

Query: 264 AYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXX 323
            Y G EL GI A EA NPR+ +PRAIK  + RI++FYI+++F +G+ V YNDP+L     
Sbjct: 203 TYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKL---DS 259

Query: 324 XXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPK 383
                   PF+++I+NSG + LP IFN  VLI + SA NS++Y+G+R LYSL+ +  AP+
Sbjct: 260 DGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLAPR 319

Query: 384 LFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYI 443
             +   + GVPY A          A++  S+GS + FN+ +N+  + G  +W+ I  ++I
Sbjct: 320 FLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSHI 379

Query: 444 FFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYI 503
            F +A   + + RN   Y+A   PY AY   FF  LI  I+ FT F   F    F+  YI
Sbjct: 380 RFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAPSFQPVDFVAAYI 439

Query: 504 GLPLYVIFYFGYKIIYKTKLV-KAEEADLYSFKEAIDR 540
            + L+V  +F +++ +K  ++ K ++ D+ S +  I+ 
Sbjct: 440 SVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIEE 477

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  326 bits (836), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 183/538 (34%), Positives = 294/538 (54%), Gaps = 23/538 (4%)

Query: 1   MSVYEVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSN---------KISDGKEDGVR-L 50
           MS+ ++  +  L  +  I ++   +   +  +  +D N          +S+ ++D    +
Sbjct: 1   MSILDINTEETLEGKSKIVIKSTESLEQHDLQGNEDKNTPTTTPSKENVSENEKDEYHEV 60

Query: 51  KKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMA 110
           K++L  RHI+MIA+                    P   LIAY F+G +V+ V   LGEMA
Sbjct: 61  KRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVTQSLGEMA 120

Query: 111 TYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPG 169
           T+IP+   FT ++ R+  PALG A GY Y F + +    +L+    +IQ+W     V   
Sbjct: 121 TFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFW--TFAVPLP 178

Query: 170 VWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFR 229
            WI+IF V++ I N   VR +GE EFW++  K+  + G I++ F I+ G G     +GFR
Sbjct: 179 AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGP-VGFR 237

Query: 230 YWKNPGAFKPYSESITGS---KGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIP 286
           YW+NPG   P+   I  S   + +F+ + +  + A F + G EL GI A EA NPR+ +P
Sbjct: 238 YWRNPG---PWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVP 294

Query: 287 RAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALP 346
           +AI+  ++RI++FYI+++F +G+ V Y+D +L             PF++AI+NSG + LP
Sbjct: 295 KAIRKVVFRILVFYILSLFFIGLLVPYDDVKL---KSENSYVSSSPFIIAIENSGTKILP 351

Query: 347 HIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXX 406
           HIFN  +L+ + SA NS++Y+G+R L+ LA +G  PKLFAKT + GVP  A         
Sbjct: 352 HIFNGVILVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGA 411

Query: 407 XAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQ 466
            A+M  S+G  + F + +NVV + G  SW+ I   +I F +   ++ + RN   ++A F 
Sbjct: 412 LAFMETSTGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFM 471

Query: 467 PYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLV 524
           PY AY      ++I F + FT F  +FD  +F   YI + L+ IF+  +++ +K + V
Sbjct: 472 PYLAYYATIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYV 529

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  328 bits (840), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 189/538 (35%), Positives = 291/538 (54%), Gaps = 32/538 (5%)

Query: 4   YEVTKDSKLIREDIIDLEKNTTSSLNSFEQED-------DSNKISDGKEDGVRLKKELKA 56
           Y+  KD  +  E I    K+ ++S N    E+       + +  +DG  +  +LK+ L++
Sbjct: 55  YDNEKDDDIRMEKI---SKDQSASSNGTIHEELVMDVDLEKSPSADGDNEPRKLKQGLQS 111

Query: 57  RHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLD 116
           RH+ +IA+                    P  + I+Y  +  +++ +M  LGEM  ++P D
Sbjct: 112 RHVQLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYIIISAVIYPIMCALGEMVCFLPGD 171

Query: 117 GFTSYA------TRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGV 170
           G  S        TRY D +LGFA G+ Y + Y I+   + TA + V++YW     V  GV
Sbjct: 172 GSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAAECTAASGVVEYWT--TAVPKGV 229

Query: 171 WITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRY 230
           WIT+FL+V+V++N   V+ +GE EFW +S KI+ + G+I+  FI+  GGGP HDRLGFRY
Sbjct: 230 WITVFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGLIILSFILFWGGGPKHDRLGFRY 289

Query: 231 WKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAY-LGIELTGIVAAEAENPRRNIPRAI 289
           W++PGAF  +     GS G F       +   FA+ LG EL  + +AE  + RRNI +A 
Sbjct: 290 WQHPGAFAHHLTG--GSLGNFTDIYTGIIKGAFAFILGPELVCMTSAECADQRRNIAKAS 347

Query: 290 KLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXX-XXXXXPFVVAIQNSGVRALPHI 348
           +  ++R+I FY++    + + V YNDP L+             PFV+ IQN+G++ LPHI
Sbjct: 348 RRFVWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKPGAGSSPFVIGIQNAGIKVLPHI 407

Query: 349 FNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXA 408
            N C+L   +SA N+ ++  TRSL ++A  G+APK   K NRWGVPY A          A
Sbjct: 408 INGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKINRWGVPYVAVAASFLCSCLA 467

Query: 409 YMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPF--- 465
           Y+NVSS +A +FN+F N+ +I G L WI   I Y+ F +A     +  N    R PF   
Sbjct: 468 YLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKA-----IFYNGLYDRLPFKTW 522

Query: 466 -QPYGAYITLFFCVLIAFIKNFTVFIGEF-DYKSFITGYIGLPLYVIFYFGYKIIYKT 521
            QPY  + +L    +I     + +FI ++     FI  Y+ LP++++ + G+K+  +T
Sbjct: 523 GQPYTVWFSLIVVSIITITNGYAIFIPKYWKVADFIAAYVTLPIFLVLWLGHKLYTRT 580

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  325 bits (834), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 181/543 (33%), Positives = 299/543 (55%), Gaps = 23/543 (4%)

Query: 10  SKLIREDIIDLEK-NTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXX 68
           S + ++D  D++K N     ++    +D   ++ G      +K+ELK RHI MIA+    
Sbjct: 23  STMSQDD--DMKKINIIQQTDASSTTEDEEMLNSGSVHDAEVKRELKQRHIGMIALGGTI 80

Query: 69  XXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCD 127
                           P   LIAY FVG L + V   LGEMAT+IP+   FT +A+R+  
Sbjct: 81  GTGLFIGISTPLEDSGPVGSLIAYIFVGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLS 140

Query: 128 PALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGV 187
           P++G AVGY Y F + +    +L+    ++ YW     V    WI+IF V++  +N   V
Sbjct: 141 PSIGAAVGYMYWFSWAVTFALELSVVGQIVDYW--TFAVPIAAWISIFWVILTALNMFPV 198

Query: 188 RYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGS 247
           +++GE EFW+++ K++ + G +++   ++ G G     +GFRYW+NPG   P+ + +T +
Sbjct: 199 KFYGEIEFWVAAVKVVAIVGFLIYCLCMVCGAGVTGP-VGFRYWRNPG---PWGDGLTSN 254

Query: 248 ---------KGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIIL 298
                     G+F+ +    + A F Y G EL GI A EA NPR+ +PRAIK  ++RI+L
Sbjct: 255 GVEISKNKNTGRFLGWFNSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVVFRILL 314

Query: 299 FYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVF 358
           FYI ++F +G+ V ++DP+L             PF++AI+NSG + LP IFN  +LI + 
Sbjct: 315 FYIGSLFFIGLLVPFDDPKLSSDDSYVSSS---PFIIAIENSGTKILPDIFNAIILITII 371

Query: 359 SACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQ 418
           SA NS++YVG+R L+SLA  G APK+ ++T + GVP+ +          AYM  + G   
Sbjct: 372 SAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGVPWVSVLATAVFGVLAYMETTQGGQT 431

Query: 419 IFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCV 478
           +F++ VN+ +I G  +W+ ILI++I F +    + + R+   ++A   P  AY  +F  V
Sbjct: 432 VFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRGISRDDLPFKANLMPGLAYYAVFCMV 491

Query: 479 LIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLV-KAEEADLYSFKEA 537
           +I   + FT F   FD   F   YI + L+ + +  +++ +K + + K E+ D+ S +  
Sbjct: 492 IIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWGAFQLWFKCRWIWKLEDVDIDSNRRD 551

Query: 538 IDR 540
           +++
Sbjct: 552 VEK 554

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  325 bits (833), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 193/561 (34%), Positives = 308/561 (54%), Gaps = 33/561 (5%)

Query: 5   EVTKDSKLIREDIIDLEKNT-TSSLNSFEQED----------DSNKISDGKEDGVRLKKE 53
           +  K   +I E  +D+E NT T  L   + ++          D  K    +E+G +LK+ 
Sbjct: 17  KADKSDPIISE--VDIEANTITEQLTKDKHKETIDYSETSSLDEEKQQQPEENG-KLKQG 73

Query: 54  LKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYI 113
           LK+RH+ +IA+                    PA +  +Y  +   ++ +M   GEM  Y+
Sbjct: 74  LKSRHVQLIALGGTIGTGLLVGSSQTLATCGPAGLFTSYLIICTFIYPIMNAFGEMVCYL 133

Query: 114 PLDGFTSYAT------RYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVN 167
           P +G  S  +      +Y D +LGFA  + Y + + I+   + TA A V++YW     V 
Sbjct: 134 PGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVATECTAAAGVVEYWAWALKVP 193

Query: 168 PGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLG 227
            G WITIFL  +V +N + V ++GE EFW +S KI+ + G+I+  FI+  GGGP+HDRLG
Sbjct: 194 KGAWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILGLIILSFILFWGGGPSHDRLG 253

Query: 228 FRYWKNPGAFKPYSESIT-GSKGKFVSFVAVFVYALFAY-LGIELTGIVAAEAENPRRNI 285
           FRYW+ PGAF   ++ IT G+ G F+      +   FA+ LG EL  + ++E  + RRNI
Sbjct: 254 FRYWQRPGAF---ADHITDGTGGNFLDVYTGVIKGGFAFVLGPELVSLTSSECHDQRRNI 310

Query: 286 PRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXX-XXXXXPFVVAIQNSGVRA 344
            +A +  ++R+++FY++    + + VAYNDP L              PFV+ IQN+G++ 
Sbjct: 311 AKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSKPGAGSSPFVIGIQNAGIKV 370

Query: 345 LPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXX 404
           LPHI NVC++   +SA N+ ++  +RSL ++A  G APK F+K NR+GVPY A       
Sbjct: 371 LPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFFSKINRFGVPYVAVGFSFLF 430

Query: 405 XXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNV-DRNSFAYRA 463
              AY+NVSS +A +FN+F N+ +I G + WI   + YI F +A I  ++ DR    Y+ 
Sbjct: 431 CCLAYLNVSSSTANVFNWFSNISTISGFIGWICACVAYIRFRKAIIFNDLYDR--LPYKG 488

Query: 464 PFQPYGAYITLFFCVLIAFIKNFTVFIGEF-DYKSFITGYIGLPLYVIFYFGYKII---Y 519
             Q Y  + +LF   LI     + +FI  F DYK FI  YI LP++++ + G+K++   +
Sbjct: 489 FAQKYLIWYSLFMVSLITLTNGYQIFIPRFWDYKDFIAAYITLPVFIVLWIGHKLVTRSW 548

Query: 520 KTKLVKAEEADLYSFKEAIDR 540
           +   +  ++ D+++  E I+ 
Sbjct: 549 RQWYIPVDKIDVFTGLEEIEE 569

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  324 bits (831), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 194/558 (34%), Positives = 295/558 (52%), Gaps = 27/558 (4%)

Query: 1   MSVYEVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNK---ISDGKEDGVR-LKKELKA 56
           MS  +  KD+      ++D +      L+     +DS K   + +  + G   LKK LK+
Sbjct: 1   MSNLQDLKDAG--ETSVVDKQTGQVYELDLTSYSNDSEKNGSLPNKPQSGDHNLKKGLKS 58

Query: 57  RHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL- 115
            HI +IAI                    PA + I+Y  +  +++ VM  L EM  ++P  
Sbjct: 59  AHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIYPVMNALAEMVCFLPGL 118

Query: 116 -------DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNP 168
                     ++  TRY D +LGFAVG+ Y++ Y I+   + TA + V+ YW     V  
Sbjct: 119 PDENETGGSISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTAASGVVTYWT--TAVPK 176

Query: 169 GVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGF 228
             WITIFL +IV++N   V ++G  E    S KI  + G+I+   ++  GGGPNHDRLGF
Sbjct: 177 AAWITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVSIVLFFGGGPNHDRLGF 236

Query: 229 RYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAY-LGIELTGIVAAEAENPRRNIPR 287
           R+WK+PGA+  +     G  G+    +   + A FA+ LG EL  + + EA++ RRNI +
Sbjct: 237 RFWKDPGAWAYHLAD--GGAGRLSDIITGVIRAGFAFILGPELVVLTSTEAQDSRRNIEK 294

Query: 288 AIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXX-XXXXXPFVVAIQNSGVRALP 346
           A +  ++R+I FY V+    G+ V+ NDP LL             PFV+ IQN+G++ LP
Sbjct: 295 AARRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGKPGAGSSPFVIGIQNAGIKVLP 354

Query: 347 HIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXX 406
           HI NVC+L   +S+ NS +Y  TRSL SL+ +G APK+F + NRWGVPY           
Sbjct: 355 HIINVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNRVNRWGVPYTGVAFATAFSC 414

Query: 407 XAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNV-DRNSFAYRAPF 465
            AY+NVSS +A +FN+F N+ +I G L WI   + Y+ F +A    N+ DR    ++ PF
Sbjct: 415 LAYLNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRFRKAVFFNNLYDR--LPFKTPF 472

Query: 466 QPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKT---K 522
           QPY  +  +    +I  I  +  F+  ++YK FI  YI LPL++I + G+K   +T    
Sbjct: 473 QPYFTWFYIILIAIICLINGYESFV-HWNYKDFIAAYITLPLFLILWLGHKAYTRTWSQW 531

Query: 523 LVKAEEADLYSFKEAIDR 540
           ++   E D+ +    I+ 
Sbjct: 532 MISVSEIDVTTGLREIEE 549

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  323 bits (829), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 173/518 (33%), Positives = 287/518 (55%), Gaps = 14/518 (2%)

Query: 27  SLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPA 86
           +L+   Q    +++         ++++LK RH+SMIA+                    P 
Sbjct: 30  ALDQEAQSSQDSQLGSSGHGRNAVQRQLKPRHVSMIALGGTIGTGLFIGIESPLRNAGPV 89

Query: 87  SILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFII 145
             LI+Y F+G + + V   LGEMAT+IP+   FT +  R+    LG A GY Y F + + 
Sbjct: 90  GALISYLFMGSIAYCVTQSLGEMATFIPVTSSFTVFTRRFLSLPLGAANGYMYCFSWSVT 149

Query: 146 TPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVM 205
              +L+    +I+YW     V    WI IF V I + N V V+++GEF+FW++  K++ +
Sbjct: 150 YALELSIVGQIIEYWTS--AVPNAAWIAIFWVPITLSNLVPVKFYGEFQFWIALIKVVAI 207

Query: 206 FGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGS---KGKFVSFVAVFVYAL 262
            G +++   ++ G G     +GFRYW+NPG   P+ + I      +G+F+ +V+  V A 
Sbjct: 208 IGFLVYCLCMVCGAGKTGP-VGFRYWRNPG---PWGDGIISHDIHEGRFLGWVSSLVNAA 263

Query: 263 FAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXX 322
           F Y G EL GI A E+ NPR+ +P+AI    +RI+LFY+ ++F +G+ V +ND +L    
Sbjct: 264 FTYQGTELVGISAGESANPRKTVPKAINKVFFRILLFYVGSLFFIGLLVPFNDEKL---T 320

Query: 323 XXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAP 382
                    PF++AIQNSG + LP IFN  +L  + SA NS++YVG+R LY LA +  AP
Sbjct: 321 SSDSYSAGSPFIIAIQNSGTKILPDIFNAVILATIISAANSNVYVGSRVLYGLAKERLAP 380

Query: 383 KLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITY 442
           + FA+TNR GVP  A           Y++VS+G+++ F++ +N+ +I G  SW+ I + +
Sbjct: 381 RFFARTNRHGVPDVAVLFVANFGFLGYLSVSNGASKAFDWLLNITAIAGFFSWLFISLCH 440

Query: 443 IFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGY 502
           + F +A   Q + R+   ++A   P+GAY + FF  LI  I+ FT     F+  +F   Y
Sbjct: 441 VRFMQALKLQGISRDDLPFKAKLMPWGAYYSAFFITLIIIIQGFTSLAPTFNVSNFFAAY 500

Query: 503 IGLPLYVIFYFGYKIIYKTKLV-KAEEADLYSFKEAID 539
           I + ++++ +  ++  Y+T+++ + E  D+ S +  +D
Sbjct: 501 ISVFMFLVIWAVFQCWYRTRIIHRIEHVDIDSDRREVD 538

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  324 bits (830), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 187/519 (36%), Positives = 287/519 (55%), Gaps = 23/519 (4%)

Query: 9   DSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXX 68
           D++ I  + +DLE  T   +    + D S+++    E   +LK+ L +RH+  IA+    
Sbjct: 22  DNRQILINELDLESLTREKIT---RSDSSSEVE--AEGNGKLKQGLSSRHVQFIALGGTI 76

Query: 69  XXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTSYAT----- 123
                           P  ++I+Y  +  +++ +M  LGEM  Y+P +G  S  +     
Sbjct: 77  GTGLFVGTSVTLKTVGPGGLVISYIIISTVIYPIMNALGEMVCYLPGNGEDSAGSVAHLV 136

Query: 124 -RYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVII 182
            RY D +L FA G+ Y + + I+   + TA + V+ YW    +V   VWITIFL ++ ++
Sbjct: 137 GRYVDKSLAFATGWNYYYCFVILVAAECTAASGVVTYW--TTSVPTAVWITIFLGIVTLL 194

Query: 183 NTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSE 242
           N   V+YFGE EFW +S KI+ + G+IL  FI+  GGGP+H RLGF YWK+PG F   + 
Sbjct: 195 NFSAVKYFGETEFWFASIKILCILGLILVSFILFWGGGPSHVRLGFHYWKDPGTF---AH 251

Query: 243 SITG-SKGKFVSFVAVFVYALFAY-LGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFY 300
            ITG S G F+      +   FA+ LG EL  + ++E  + RRNI +A K  ++R++ FY
Sbjct: 252 HITGGSWGSFLDIYTGIIKGAFAFILGPELVALTSSECNDQRRNIAKASKRFIWRLMFFY 311

Query: 301 IVTIFLLGMCVAYNDPRLLXXXXXXXX-XXXXPFVVAIQNSGVRALPHIFNVCVLIFVFS 359
           I+    + + VAYNDP LL             PFV+ IQN+G++ LPHI N C+L   +S
Sbjct: 312 ILGTLSISVIVAYNDPVLLNALEEGKEGAASSPFVIGIQNAGIKVLPHIINACILSSAWS 371

Query: 360 ACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQI 419
           A NS ++  +RSL ++A +G APK+F K NR+GVPY +          A++NVSS +AQ+
Sbjct: 372 AGNSFMFASSRSLMTMAHNGSAPKIFCKVNRFGVPYYSVGLSAMLSCLAFLNVSSSTAQV 431

Query: 420 FNYFVNVVSIFGILSWISILITYIFFYRACIAQNV-DRNSFAYRAPFQPYGAYITLFFCV 478
           F++F N+ +I G L WI  +I Y+ F +A    N+ DR    ++   QPY  + +L    
Sbjct: 432 FDWFSNISTISGFLGWICAIIAYLRFRKAIFYNNMYDR--LPFKTFGQPYLIWYSLLVIS 489

Query: 479 LIAFIKNFTVFIGEFDYKS-FITGYIGLPLYVIFYFGYK 516
           +I     +  FI  F   S F+  YI LPL++I + G+K
Sbjct: 490 VITLTNGYQTFIPRFWSGSDFVAAYITLPLFLILWVGHK 528

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  323 bits (827), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 186/546 (34%), Positives = 297/546 (54%), Gaps = 18/546 (3%)

Query: 2   SVYEVTKDSKLIR-----EDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKA 56
           +V E +  S+ I+     E+ I+L+  T ++    E  +D  +  D +E    +K+ LKA
Sbjct: 7   AVSETSTRSRYIKKGKTLENDIELQSVTPAT---GEFPEDHTEEGDYQE--TEVKRALKA 61

Query: 57  RHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL- 115
           RHISMIA+                    P   L+AY F+G +V+ +   LGEMAT+IP+ 
Sbjct: 62  RHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIGTVVYSITQSLGEMATFIPVT 121

Query: 116 DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIF 175
              T ++ R+  PA G A GY Y F + I    +L+    +IQYW DR  +    WI IF
Sbjct: 122 SSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQIIQYWTDRVPI--AAWIVIF 179

Query: 176 LVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKN-P 234
            V++ ++N   VR++GE EFW++S K++ + G +++ FII+ GG      +G       P
Sbjct: 180 WVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVCGGS-KQGPIGLPATGGIP 238

Query: 235 GAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMY 294
                 S   T  +  F+ +V+  + A F Y G EL GI A E+ NPR+N+P+AI    +
Sbjct: 239 ARGARASSRTTRKRHGFLGWVSSLIKAAFTYQGTELVGITAGESTNPRKNVPKAINKVFF 298

Query: 295 RIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVL 354
           RI+ FYI ++  +G+ V Y+DPRL             PFV++I+N+G + LP IFN  VL
Sbjct: 299 RILFFYIGSLLFVGLLVPYDDPRL--NSESSTDVNASPFVISIKNAGTKILPDIFNAVVL 356

Query: 355 IFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSS 414
           I V SA NS++Y+G+R  YSLA+ G APK  A   + GVPY            +++ ++ 
Sbjct: 357 ITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQGVPYFGVLITSLMGLMSFLVLNH 416

Query: 415 GSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITL 474
            ++  F++ VN+ ++ G+ +W+ I + +I F +    + + R+   ++A F P+ AY   
Sbjct: 417 NASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHRGISRDDLPFKAKFMPWAAYYAT 476

Query: 475 FFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKA-EEADLYS 533
           FF  +I FI+ +T F  +FD  +F T YI L L ++ + G +I YK + + A E+ D+ S
Sbjct: 477 FFVTVIIFIQGYTAFTPKFDVTTFFTSYISLFLMLLVFIGCQIYYKCRFLWAVEDIDIDS 536

Query: 534 FKEAID 539
            +  ID
Sbjct: 537 DRREID 542

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  321 bits (823), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 183/513 (35%), Positives = 283/513 (55%), Gaps = 18/513 (3%)

Query: 16  DIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXX 75
           D+    +  + +LN  E + +  K      D   L+K L +RHI +IA+           
Sbjct: 17  DVKSQGETYSGTLNQLESQLEGTKC-----DENNLEKGLSSRHIQLIALGGCIGTGLFVG 71

Query: 76  XXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRYCDPALGFAV 134
                    P  + +++  +  +V+ VM  L EM  Y+P  G      +RY DP+LGFA 
Sbjct: 72  TSSTLHNCGPLPLFLSFVIISFIVYPVMNTLAEMICYLPQQGTVPELTSRYVDPSLGFAA 131

Query: 135 GYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFE 194
           G+ Y + Y I+   +L+A A V+QYW D+  V+  VWITIFLV++V +N   V+++GE E
Sbjct: 132 GWNYAYSYSILVATELSAAAGVVQYWTDK--VHVAVWITIFLVIVVGLNFAPVKFYGESE 189

Query: 195 FWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITG-SKGKFVS 253
           FW +S KI+ + G+++   +I  GG P+HDRLGFRYW NPG   P++  ITG + G+F+ 
Sbjct: 190 FWFASLKIICILGLLIVSIVIFFGGAPSHDRLGFRYWNNPG---PFAYHITGGNTGRFLD 246

Query: 254 FVAVFVYALFAY-LGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVA 312
                + + FA+ L  EL G+   EA++ RRNI +A +  ++RII FYI +   +G  ++
Sbjct: 247 IWTAIIKSGFAFILSPELIGLACVEAKDTRRNIEKASRRFIWRIIFFYITSTLCIGFILS 306

Query: 313 YNDPRLLXXXXXXXX-XXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRS 371
            +DP+L+             PFV  I N+G+  L HI N  +L   +S+ NS +Y  +RS
Sbjct: 307 RDDPKLIQALTSDAPGAASSPFVQGISNAGIPVLNHIINAVILSSAWSSANSFMYASSRS 366

Query: 372 LYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFG 431
           + +LA  G APK+F + NR GVPYNA           Y+N SS SAQ+F +  N+ +I G
Sbjct: 367 ILALAKQGDAPKVFTRINRLGVPYNAVALSTAVSCLTYLNASSSSAQVFTWLSNICTISG 426

Query: 432 ILSWISILITYIFFYRACIAQNV-DRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI 490
            + W  I ITY+ F +A    N+ +R  F  ++  QPY  Y  + F VL+     +  FI
Sbjct: 427 FIGWALIGITYLRFRKAIFYNNLYERVPF--KSALQPYFTYFFVVFVVLLCLTNGYATFI 484

Query: 491 GEF-DYKSFITGYIGLPLYVIFYFGYKIIYKTK 522
            ++ +   F+  YI LP++ + Y G+KI +KT+
Sbjct: 485 PKYWNASDFVAAYITLPIFFLLYLGHKIWFKTR 517

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  320 bits (821), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 180/503 (35%), Positives = 276/503 (54%), Gaps = 19/503 (3%)

Query: 50  LKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEM 109
           LKK L++RHI +IA+                    PA +L +Y  + ++++ VM  LGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 110 ATYIPLDGFTSYA------TRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDR 163
             ++P     S        TRY DP+LGFA G+ Y + Y I+   + TA + V+ YW   
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTT- 223

Query: 164 ETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNH 223
             V  G WI IFL V+ ++N   V+ +GE EFW +  KI+ + G++   FI+  GGGP H
Sbjct: 224 -AVPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTH 282

Query: 224 DRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAY-LGIELTGIVAAEAENPR 282
           DRLGFRYW++PGAF  +    TG+ G+F+      +   FA+ LG EL  I ++EA + R
Sbjct: 283 DRLGFRYWQHPGAFAYHIT--TGNTGRFLDIWTGVIKGGFAFILGPELVAITSSEALDAR 340

Query: 283 RNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXX-XXPFVVAIQNSG 341
           RNI +A +   YR++ FY+ +   +G+ V+  DP L              PFV+AIQN+ 
Sbjct: 341 RNIEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAH 400

Query: 342 VRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXX 401
           ++ LPHI N C+L   +S+ NS ++  +RSL S+A DG AP++  + NR GVPY A    
Sbjct: 401 IKVLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALS 460

Query: 402 XXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNV-DRNSFA 460
                 A++NVSSGSA+ F +F N+ +I G + WI I + Y+ F +A   + + +R  F 
Sbjct: 461 AAFSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGLYERVPF- 519

Query: 461 YRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKI--- 517
            ++P QPYG Y  +    LI     +  F+  ++   F+  YI LP++V+ + G+KI   
Sbjct: 520 -KSPLQPYGTYFFIVVVSLICLTNGYASFV-NWNASDFVAAYITLPIFVVLWVGHKIYTR 577

Query: 518 IYKTKLVKAEEADLYSFKEAIDR 540
            + T L+   E D+ +    I+ 
Sbjct: 578 TWSTWLLPVAEVDVTTGLAEIEE 600

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  316 bits (810), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 171/515 (33%), Positives = 286/515 (55%), Gaps = 14/515 (2%)

Query: 33  QEDDSNKISDGKEDGVRL-----KKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPAS 87
              DS    + +E  V +     ++ELK RH+ MIA+                    P  
Sbjct: 5   HNQDSKMKEEIREISVEVEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVG 64

Query: 88  ILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIIT 146
            LIAY F+  L + V   LGEMAT+IP+   FT ++ R+  PA G A GY Y F + I  
Sbjct: 65  ALIAYLFMATLAYSVTQSLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITF 124

Query: 147 PNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMF 206
             +L+    VIQ+W     V    WI+IF V++  +N   V+Y+GEFEFW++  K++ + 
Sbjct: 125 ALELSVVGQVIQFWTF--AVPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIM 182

Query: 207 GVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYL 266
           G +++ F ++ G G     +GFRYW++PGAF P   +   ++ +F+ +V+  + A F + 
Sbjct: 183 GFLIYCFCMVCGAGVTGP-VGFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQ 241

Query: 267 GIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXX 326
           G EL GI A EA NPR+ +PRAIK  ++RI+ FYI+++F +G+ V Y+D +L        
Sbjct: 242 GTELVGITAGEAANPRKTVPRAIKKVVFRILFFYILSLFFIGLLVPYDDWKL---TSTDS 298

Query: 327 XXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFA 386
                PF++AI+NSG   LPHIFN  ++  + SA NS++YVG+R +Y L+    AP + +
Sbjct: 299 YVSASPFIIAIENSGTHVLPHIFNAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILS 358

Query: 387 KTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFY 446
           +T + GVP+ A          AYM  S+G  + FN+ +N+  + G  +W+ I +++I F 
Sbjct: 359 RTTQHGVPWVAVLVTSLFGALAYMETSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFM 418

Query: 447 RACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLP 506
           +A   + + R+   ++A + P  AY  +FF  LI  I+ FT F   ++   F+T YI + 
Sbjct: 419 QALEMRGISRDDLPFKAKWMPGLAYYGVFFMTLIIIIQGFTSFC-PWNGIDFLTAYISVF 477

Query: 507 LYVIFYFGYKIIYKTKLV-KAEEADLYSFKEAIDR 540
           +++  +  ++  ++ +L+ + E+ D+ + + A++ 
Sbjct: 478 MFIAIWIAFQAWFRCRLIWRVEDVDIDTDRRAVEE 512

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  316 bits (810), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 174/493 (35%), Positives = 272/493 (55%), Gaps = 8/493 (1%)

Query: 49  RLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGE 108
            +K+ELK RHI MIA+                    P   LI+Y F+G LV+ V   LGE
Sbjct: 72  EVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVYSVTQSLGE 131

Query: 109 MATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVN 167
           MAT+IP+   FT +A R+  P++G A GY Y F + +    +L+    VIQYW     V 
Sbjct: 132 MATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQYWT--YAVP 189

Query: 168 PGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLG 227
              WI+IF VVI   N   V+Y+GE EFW++  K++ + G +L+   ++ G G     +G
Sbjct: 190 LAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGVTGP-VG 248

Query: 228 FRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPR 287
           FRYW+NPG + P   S   ++ +F+ +V+  +   F Y G EL GI A EA NPR+ +PR
Sbjct: 249 FRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPRKAVPR 308

Query: 288 AIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPH 347
           AIK  ++RI+ FYI ++F +G+ V YND  L             PF++AI+NSG   LPH
Sbjct: 309 AIKKVVFRILFFYIGSLFFIGLLVPYNDDAL---NNTDSYVASSPFIIAIKNSGTPVLPH 365

Query: 348 IFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXX 407
           IFN  +   + SA NS++YVG+R L+ L+ +  APK+ ++T + GVP+ A          
Sbjct: 366 IFNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVGAL 425

Query: 408 AYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQP 467
           AYM  S+G    FN+ +N+ ++ G  +W+ I +++I F +A   + + R+   ++A   P
Sbjct: 426 AYMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAALMP 485

Query: 468 YGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLV-KA 526
             AY   F   +I  I+ FT F  +F    F   YI + L++  +  ++II++ + + K 
Sbjct: 486 GLAYYASFLMFVIIIIQGFTAFAPKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIHKV 545

Query: 527 EEADLYSFKEAID 539
           E+ D+ + +  I+
Sbjct: 546 EDVDIDTDRRDIE 558

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  308 bits (790), Expect = 2e-97,   Method: Compositional matrix adjust.
 Identities = 168/525 (32%), Positives = 281/525 (53%), Gaps = 25/525 (4%)

Query: 2   SVYEVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISM 61
           S   +T     I+ ++++   +   SL     + D             +K+ELK RH++M
Sbjct: 14  SSSTITAKPGAIKAEVLNHNTSEVESLCEKPNQSD-------------VKRELKPRHVTM 60

Query: 62  IAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTS 120
           I++                    P   L+AY FV  + + V   LGEMAT+IP+   FT 
Sbjct: 61  ISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVTQSLGEMATFIPVTSSFTV 120

Query: 121 YATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIV 180
           +A+R+  PALG A GY Y   + I    +++    +I YW D   +    W+ IF V++ 
Sbjct: 121 FASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAVPIT--AWMAIFWVLLT 178

Query: 181 IINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPY 240
            IN + V+++GEFEFW++S K++ +    LF  ++++ GG    R+GFRYWK+PG   P+
Sbjct: 179 AINLIPVKFYGEFEFWIASLKVIAIL-CFLFYGLVVVCGGSKLGRIGFRYWKDPG---PW 234

Query: 241 SESITGSK---GKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRII 297
              I   +    +F+ +V+  + A F + G EL G+ A E +NPRR +P+AI    +RI+
Sbjct: 235 GVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPKAINTVFFRIL 294

Query: 298 LFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFV 357
           LFYI ++ ++G+ V Y+DP+L+            PFVVAI  +G + LP I N  +++ +
Sbjct: 295 LFYIGSLLVIGLLVRYDDPQLIQDGSTTNANAS-PFVVAINAAGTKVLPDIMNGVIMVTI 353

Query: 358 FSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSA 417
            SA NS++YVG+R LY L   G AP   ++T   GVPY A           Y+NVSS S 
Sbjct: 354 ISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALGYLNVSSKSG 413

Query: 418 QIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFC 477
            +F++ +++ ++ G  +W+ I +++I F +    + + R+   ++A F PYGAY   FF 
Sbjct: 414 SVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPYGAYYAAFFV 473

Query: 478 VLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTK 522
           ++I  ++ FT F   F    F+  YI   ++V+ +  ++ ++K +
Sbjct: 474 IVIILVQGFTAFT-PFSAVDFVAYYISAFIFVVIWLLFQFLFKGR 517

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  308 bits (789), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 175/542 (32%), Positives = 293/542 (54%), Gaps = 8/542 (1%)

Query: 1   MSVYEVTKDSKLIREDIIDLEKNTTSSLNSFE-QEDDSNKISDGKEDGVRLKKELKARHI 59
           +S   V+   +    ++  LE+  T++++ F  Q  DS K      +    +++L  R +
Sbjct: 67  VSQMSVSGKKEAFELNVTSLEEGETATIDDFVLQNRDSPKSQSLSLEERIARRKLLPRQV 126

Query: 60  SMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-F 118
           SMI I                    P S+LIA+    ++   +  C+  M TY+P+ G F
Sbjct: 127 SMIGIGGAIGTALFVSIGTKIIQGGPGSLLIAFCLWSVVFIGLSKCMCVMVTYLPVTGSF 186

Query: 119 TSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVV 178
             +  R+ D + GFAVG+ Y          ++TA  LV++YW D+  +     I++ +++
Sbjct: 187 VHFTERFVDQSCGFAVGWTYFVCQAANVCFEITAVCLVVEYWTDK--IPKAALISMLIIL 244

Query: 179 IVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFK 238
              +N   V +FGE EF+LS  K+++  G+I+F  ++M GG P H  LGF+ W NPGAF 
Sbjct: 245 FGSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFTVVVMAGGNPQHTVLGFKNWSNPGAFA 304

Query: 239 PYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIIL 298
            Y     GS G+F  F++  V+AL+ + G++  G  A+EA NPR+ IP + +    R+I+
Sbjct: 305 EYISD--GSVGRFHGFMSCLVFALYVFWGVDYLGNAASEAMNPRKVIPSSFRKVFGRLII 362

Query: 299 FYIVTIFLLGMCVAYNDPRLLXXXXXXXXXX-XXPFVVAIQNSGVRALPHIFNVCVLIFV 357
           FYI     +G+ + YNDP ++             P+V A++  G+R LPHI N+ +L  +
Sbjct: 363 FYIGGAICVGILIPYNDPNMIRAIKEGAVGAGASPYVSAMKTLGIRVLPHIVNILILTSI 422

Query: 358 FSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSA 417
            SA NS LY  +R L+ LA+D +AP++F  T + GVP             AY++VS+ + 
Sbjct: 423 ISAGNSSLYSASRVLHRLALDNQAPRIFKVTTKKGVPVYCCIAVLVICGLAYLSVSNSTN 482

Query: 418 QIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFC 477
            +  +F+NV +    + +I I ++Y+ F + C+AQNVD  S  Y +   PY A+ +LF+ 
Sbjct: 483 NVLTWFLNVETAAMAIVYIFICVSYLQFRKGCLAQNVDLKSLPYYSSSLPYLAWHSLFWL 542

Query: 478 VLIAFIKNFTVFI-GEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKE 536
           VL+  +  +TVF+ G +D +SF+  Y  +P +++F FG+K+   TK V+  E DL++  E
Sbjct: 543 VLMLLVNGYTVFLKGSWDTQSFVFSYFMIPFFLVFLFGHKLYKGTKSVRPLEMDLFTGIE 602

Query: 537 AI 538
            +
Sbjct: 603 EL 604

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  303 bits (775), Expect = 6e-95,   Method: Compositional matrix adjust.
 Identities = 178/508 (35%), Positives = 274/508 (53%), Gaps = 13/508 (2%)

Query: 20  LEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXX 79
           +++ T  S++S   E     + D +     + + LK+RH+ +IA+               
Sbjct: 21  MKEKTQFSIHSTGDEVSQGSVLDIESQKPGIVRGLKSRHVQLIALGSAIGTGLFIGSGGA 80

Query: 80  XXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFT---SYATRYCDPALGFAVGY 136
                PA +LIAY+ + + V+ VM  + EM T IPL G +   S    Y +  L F  G+
Sbjct: 81  LSICGPAPLLIAYAVMSLFVWSVMNQMTEMVTLIPLPGESTLYSLLKLYVNKPLSFMCGW 140

Query: 137 CYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFW 196
              +   +I P ++TA AL++QYW D    NP ++I+IFLV+ V I  + V+ FGE EFW
Sbjct: 141 NLFYAQAMIAPAEVTACALLVQYWTD---ANPAIFISIFLVLSVAITMLPVKVFGESEFW 197

Query: 197 LSSFKIMVMFGVILFLFIIMLGGGPNHDR-LGFRYWKNPGAFKPYSESITGSKGKFVSFV 255
           +SS KI+ + G+I+   +I  GGGP  +  LGF YWK PGAFKPY   + G  GKF++F 
Sbjct: 198 VSSIKILTIVGLIIVGVVIFFGGGPAQEHVLGFHYWKKPGAFKPYL--VEGGTGKFLAFW 255

Query: 256 AVFVYALFAYLGI-ELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYN 314
              + + F+++ + E+    AAEA  PRRN+PRA K  +YR+ LFY+  I ++G+ V Y+
Sbjct: 256 TAIIKSGFSFVLVPEIVSSCAAEAVAPRRNMPRACKRFIYRLALFYVFGILVVGVIVGYD 315

Query: 315 DPRLL-XXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLY 373
           + RLL             PFV+ I+ +G+R LPHI N  +L   +S     LY  +R+L+
Sbjct: 316 NDRLLNAIASGQSSAAASPFVIGIKEAGIRVLPHIINAAILTSAYSCGTGLLYGASRTLH 375

Query: 374 SLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGIL 433
           S+A  G AP++    N++GVPY            AY+N S+ S+ +FN+  N+ +I G +
Sbjct: 376 SMACKGDAPRILTTVNKYGVPYYCTGITSLFCLLAYLNCSNSSSVVFNWLSNIATISGFV 435

Query: 434 SWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI-GE 492
           SW+ + I YI F R  I      +   +R P+Q   AY+ + F  ++     F VFI G 
Sbjct: 436 SWVLVSIAYIRF-RNVIDVLKLNDRIPFRVPYQKPLAYLAMGFFSILTLTNGFAVFIKGN 494

Query: 493 FDYKSFITGYIGLPLYVIFYFGYKIIYK 520
           +D  +F   YI L   ++ + G  I YK
Sbjct: 495 WDTSNFFAAYITLGFVLVLFVGSTIYYK 522

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  298 bits (764), Expect = 9e-93,   Method: Compositional matrix adjust.
 Identities = 170/486 (34%), Positives = 269/486 (55%), Gaps = 18/486 (3%)

Query: 41  SDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVF 100
            DG+++  +LK+ L ARHI +IA+                    PA ++ +Y  +  +V+
Sbjct: 95  EDGRKN--KLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGPAGLVASYLIISTMVY 152

Query: 101 FVMACLGEMATYIPLDGFTSYAT------RYCDPALGFAVGYCYLFKYFIITPNQLTAGA 154
            +M  LGEM  Y+P DG  S  +      RY D +L FA G+ Y + + ++   + TA +
Sbjct: 153 PIMNVLGEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYYYCFVMLVAAECTAAS 212

Query: 155 LVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFI 214
            V++YW   + V    WI +F ++I  +N   VR +GE EFW +  KI+ + G+I+  FI
Sbjct: 213 GVVEYW--TKVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISKILCIVGLIILSFI 270

Query: 215 IMLGGGPNHDRLGFRYWKNPGAFKPYSESIT-GSKGKFVSFVAVFVYALFAY-LGIELTG 272
           +  GGGPNHDRLGFRYW  PG+F   + +IT GS G F+      +   F++ LG EL  
Sbjct: 271 LFWGGGPNHDRLGFRYWITPGSF---ANTITNGSFGNFLDVYKGIILGAFSFILGPELVV 327

Query: 273 IVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRL-LXXXXXXXXXXXX 331
           + ++E  +PRRNI +A K  ++R++ FYI+    + + V+YNDP L              
Sbjct: 328 LPSSECSDPRRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPILSTALIQDKPGAGSS 387

Query: 332 PFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRW 391
           PFV+ IQN+G+  LPHI NVC+LI  +S+ N+ L+  +RSL ++AI+ +APK   K NR+
Sbjct: 388 PFVIGIQNAGIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAINSQAPKCLGKINRF 447

Query: 392 GVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIA 451
           GVPY A          AY+N S  ++ +F +F N+ +I G L WI + +TY+ F +A I 
Sbjct: 448 GVPYVAVIVSIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIVSVTYLRFRKA-IE 506

Query: 452 QNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGE-FDYKSFITGYIGLPLYVI 510
            +  ++   Y    QPY    +L   ++I     F + I   ++   FI  Y+ LP++++
Sbjct: 507 YHGMKDRLPYTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVSDFIAAYLTLPIFLM 566

Query: 511 FYFGYK 516
            + G+K
Sbjct: 567 IWIGHK 572

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  291 bits (746), Expect = 1e-90,   Method: Compositional matrix adjust.
 Identities = 172/521 (33%), Positives = 276/521 (52%), Gaps = 16/521 (3%)

Query: 16  DIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXX 75
           D  + EK+        + ED S ++ +G+E   ++ ++LK+RHI +IA+           
Sbjct: 35  DSWNNEKSAYQVDQIIDVEDASMELIEGQEH--QVARKLKSRHIQLIALGGAIGTGLFIG 92

Query: 76  XXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTSY---ATRYCDPALGF 132
                    PA +LI+Y  +   V+ +M  L EM   +P+ G TS       Y +  L F
Sbjct: 93  SGGALSVCGPAPLLISYMIMSFFVWCIMNFLTEMVCMMPISGETSMFAMTGTYLNKPLSF 152

Query: 133 AVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGE 192
             G    +   +I P+++TA A++IQYW D    N  ++I+IF+VV V +  + V +FGE
Sbjct: 153 MCGINLFYAMSMIAPSEITATAILIQYWTD---ANSAIFISIFIVVTVSLTMLPVHFFGE 209

Query: 193 FEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDR-LGFRYWKNPGAFKPYSESITGSKGKF 251
            EFW+S  K+  + G+++   +I  GG PN D+ LGF YWK+PGAF P+   + G+ GKF
Sbjct: 210 SEFWVSIIKLFCITGLVILGIVIFFGGAPNQDKVLGFHYWKHPGAFNPHL--VPGNTGKF 267

Query: 252 VSFVAVFVYALFAYLGI-ELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMC 310
           ++     + + F+Y+ + E+    AAEA++PRRN+PR  +  +YR+ LFY+     +G+ 
Sbjct: 268 LACWTAIIKSGFSYVLVPEVVVSCAAEAKDPRRNMPRVAQRFVYRLALFYVCGSLTIGIM 327

Query: 311 VAYNDPRLLXXXXX-XXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGT 369
           V Y++ RLL             PFV+ IQ  G+R LPHI N C+L   +S   S LY  +
Sbjct: 328 VGYDNSRLLNAIAAGESNAAASPFVIGIQEVGIRVLPHIINACILTSAYSCGTSVLYGAS 387

Query: 370 RSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSI 429
           R L+S+A++G  PK+FA TNR+G PY +          AY+N S  S+ +F +  N+ +I
Sbjct: 388 RVLHSMAVNGAVPKIFATTNRFGTPYYSTAAASVFCLLAYLNCSDSSSVVFTWLSNIATI 447

Query: 430 FGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVF 489
            G + W+ + + Y+ F R  I      +   +R  F    AY++  F  +++    + VF
Sbjct: 448 SGFVDWMLVCVVYLRF-RKVIEHANLTDKMPFRKRFMKPLAYLSCGFFAILSLTNGYAVF 506

Query: 490 IGE-FDYKSFITGYIGLPLYVIFYFGYKIIYKT-KLVKAEE 528
           + + ++   F   Y  L L  + Y G  I YKT KL   +E
Sbjct: 507 VADNWNVSDFFACYTTLGLAAVLYIGAAIYYKTIKLRDLDE 547

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  290 bits (742), Expect = 4e-90,   Method: Compositional matrix adjust.
 Identities = 169/510 (33%), Positives = 274/510 (53%), Gaps = 15/510 (2%)

Query: 20  LEKNTTSSLNSFEQEDDSNKISDGK--EDGVRLKKELKARHISMIAIXXXXXXXXXXXXX 77
           +++   SS+N    + D    SD +  +   ++ + LK RHI +IA+             
Sbjct: 23  IKEQAFSSVNDVIGDSDQGSYSDIENFKPPQKIVRGLKTRHIQLIALGSAIGTGLFIGSG 82

Query: 78  XXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG---FTSYATRYCDPALGFAV 134
                  PA +LIAY  +   V+ +M  + EM   IPL G     S A  Y +  + F  
Sbjct: 83  GALSVCGPAPLLIAYIIISFFVWSIMNQMTEMVCLIPLPGEASLYSLAKTYLNSPISFMC 142

Query: 135 GYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFE 194
           G+   +   +I P ++TA AL++QYW D    N  ++I+IF+VV +++  + V+ FGE E
Sbjct: 143 GWNLFYAMAMIVPAEITACALLVQYWTD---ANSAIFISIFIVVSILLTMLPVKVFGESE 199

Query: 195 FWLSSFKIMVMFGVILFLFIIMLGGGPNHDR-LGFRYWKNPGAFKPYSESITGSKGKFVS 253
           FW+SS KI+ + G+I+   +I  GGGP  D  LGF YWKNPGAF P+     G+ G+F++
Sbjct: 200 FWVSSIKILTIVGLIIVGIVIFFGGGPAQDHVLGFHYWKNPGAFNPHLAE--GNTGRFLA 257

Query: 254 FVAVFVYALFAYLGI-ELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVA 312
                + + F+++ + E     +AE   PRRN+P+A +  +YR+ +FYIV   ++G+ V 
Sbjct: 258 VWTAIIKSGFSFVLVPETVTSCSAECIAPRRNMPKACQRFIYRLAIFYIVGTLVVGVIVG 317

Query: 313 YNDPRLLXXXXX-XXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRS 371
           +N+ RL+             PFV+ IQ +G++ LPHI N C+L   +S     LY  +R+
Sbjct: 318 FNNDRLINAIQSGKSDAAASPFVIGIQEAGIKILPHIINACILTSAYSCGTGLLYGSSRT 377

Query: 372 LYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFG 431
           LYS+A+ G APK+FAK NR+G PY +          AY+N S  ++ +FN+  N+ +I G
Sbjct: 378 LYSMALRGDAPKIFAKVNRFGTPYYSTGLASLFSFLAYLNCSKSASVVFNWLSNIATISG 437

Query: 432 ILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI- 490
            +SWI + +TYI F +   A +++ +   +R PFQ   AY+T  F  +++    + VF+ 
Sbjct: 438 FVSWIFVSMTYIRFRKVINALDLN-DRVPFRRPFQVPLAYLTCGFFFILSLTNGYAVFVK 496

Query: 491 GEFDYKSFITGYIGLPLYVIFYFGYKIIYK 520
           G ++   F   Y+ +   +  Y      YK
Sbjct: 497 GNWNVSDFFASYVTIGFVIFLYLVGSFYYK 526

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  288 bits (737), Expect = 3e-89,   Method: Compositional matrix adjust.
 Identities = 168/514 (32%), Positives = 274/514 (53%), Gaps = 15/514 (2%)

Query: 15  EDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXX 74
            D+   E   T S+   + E  S  +   ++   ++++ LK+RH+ +IA+          
Sbjct: 24  SDMKVKENFVTESIQEDDLERGSIDVLIDEKPSHQMQRGLKSRHMQLIALGCAIGTGLFI 83

Query: 75  XXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTSY---ATRYCDPALG 131
                     PA +LI+Y  +   V+ +M  L EM    P+ G  S    A  Y +  L 
Sbjct: 84  GTGGALSTCGPAPLLISYIIMSFFVWTIMHQLTEMVVLTPIPGEASMYALARAYLNRPLS 143

Query: 132 FAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFG 191
           F  G+   +   +I P+++TA  L+IQYW D    N  ++++IF+V+ + +  + V+ FG
Sbjct: 144 FMCGWNLFYAQAMIAPSEITASTLLIQYWTD---ANSAIFVSIFIVITIAVTALPVKVFG 200

Query: 192 EFEFWLSSFKIMVMFGVILFLFIIMLGGGPN-HDRLGFRYWKNPGAFKPYSESITGSKGK 250
           E EFW+S  K++ + G+I+   +I  GGGPN H  LGF YWK+PGAFKP+    TG+ GK
Sbjct: 201 ESEFWVSMIKLITITGLIILGVVIFFGGGPNQHHVLGFHYWKHPGAFKPHIS--TGNTGK 258

Query: 251 FVSFVAVFVYALFAY-LGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGM 309
           F++     + + FA+ L  E     +AEA+ PRRN+PRA    ++R++LFYI    ++G+
Sbjct: 259 FLAVWTAIIKSGFAFILSPETLTSCSAEADRPRRNMPRAANRFVWRLMLFYIGGALVVGV 318

Query: 310 CVAYNDPRLLXXXXX-XXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVG 368
            V Y++  LL             PFV+ I+  G++ LPHI N  +L   +SA  +++Y  
Sbjct: 319 TVGYDNQNLLSAIASGQSNAAASPFVIGIKEVGIKVLPHIINAAILTGAYSAGTAEMYGA 378

Query: 369 TRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVS 428
           +R L+S+A+ G APK+FA+ NR+GVPY +          AY+N S+ ++Q+F +  N+ +
Sbjct: 379 SRMLHSMALKGNAPKIFARVNRYGVPYYSIIVPSCFCFLAYLNCSNSASQVFTWLTNIST 438

Query: 429 IFGILSWISILITYIFFYRACIAQNVDRNS-FAYRAPFQPYGAYITLFFCVLIAFIKNFT 487
           I G +SW+ + ITY+ F R  +   +D N    +R PFQ   AY +  F V+++    + 
Sbjct: 439 ISGFISWVFVSITYVRFRR--VIDYLDLNDRIKFRKPFQRIFAYFSGCFFVILSLTNGYA 496

Query: 488 VFI-GEFDYKSFITGYIGLPLYVIFYFGYKIIYK 520
           VF  G +    F   YI +   V+ +      YK
Sbjct: 497 VFTKGNWSVSDFFANYITIGFVVVLFIMGTAYYK 530

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  287 bits (734), Expect = 4e-89,   Method: Compositional matrix adjust.
 Identities = 164/486 (33%), Positives = 265/486 (54%), Gaps = 8/486 (1%)

Query: 51  KKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMA 110
           +++L  R +SMI I                    P S+LIA+    ++   +  C+  M 
Sbjct: 46  RRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAFCLWSVVFIGLSQCMCVMV 105

Query: 111 TYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPG 169
           TY+P+ G F  +  R+ D + GF+VG+ Y          ++TA  LV+++W D+  +   
Sbjct: 106 TYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVVEFWTDK--IPKA 163

Query: 170 VWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFR 229
             I+I + +   +N   V  FGE EF+LS  K+++  G+I F  ++M GG P H  LGF+
Sbjct: 164 ALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGGNPQHKVLGFK 223

Query: 230 YWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAI 289
            W NPGAF  Y     GS GKF  F++  ++AL+ + G++  G  A+EA NPR+ IP + 
Sbjct: 224 NWSNPGAFAEYISK--GSAGKFHGFMSCLIFALYVFWGVDYLGNAASEAMNPRKVIPSSF 281

Query: 290 KLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXX-XXXXXXXPFVVAIQNSGVRALPHI 348
           +    R+I+FYI     +G+ V +ND  ++             P+V A++  G+  LPHI
Sbjct: 282 RKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPYVSAMKTLGIGVLPHI 341

Query: 349 FNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXA 408
            NV +L  + SA NS LY  +R L+ LA++G+APKLF  T R GVP             A
Sbjct: 342 VNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLFKITKR-GVPIYCCVAVLLVCGLA 400

Query: 409 YMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPY 468
           Y++VS+ +  +  +F+NV +    + +I I I+Y+ F + C AQN+D  +  Y + F PY
Sbjct: 401 YLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLKTLPYSSSFLPY 460

Query: 469 GAYITLFFCVLIAFIKNFTVFIGE-FDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAE 527
             + +LF+ VL+ F+  + VF+ + +D +SFI  Y  +P +++ + G+K+  KT+ VK  
Sbjct: 461 LGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGHKLYKKTRFVKPV 520

Query: 528 EADLYS 533
           E DL+S
Sbjct: 521 EMDLFS 526

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  285 bits (728), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 172/529 (32%), Positives = 279/529 (52%), Gaps = 17/529 (3%)

Query: 1   MSVYEVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGK--EDGVRLKKELKARH 58
           MS +E+T  S   R+   + +K+    + + EQ+ +   +SD    +    + + LK+RH
Sbjct: 15  MSNFEMTDASLTSRDHSTNQKKDAI--ITAVEQDIERGSLSDIDTIKPSTEVSRGLKSRH 72

Query: 59  ISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGF 118
           +  IA+                    PA +LI+YS +   V+ +M  + EM   IPL G 
Sbjct: 73  VQFIALGGAIGTGLFIGSGTALSSCGPAPLLISYSVMSFFVWAIMNQMTEMVVLIPLSGE 132

Query: 119 TSYAT---RYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIF 175
           +S A+    Y +    F  G+   +   ++ P ++TA AL+I+YW D    N  +++TIF
Sbjct: 133 SSMASLAGTYLNRPSSFMCGWNCFYAMSMVVPTEITACALLIEYWTD---ANAAIFVTIF 189

Query: 176 LVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGP-NHDRLGFRYWKNP 234
           +++  +++ + V+ FGE EF +S  KI+ + G+IL   +I  GGGP  H  LGF YW  P
Sbjct: 190 MILATLLSLLPVKIFGESEFCVSIIKILTILGLILVGVVIFFGGGPAQHKVLGFHYWNTP 249

Query: 235 GAFKPYSESITGSKGKFVSFVAVFVYALFAYLGI-ELTGIVAAEAENPRRNIPRAIKLTM 293
           GAF  Y   + GS G F++     + + FA++ I E+T   +AEA  PR+N+PRA +  +
Sbjct: 250 GAFNSYL--VKGSTGAFLAVWKAIIKSGFAFVMIPEITSSCSAEAAFPRKNMPRACQRFV 307

Query: 294 YRIILFYIVTIFLLGMCVAYNDPRL-LXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVC 352
           YR+ +FY++   ++G+ V Y++  L              PFV+ IQ +G+R LPHI N C
Sbjct: 308 YRLAVFYVLGCLVIGVIVGYDNKTLNEAISSGKANAAASPFVIGIQEAGIRILPHIINAC 367

Query: 353 VLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNV 412
           +L   +S   S+LY  +R L+SLA+ G APK F+K N++GVPY +          AY+N 
Sbjct: 368 ILTSAYSCSTSELYGASRVLHSLALRGDAPKFFSKVNKYGVPYYSVAATSLFGVLAYLNC 427

Query: 413 SSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYI 472
           S  S  +FN+  N+ +I G ++W+ + ITY+ F +      ++ +   YR   Q   AY 
Sbjct: 428 SKSSLVVFNWLSNIATISGFVNWVFVSITYLRFRKITDYLKIN-DRVPYRRRGQRALAYA 486

Query: 473 TLFFCVLIAFIKNFTVFI-GEFDYKSFITGYIGLPLYVIFYFGYKIIYK 520
           +  F  L+A    F VFI G ++   F T Y+ +    + + G  I YK
Sbjct: 487 SAIFFALLAITNGFYVFIAGNWNVSDFFTCYVTIGFVGVLFIGSSIYYK 535

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  284 bits (726), Expect = 8e-88,   Method: Compositional matrix adjust.
 Identities = 171/531 (32%), Positives = 274/531 (51%), Gaps = 15/531 (2%)

Query: 5   EVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAI 64
           E T   + ++  I + + +    + S E+      + +   D  +LK+ LK RHI M+ +
Sbjct: 7   ESTNSQEKVKPKIYEEDVDEEHDIVSVEETVKRGVLHN---DRTKLKQGLKERHIKMLTL 63

Query: 65  XXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFT-SYAT 123
                               P  +LIAY FVGI+V      + E+A+++P  G T  +A 
Sbjct: 64  VGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAE 123

Query: 124 RYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIIN 183
           ++ D ++GF  G+  +  Y  + P +L+A A++++YW D   V+P V+IT+F ++ V+ N
Sbjct: 124 QFIDESVGFTFGW--ISTYSSLMPGELSATAVIMRYWTD---VSPAVFITVFGILFVVTN 178

Query: 184 TVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSES 243
              +R++GE E+     K++++F +I+   +I LGG    +RLGF YW+ PG F  Y   
Sbjct: 179 IYTIRFYGELEYIFGWLKLVLIFILIISGLVIDLGGTKGQERLGFHYWREPGPFANYL-- 236

Query: 244 ITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVT 303
           + G  GKFV F A     +++Y GI+   I+A E +N R  I    K    RII+ Y+VT
Sbjct: 237 VGGHIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFLRIIVLYLVT 296

Query: 304 IFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNS 363
           +F+L + V YND  +             PFV+A+  +G++ LPHI N  +L   +SA N 
Sbjct: 297 VFILTLIVPYNDKLI---ATGTGTARSSPFVIAMNRAGIKVLPHIVNALILTSAWSAGNL 353

Query: 364 DLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYF 423
            +  G+R+L+ LA   +APK+F +T++ G+PY            AYM+ S  SA +F +F
Sbjct: 354 AIIEGSRNLFCLATKNQAPKIFLRTSKRGIPYVGVIFISSFLPLAYMSCSKSSATVFGWF 413

Query: 424 VNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFI 483
             +VS   +L WI I   +I   RA  AQ   R+   Y  P  P+ A+ +     +    
Sbjct: 414 QELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPYSTPMGPFAAWFSGIMSFIFLLT 473

Query: 484 KNFTVFI-GEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYS 533
             F  FI G FD +SF T Y  +PL +  +  +K+  KTK ++  E DL S
Sbjct: 474 GGFYNFIHGHFDIESFFTRYFIIPLAIGLFTFWKLFKKTKYLRPHEVDLES 524

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  283 bits (725), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 177/570 (31%), Positives = 298/570 (52%), Gaps = 54/570 (9%)

Query: 13  IREDIIDLEKNTTSSLNSFEQEDDSNKISDG------------------KEDGVR-LKKE 53
           ++ D+ +     T++++ +++ +D N I DG                  KE   R LK  
Sbjct: 1   MKSDMSESSDMATTNISVYDK-NDKNNIKDGVSFEKPIIYSEVDIESGAKESSSRNLKHG 59

Query: 54  LKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYI 113
           L++RHI +IA+                    PA+++I+Y  +  +V+ +M   GEM  Y+
Sbjct: 60  LQSRHIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIMNMFGEMVCYL 119

Query: 114 PLD-------GFTSY-ATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRET 165
           P +       G+ +Y  ++Y D +LGFA  + Y + + ++   + TA + +++YW  +  
Sbjct: 120 PGNDDDDESVGYCAYLVSKYVDESLGFATSWNYYYCFIVLVATECTAASSIVEYWTSK-- 177

Query: 166 VNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDR 225
           +   V I +FL VI ++N + V+++GE EFW +  KI  + G+I+  F+I  GG PN++ 
Sbjct: 178 IPKAVLIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGAPNNED 237

Query: 226 ---LGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAY-LGIELTGIVAAEAENP 281
              +GF YWKNP +F+ Y  +  GS G F+      +   FA+ LG EL  + ++E  + 
Sbjct: 238 NSFVGFHYWKNPSSFRDYVTN--GSLGNFLDVYNALIKGAFAFILGPELVSLTSSECVDQ 295

Query: 282 RRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXX-XXXXXPFVVAIQNS 340
           RRNI +A +  +YR++ FYI     + + V YNDP LL             PFV+ IQN+
Sbjct: 296 RRNIAKASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSSPFVIGIQNA 355

Query: 341 GVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXX 400
           G+  LPHI N C+L    SA N+ L+  TR+L ++  +G AP++F++ NR GVPY A   
Sbjct: 356 GITILPHIINFCILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPYVALSL 415

Query: 401 XXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFA 460
                  A++N S+ SA++F +F N+ +I G + W +  I Y+ F R      +D N   
Sbjct: 416 SIMIACLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRT-----IDYNGLY 470

Query: 461 YRAPFQPYGA-YITLF---FCVLIAFIKNFTVFIGEF-DYKSFITGYIGLPLYVIFYFGY 515
            R PF+  G  Y+T +   F  ++     +   I +F +Y+ FI  YI LP++++ YFG+
Sbjct: 471 DRLPFKTKGQVYLTWYSFVFVGILILTNGYMYIIPKFWNYQDFIAAYITLPVFLVLYFGH 530

Query: 516 KIIYKTKLVK------AEEADLYSFKEAID 539
            IIY  +  +       +E D+ +  E I+
Sbjct: 531 -IIYSGRWRQRKWWKPVDEIDVVTGLEEIE 559

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  281 bits (719), Expect = 5e-87,   Method: Compositional matrix adjust.
 Identities = 175/536 (32%), Positives = 275/536 (51%), Gaps = 21/536 (3%)

Query: 5   EVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAI 64
            +TK+   I E  + LE+  T         D++ K      D  +LK+ LKARHI M+ +
Sbjct: 9   SLTKEKVAIDEAEVQLEEGVTL--------DETIKQGVLHNDRTKLKQGLKARHIKMLTL 60

Query: 65  XXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFT-SYAT 123
                               P  +LIAY  VGI+V      + E+A+++P  G T  ++ 
Sbjct: 61  VGVFGTGLFLSSGGTLKKTGPVGMLIAYVLVGIVVGCNQIAIAEVASFMPATGATIRHSE 120

Query: 124 RYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIIN 183
           ++ D A+GF  G+  +  Y  + P +L+A A+V+ YW D   ++P ++ITIF V+ ++ N
Sbjct: 121 QFIDEAVGFTFGW--ISTYSSLMPGELSATAVVMTYWTD---LSPAIFITIFGVLFILTN 175

Query: 184 TVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSES 243
              +R++GE E++    K+ ++  +I+   +I LGG    +RLGF YW+NPG F  Y   
Sbjct: 176 IYTIRFYGEIEYFFGWLKLALIAILIITGLVIDLGG-TKQERLGFHYWRNPGPFAEYL-- 232

Query: 244 ITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVT 303
           + G  GKFV F A     +++Y GI+   I+A E +N R  I    K    RIIL Y++T
Sbjct: 233 VGGDTGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFVRIILLYLIT 292

Query: 304 IFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNS 363
           +F+L + V YND  +             PFV+A++ +G++ LPHI N  +L   +SA N 
Sbjct: 293 VFVLTLIVPYNDKLI---ATGSGNARSSPFVIAMERAGIKVLPHIVNALILTSAWSAGNL 349

Query: 364 DLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYF 423
            +  G+R+L+ LA   +APK+F KT++ G+P+            AYM+ S  SA +F++F
Sbjct: 350 AIIEGSRNLFCLATKNQAPKIFLKTSKRGIPWVGVLFISSFLPLAYMSCSESSATVFSWF 409

Query: 424 VNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFI 483
             +VS   +L WI I   +I   RA  AQ   R    Y     PY A+ +     +    
Sbjct: 410 QELVSSNTLLRWILISANHIHMDRALRAQGYSRKDLPYSTTIAPYAAWFSGIMSFIFLLT 469

Query: 484 KNFTVFI-GEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAI 538
             F  FI G FD +SF + Y  +PL +  +  +K+  KT+ ++  E DL S  E I
Sbjct: 470 GGFYNFIHGNFDIESFFSRYFIIPLAIALFTFWKLFKKTRYLRPHEVDLQSIFEDI 525

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  281 bits (719), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 173/537 (32%), Positives = 266/537 (49%), Gaps = 27/537 (5%)

Query: 19  DLEKNTTS--SLNSFEQ-EDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXX 75
           DLE + T+  S+NS ++ ++        K +   LKK +K RH+ MI++           
Sbjct: 108 DLENDLTTAISMNSLDRVQNKPTGNGQMKFEEEALKKSIKPRHVVMISLGTGIGTGLLVG 167

Query: 76  XXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIP--LDGFTSYATRYCDPALGFA 133
                    PA ++I Y+ +G  ++ ++   GEMA      L GF +Y +   DP  GFA
Sbjct: 168 NAKALHNAGPAGLVIGYAIMGSCIYCIIQAAGEMAVVYSNLLGGFNTYPSMLVDPGFGFA 227

Query: 134 VGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEF 193
           V + Y  ++  + P +L   +L I+YW    TVNP  ++ IF VVI+ I   G R + E 
Sbjct: 228 VAWVYCLQWLCVCPLELVTTSLTIKYWT--TTVNPDAFVVIFYVVIIFIQIFGARGYAEA 285

Query: 194 EFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKG--KF 251
           EF+ +  KI+++ G  +   II  GG  N   LG +YW +PGAF+       G+ G  +F
Sbjct: 286 EFFFNCCKILMIIGFYILGIIINAGGAGNDGYLGAKYWHDPGAFR-------GTNGIQRF 338

Query: 252 VSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCV 311
              +A FV A FA+   E   + AAE  NPR+ IP A K  +YR+I  ++ TI LLG  V
Sbjct: 339 KGIMATFVSAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRVICIFVGTIALLGFLV 398

Query: 312 AYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRS 371
            ++  +L+            P+V+AI   GVR +PH  N  +LI VFS  NS  Y  +R 
Sbjct: 399 PWDSDQLMGAGGSATKAS--PYVLAISIHGVRVVPHFINAVILISVFSVANSAFYSSSRL 456

Query: 372 LYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFG 431
           L  LA  G APK F   +R G P+ A          A+   S    Q+F + + +  +  
Sbjct: 457 LLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVIAFCAASPKEDQVFTWLLAISGLSQ 516

Query: 432 ILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI- 490
           + +WI+I +++I F RA   Q        ++A    YG+Y      VL A I  F V I 
Sbjct: 517 LFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGVYGSYYATIMMVL-ALIAQFWVAIA 575

Query: 491 -----GEFDYKSFITGYIGLPLYVIFYFGYKIIYKT--KLVKAEEADLYSFKEAIDR 540
                G+ D + F   Y+ +P+ + FYFGYK+  +     ++A++ DL S+++  D 
Sbjct: 576 PIGNNGDLDAEGFFENYLAMPILIAFYFGYKLWKRDWRLFIRAKDIDLDSYRQVFDE 632

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  278 bits (711), Expect = 9e-86,   Method: Compositional matrix adjust.
 Identities = 171/501 (34%), Positives = 267/501 (53%), Gaps = 12/501 (2%)

Query: 35  DDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSF 94
           D++ K      D  +LK+ LK RHI M+ +                    P  +LIAY F
Sbjct: 29  DETLKQGVLHNDRTKLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLF 88

Query: 95  VGILVFFVMACLGEMATYIPLDGFT-SYATRYCDPALGFAVGYCYLFKYFIITPNQLTAG 153
           VGI+V      + E+A+++P  G T  +A ++ D ++GF  G+  +  Y  + P +L+A 
Sbjct: 89  VGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDESVGFTFGW--ISTYSSLMPGELSAT 146

Query: 154 ALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLF 213
           A++++YW D   ++P V+ITIF V+ V+ N   +R++GE E+     K++++F +I+   
Sbjct: 147 AVIMRYWTD---ISPAVFITIFGVLFVVTNIYTIRFYGEVEYVFGWLKLILIFILIISGL 203

Query: 214 IIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGI 273
           +I LGG    +RLGF YW++PG F  Y   + GS GKFV F +     +++Y GI+   I
Sbjct: 204 VIDLGGVKGQERLGFHYWRDPGPFAEYI--VGGSIGKFVGFWSALSSVVYSYSGIQNIAI 261

Query: 274 VAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPF 333
           +A E +N R  I    K    RII+ Y+VT+F+L + V YND  +             PF
Sbjct: 262 LAGETKNSRHAIYHGAKNVFLRIIVLYLVTVFVLTLIVPYNDALI---ASGTGTAKSSPF 318

Query: 334 VVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGV 393
           V+A+  +G++ LPHI N  VL   +SA N  +  G+R+L+ LA   +APK+F KT++ G+
Sbjct: 319 VIAMNRAGIKVLPHIVNALVLTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGI 378

Query: 394 PYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQN 453
           PY            AYM+ S  S+ +F +F  +VS   +L WI I   +I+  RA  AQ 
Sbjct: 379 PYVGVIFISCFLPLAYMSCSESSSTVFGWFQELVSSNTLLRWILISANHIYMDRALKAQG 438

Query: 454 VDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI-GEFDYKSFITGYIGLPLYVIFY 512
             R+   Y  P  PY A+ +     +      F  FI G FD +SF T Y  +PL +  +
Sbjct: 439 YSRSDLPYSTPIAPYAAWFSGIMSFIFLLTGGFYNFIHGHFDIESFFTRYFIIPLAIGLF 498

Query: 513 FGYKIIYKTKLVKAEEADLYS 533
             +K+  KT+ ++ EE DL S
Sbjct: 499 TFWKLFKKTRYLRPEEVDLAS 519

>TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  275 bits (703), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 170/523 (32%), Positives = 274/523 (52%), Gaps = 27/523 (5%)

Query: 5   EVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAI 64
           ++ ++ K    ++ID E+ + S L    Q +              + + LK+RHI +IA+
Sbjct: 20  QMKENMKASVNEVIDEEQGSISELEVKPQNE--------------MVRGLKSRHIQLIAL 65

Query: 65  XXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFTSY--- 121
                               PA ILI+Y  +   V+ ++  L EM   IPL G  S    
Sbjct: 66  GDAIGTGLFIGSGGALSTCGPAPILISYIVMSFFVWTIVNQLTEMVALIPLPGEASMYSL 125

Query: 122 ATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVI 181
           A  Y    L F  G+   +   +I P+++TA A++IQYW D    N  ++I+IF+V  V 
Sbjct: 126 ARMYVGRPLAFMCGWNLFYAMAMIAPSEITACAMLIQYWTD---ANSAIFISIFIVFSVA 182

Query: 182 INTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDR-LGFRYWKNPGAFKPY 240
           I  + VR FGE EF +SS K++ + G+I+   +I  GGGP+ D  LGF YWK PGAFK +
Sbjct: 183 ITMLPVRVFGESEFCVSSIKLLTIVGLIIVGIVIFFGGGPSQDHILGFHYWKKPGAFKEH 242

Query: 241 SESITGSKGKFVSFVAVFVYALFAYLGI-ELTGIVAAEAENPRRNIPRAIKLTMYRIILF 299
              + GS GKF++     + + F+++ + E     +AE+ +PRRN+PRA +  +YR+ LF
Sbjct: 243 L--VPGSTGKFLAVWTAIIKSGFSFVLVPETVASCSAESASPRRNMPRACQRFVYRLALF 300

Query: 300 YIVTIFLLGMCVAYNDPRLLXXXXX-XXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVF 358
           Y+  + ++ + V  +D  LL             P+V+ I+ +G++ LPHI N C+L   +
Sbjct: 301 YVAGVLVVTVVVGSDDANLLNAIHSGASNAAASPYVIGIKEAGIKVLPHIINACILTSAY 360

Query: 359 SACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQ 418
           S   ++LY  +R L+S+A+ G AP++FAK NR+GVPY +          AY+N S  S+ 
Sbjct: 361 SCGTAELYGCSRILHSMAMKGDAPQIFAKVNRFGVPYYSTAVACLFTLLAYLNCSKSSSL 420

Query: 419 IFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCV 478
           +FN+  N+ +I G +SW+ + +TY  F R  I +    +   +R  FQ   AY  + F V
Sbjct: 421 VFNWLSNIATISGFISWVFVSVTYTRF-RTVIDKLDLNDRIPFRRRFQKGFAYACIAFFV 479

Query: 479 LIAFIKNFTVFI-GEFDYKSFITGYIGLPLYVIFYFGYKIIYK 520
           L++    + VFI G ++   F   Y+ +    + + G  I YK
Sbjct: 480 LLSLTNGYAVFIKGNWNTSDFFASYVTIGFVAVLFIGSTIYYK 522

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  276 bits (705), Expect = 2e-84,   Method: Compositional matrix adjust.
 Identities = 177/544 (32%), Positives = 284/544 (52%), Gaps = 26/544 (4%)

Query: 2   SVYEVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISM 61
           S ++  KDS   R ++ +L+ N T        E +   I+  +     L+ +LK RH+ M
Sbjct: 48  SRWKKIKDS-FKRAEVPELDPNLT--------EAEKIAIATARSP---LQHQLKNRHLQM 95

Query: 62  IAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTS 120
           I+I                    PA ILI +   G +++ ++  + E+A   P+  GFT+
Sbjct: 96  ISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSVAELAIAFPVAGGFTT 155

Query: 121 YATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIV 180
           YATR+ D + GFA  + Y+ ++ +  P ++ A ++ + YW   +    G ++ +F VVIV
Sbjct: 156 YATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKKYRDG-FVALFWVVIV 214

Query: 181 IINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPY 240
           IIN  GVR +GE EF  S  KI+++ G I+   I++ GGGP    +G RYW +PGAF   
Sbjct: 215 IINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGYIGARYWYHPGAFAGD 274

Query: 241 SESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFY 300
           +     S  KF  F +VFV A F++ G EL G+ AAEA NPR+++P A K   +RI +FY
Sbjct: 275 T-----SGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKDVPGAAKQVFWRITMFY 329

Query: 301 IVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSA 360
           ++ + L+GM V Y DPRL+            PFV+AI+N G+  LP + NV +LI V S 
Sbjct: 330 VLCLLLIGMLVPYTDPRLIGGSSVDAAAS--PFVIAIKNQGISGLPTLVNVVILIAVLSV 387

Query: 361 CNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIF 420
            NS +Y  +R+L +LA  G  PK F+  +R G P             A++  S    ++F
Sbjct: 388 GNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFGLIAFVAQSDKEGEVF 447

Query: 421 NYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLI 480
           ++ + +  +  + +W +I + +I F RA  AQ    N  A+ +P   +GA   LF C+++
Sbjct: 448 DWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPAGVWGAAWGLFLCIIM 507

Query: 481 AFIKNFTVFI---GEFDYKSFITGYIGLPLYVIFYFGYKIIYKT-KL-VKAEEADLYSFK 535
              + +              F  GY+ LP+ +  + G+KI  K  KL +KAE+ D+ + +
Sbjct: 508 LAAQFYVALFPLGAPPSANDFFQGYLSLPIVLAMWLGHKIWKKNWKLFIKAEDMDIDTGR 567

Query: 536 EAID 539
             +D
Sbjct: 568 RELD 571

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  271 bits (694), Expect = 8e-83,   Method: Compositional matrix adjust.
 Identities = 170/543 (31%), Positives = 280/543 (51%), Gaps = 25/543 (4%)

Query: 14  REDIIDLEKNTTSSL---------NSFEQEDD-SNKISDGKEDGVRLKKELKARHISMIA 63
            + I++ + +T SSL         N  E  +D ++ +S+     V L K L  RH+  +A
Sbjct: 24  EKSILEGKSSTQSSLLDLTLKKCDNGIEVVNDATSTVSNASVTNVNLNKNLSIRHLLTLA 83

Query: 64  IXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYA 122
           +                    PAS++I +  +   +F V+  LGEMA   P+  GF  Y 
Sbjct: 84  VGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINALGEMAAAFPVVGGFNVYI 143

Query: 123 TRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVII 182
           TR+ DP++GFAV   YL ++ ++ P +L A ++ I+YW D  T+N   W+ IF  VI   
Sbjct: 144 TRFVDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWND--TINSDAWVAIFYAVIAFA 201

Query: 183 NTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSE 242
           N + V+ FGE EF LS  KI+ + G  +   ++  GGGP    LG +YW NPG+F  ++ 
Sbjct: 202 NMLEVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPQGGYLGGKYWHNPGSFVGHT- 260

Query: 243 SITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIV 302
               S  KF    +VFV A F+Y GIE+T + AAE+++PRR IP+A K T + I   YI 
Sbjct: 261 ----SGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRRTIPKAAKRTFWLITASYIT 316

Query: 303 TIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACN 362
            + L+G  V Y++PRLL            P V+AI+N G++ LP + N  +LI + S  N
Sbjct: 317 ILTLIGCLVPYDEPRLLSGSSSVDAASS-PLVIAIENGGIKGLPSLMNAIILISIISVAN 375

Query: 363 SDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNY 422
           S +Y  +R + ++A  G  P++    ++ G P NA          +++  S   A++F +
Sbjct: 376 SAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPVNAILFTLFFGLLSFVAASDKQAEVFTW 435

Query: 423 FVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAY---ITLFFCVL 479
              +  +  I  W++I I++I F +A   Q    +   Y +    +G++   I LF  ++
Sbjct: 436 LSALSGLSTIFCWMAINISHIRFRQAMKKQRKSLDELPYLSQTGVWGSWYGVIVLFLVLI 495

Query: 480 IAFIKNFTVFIGE-FDYKSFITGYIGLPLYVIFYFGYKIIYKTK--LVKAEEADLYSFKE 536
           ++F  +     G   D +SF  GY+  P+ +  Y G+K++Y+ K  +V  E+ D+ + + 
Sbjct: 496 VSFWTSLFPLGGSGADAESFFQGYLSFPILIACYVGHKLVYRKKQIVVALEDMDIDTGRR 555

Query: 537 AID 539
            +D
Sbjct: 556 QVD 558

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  271 bits (694), Expect = 9e-83,   Method: Compositional matrix adjust.
 Identities = 173/548 (31%), Positives = 279/548 (50%), Gaps = 18/548 (3%)

Query: 2   SVYEVTKDSKLIREDIIDLEKNT---TSSLNSFEQEDDSNKISDGKEDGVRLKKELKARH 58
           S +   K S  ++ED + ++  +   T ++N     +DSN +S    DG  L K+L  RH
Sbjct: 38  SSFITEKRSNSLKEDNVMIQTTSSGATKNINGTSNPNDSNMLSKEDIDGSNLNKDLNIRH 97

Query: 59  ISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DG 117
           +  +A+                    PAS++I +  V   +F V+  LGE+A   P+  G
Sbjct: 98  LLTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWVIVSTALFTVINSLGELAAAYPVVGG 157

Query: 118 FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLV 177
           F+ Y TR+ DP++ F++   YL ++ ++ P +L A ++ I+YW D+  +N   W++IF  
Sbjct: 158 FSVYMTRFIDPSIAFSINLNYLVQWLVLLPLELVAASITIRYWNDK--INSDAWVSIFYT 215

Query: 178 VIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAF 237
           VI ++N + V+ FGE EF LS  KI+ + G  +   ++  GGGP    +G +YW +PGAF
Sbjct: 216 VIGLLNMLDVKSFGETEFVLSFIKILAIIGFTILGIVLSCGGGPVGGYIGGKYWHDPGAF 275

Query: 238 KPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRII 297
             ++     +  +F    +VFV A F+Y GIE+  + AAE+ +PR+ IP A K T + I 
Sbjct: 276 VGHT-----AGSQFKGLCSVFVTAAFSYSGIEMIAVSAAESIDPRKTIPVAAKRTFWLIT 330

Query: 298 LFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFV 357
             Y+  + L+G  V Y+DPRLL            P V+AI+N G++ LP + N  +LI V
Sbjct: 331 ASYVTILTLIGCLVPYDDPRLLNGSSSVDVASS-PLVIAIENGGIKGLPSLMNAIILIAV 389

Query: 358 FSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSA 417
            S  NS +Y  +R + S+AI G  PK   + ++ G P NA          +++  S   A
Sbjct: 390 LSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPINATLVTLFFGLISFVAASDKQA 449

Query: 418 QIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAY---ITL 474
           ++F +   +  +  I  W+ I I++I F RA   Q        Y +    YG++   I L
Sbjct: 450 EVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRSLEEMPYLSQVGVYGSWYGCIIL 509

Query: 475 FFCVLIAFIKN-FTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKT--KLVKAEEADL 531
           F  ++ AF  + F V   + +  +F  GY+ LP+ +  Y G+K  +K         E DL
Sbjct: 510 FLVLIAAFWTSLFPVGSSQANATTFFEGYLSLPILLACYVGHKFYFKNWRLFTPYNEIDL 569

Query: 532 YSFKEAID 539
            S K  ID
Sbjct: 570 DSGKRDID 577

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  270 bits (690), Expect = 4e-82,   Method: Compositional matrix adjust.
 Identities = 164/539 (30%), Positives = 281/539 (52%), Gaps = 28/539 (5%)

Query: 8   KDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXX 67
           KDS   R D +DL+ N T          D+ KI+        L+++LK RH+ MIAI   
Sbjct: 54  KDS-FKRMDSVDLDPNLT----------DAQKIAILTSQS-PLQRKLKNRHLQMIAIGGA 101

Query: 68  XXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRYC 126
                            PA ILI +  +  ++  +   LGEMA   P+ G +T+YATR+ 
Sbjct: 102 IGTGLFIGSSKALRTAGPAGILIGWGLMATMILCMCLSLGEMAVTFPVSGGYTTYATRFI 161

Query: 127 DPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVG 186
           D + GFA    Y+ +  ++ P ++ A ++ + YW  +       ++ +F + IV IN  G
Sbjct: 162 DESYGFANNINYMMQALVVLPLEIVAASITVDYWGPKSQYR-AAFVALFWLCIVSINMFG 220

Query: 187 VRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITG 246
           V+ +GE EF  S  K++ + G I+   I++ GGGP H+ +G ++W NPGAF      +  
Sbjct: 221 VKGYGEAEFVFSLIKVVTVIGFIILGVILVCGGGPTHEYIGSKFWSNPGAF------VGD 274

Query: 247 SKG-KFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIF 305
           + G KF    +VFV A F++   EL G+ AAE E+PR+++P+A K   +RI LFYI+++ 
Sbjct: 275 TAGQKFKGICSVFVTAAFSFANTELVGLAAAETEDPRKSVPKAAKQVFWRITLFYILSLL 334

Query: 306 LLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDL 365
           ++G+ V Y DPRLL            PFV+A++N G++ LP + NV +L  V S  NS +
Sbjct: 335 MVGLLVPYTDPRLLGSSIVDAAAS--PFVLALKNHGIKGLPSVINVVILTAVLSVGNSSV 392

Query: 366 YVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVN 425
           +  +R L +L+  G  P +F   +R G P  +           ++ VS    +IF++ ++
Sbjct: 393 FSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIFSSAFGLLCFLAVSHQVQEIFDWMLS 452

Query: 426 VVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKN 485
           +  +  +  W++I + +I F +A  AQN   +  A+ +P   +G+Y ++F  +++  ++ 
Sbjct: 453 LSGLSSLFIWLTISLCHIRFRKALSAQNRSIDELAFASPIGIWGSYYSVFLIIVVLILQF 512

Query: 486 F-TVFIGEF--DYKSFITGYIGLPLYVIFYFGYKIIYKT--KLVKAEEADLYSFKEAID 539
           +  +F G       +F   Y+ +P+ V  Y G+KI  K    L+  +  D+ + +  +D
Sbjct: 513 WIALFPGHQKPSASNFFKAYLSMPIAVAMYLGHKIYTKNWKLLIDPKYMDIDTGRRELD 571

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  269 bits (688), Expect = 7e-82,   Method: Compositional matrix adjust.
 Identities = 173/567 (30%), Positives = 282/567 (49%), Gaps = 27/567 (4%)

Query: 13  IREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXX 72
           ++    D ++N  S +      D  N + D   D  +L K+L  RH+  +A+        
Sbjct: 54  LKSSSFDSKENIKSDVP--HVSDFENNVYDTANDS-KLNKDLSVRHLLTLAVGGAIGTGL 110

Query: 73  XXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALG 131
                       PAS+++A+  V   +F ++  LGE+A   P+  GF  Y TR+ +P+ G
Sbjct: 111 FVNSGASLNTGGPASLIVAWVIVSTCLFTIVNALGELAAVFPVVGGFNVYITRFVEPSFG 170

Query: 132 FAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFG 191
           FAV   YL ++ ++ P +L A ++ I+YW    T+N   W+ IF   I + N + V+ FG
Sbjct: 171 FAVNINYLAQWAVLLPLELVAASITIRYW--NNTINSDAWVAIFYTAIFLANMLDVKSFG 228

Query: 192 EFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKG-K 250
           E EF LS  KI+ + G  +   ++  GGGP+ + +G RYW +PGAF      +  + G +
Sbjct: 229 ETEFVLSMIKILAIIGFTILGIVLACGGGPSGEYIGGRYWNDPGAF------VGDTPGRR 282

Query: 251 FVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMC 310
           F    AVFV A F+Y G EL  + AAE+ NPR  +P+A K T + I L YI  + ++G  
Sbjct: 283 FKGVCAVFVTAAFSYSGTELVAVSAAESHNPRVTLPKASKRTFWLITLCYITVLTIIGCL 342

Query: 311 VAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTR 370
           V YND RLL            P V+AI+N G++ LP + N  +LI + S  NS +Y  +R
Sbjct: 343 VPYNDERLL-NGNSSVDAAASPLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSR 401

Query: 371 SLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIF 430
            + ++A  G  PK     ++ G P  A          +++  S    ++F +   +  + 
Sbjct: 402 CMVAMAEIGNLPKRLNYIDKRGRPLYAIFATLIFGLLSFIAASDKQEEVFTWLSALSGLS 461

Query: 431 GILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAY--ITLFFCVLIA--FIKNF 486
            +  W SI +++I F +A  AQ+   N   + +    YG++    + F VLIA  +   F
Sbjct: 462 TLFCWFSINLSHIRFRQAMKAQDRSLNELPFVSITGVYGSWYGCIVIFLVLIASFWTSLF 521

Query: 487 TVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKT-KL-VKAEEADLYSFKEAIDRXXXX 544
            V     D +SF  GY+ LP++++ Y G+K+  K  +L VK ++ DL + +  ID     
Sbjct: 522 PVGSDGADAESFFEGYLSLPIFIVCYLGHKVYKKDWRLYVKTKDMDLDTGRREID----- 576

Query: 545 XXXXXXXXXXRLKNSKKSLKWFYEKYL 571
                     RL+  + + K FY ++L
Sbjct: 577 --LDILKQEIRLEREQMAQKPFYIRFL 601

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  265 bits (678), Expect = 8e-81,   Method: Compositional matrix adjust.
 Identities = 163/504 (32%), Positives = 264/504 (52%), Gaps = 18/504 (3%)

Query: 46  DGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMAC 105
           +   L K L  RH+  +A+                    PAS+++ +  +   +F V+  
Sbjct: 39  NNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVINS 98

Query: 106 LGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRE 164
           LGE+A   P+  GF  Y TR+ DP++GFAV   YL ++ ++ P +L A +L I+YW D+ 
Sbjct: 99  LGELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDK- 157

Query: 165 TVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHD 224
            +N   W+ IF V IV+ N + V+ FGE EF LS  KI+ + G  +   ++  GGGP+  
Sbjct: 158 -INSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGG 216

Query: 225 RLGFRYWKNPGAFKPYSESITGSKG-KFVSFVAVFVYALFAYLGIELTGIVAAEAENPRR 283
            LGF+YW NPGAF      + G+   KF    +VFV A F++ GIE+  + AAE++NPR+
Sbjct: 217 YLGFKYWNNPGAF------VGGTNASKFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRK 270

Query: 284 NIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVR 343
            IP+A K T + +   Y+V + L+G  V YND RLL            P V+AI+N G++
Sbjct: 271 VIPKAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAAS-PLVIAIENGGIK 329

Query: 344 ALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXX 403
            LP + N  +LI + S  NS +Y  +R + S+A  G  PK+ +K ++ G P NA      
Sbjct: 330 GLPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLI 389

Query: 404 XXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRA 463
               +++  S    ++F +   +  +  I  W++I  + I F RA   QN   +   Y +
Sbjct: 390 FGLLSFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLS 449

Query: 464 PFQPYGAY--ITLFFCVLIA--FIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIY 519
               +GA+  + + F V++A  +   F +     D +SF   ++ LP+ ++ YFG+K+ +
Sbjct: 450 QTGIWGAWYGVLVLFLVIVASFWTSMFPLGSAHADAESFFESFLSLPILLVCYFGHKLYF 509

Query: 520 KTKL---VKAEEADLYSFKEAIDR 540
                  + AEE D+ S ++ ID 
Sbjct: 510 ARNWRLQIGAEEMDIDSGRKIIDE 533

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  265 bits (678), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 167/528 (31%), Positives = 264/528 (50%), Gaps = 35/528 (6%)

Query: 28  LNSFEQEDDSNKISDGKEDGV--RLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXP 85
           ++SF+++ D + +   +E G   ++KK +K+RH+ MI++                    P
Sbjct: 40  VDSFKKKQDDDVVGYDEETGTSSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGP 99

Query: 86  ASILIAYSFVGILVFFVMACLGEMA-TYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYF 143
             ++I Y     +++ ++   GE+   Y  + G +T+Y++   DPALGF+V + Y  ++ 
Sbjct: 100 GGLIIGYGVASAMLYCIIQAAGELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWM 159

Query: 144 IITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIM 203
            + P QL   A+ I+YW D    NP +++ I   +IV IN  G + + E EF  ++ K++
Sbjct: 160 TVFPLQLVTAAITIKYWTD---TNPDIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVL 216

Query: 204 VMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALF 263
           +M G ++   II  GG  N   +G RYW  PGAF       TG KG       VF YA F
Sbjct: 217 MMVGFVILGIIINCGGAGNDGYIGARYWHTPGAFS------TGFKG----VCYVFCYAAF 266

Query: 264 AYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXX 323
           AY GIE+  + A+E ENPR++IP A K  +YRI+L Y++T  ++   V Y+ P L     
Sbjct: 267 AYGGIEVMVLTASEQENPRKSIPSACKKVIYRILLIYMLTTLIVCFLVPYDAPEL---TS 323

Query: 324 XXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPK 383
                   PFV+AI + G+  +PHI N  +L+ V S  NS LY   R L SL+  G APK
Sbjct: 324 TGSASRASPFVIAIASHGISVVPHIINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPK 383

Query: 384 LFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYI 443
           +F   +R G P             A++  S     +F++ + +  +  +  WISI ++++
Sbjct: 384 VFNYVDRQGRPLLCFLVAMFVGLLAFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHV 443

Query: 444 FFYRACIAQNVDRNSFAYRAPFQPYGAY----ITLF-----FCVLIAFIKNFTVFIGEFD 494
            F  A  AQ        Y++    +G++    ++LF     F V IA I N     G+  
Sbjct: 444 RFRDAMKAQGRSLGEVGYKSQTGYWGSWFAIIVSLFVLVAQFWVAIAPIGNG----GKLS 499

Query: 495 YKSFITGYIGLPLYVIFYFGYKIIYKT--KLVKAEEADLYSFKEAIDR 540
            K F   Y+  P+ +  YFGYKI YK     + A E DL S ++  D 
Sbjct: 500 AKDFFQSYLAAPVLIFIYFGYKIYYKDWRLCIPATEVDLNSHRKIFDE 547

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  266 bits (679), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 164/516 (31%), Positives = 261/516 (50%), Gaps = 19/516 (3%)

Query: 32  EQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIA 91
           +++ D  ++S    D   LKK +K+RH+ M+ +                    P +++I 
Sbjct: 49  DEKSDLEEMSMESTD-RHLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVIG 107

Query: 92  YSFVGILVFFVMACLGEMA-TYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQ 149
           Y  V  + +F++   GEMA TY  L G F +Y + +    +GFA  + +L ++  + P +
Sbjct: 108 YILVSFVTYFMIQAAGEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPLE 167

Query: 150 LTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVI 209
           L  G + IQYW D  ++N  VWI IF V ++ ++  GV+ +GE EF  ++ KI+ + G I
Sbjct: 168 LITGTMTIQYWND--SINADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGGFI 225

Query: 210 LFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIE 269
           +F  ++  GG      +G +YWKNPG+F   +     S G+F     V V A F+Y G E
Sbjct: 226 IFSIVVNAGGAGTDGYIGAKYWKNPGSFASST-----SAGRFKDVCYVLVTAYFSYGGTE 280

Query: 270 LTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXX 329
           L  +   E  NPRR+ P+A K ++YRI++ Y++T+ L+G  V +++ +L+          
Sbjct: 281 LYVLSVNEQANPRRSTPKAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGSSTHAS 340

Query: 330 XXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTN 389
             P+V+A    GV+ +PHI N  +LI V S  NS LY   R   SLA  G APK  A  +
Sbjct: 341 --PYVLAASIHGVKVVPHIINAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYID 398

Query: 390 RWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRAC 449
           R G P  A          A+   SS   Q+F +   + ++  + +W +IL+++I F  A 
Sbjct: 399 REGRPIIALAACAVVGVIAFAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAM 458

Query: 450 IAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI----GEFDYKSFITGYIGL 505
             Q  D N   Y+A    +G+     FCVL+ FI  F V +    G    + F   Y+  
Sbjct: 459 KVQGKDLNELGYKALTGVWGSMWGFGFCVLV-FIAQFWVALSPPGGTISAEGFFESYLAF 517

Query: 506 PLYVIFYFGYKIIYK--TKLVKAEEADLYSFKEAID 539
           PL++ FYF Y +  +  T L K E+ DL + +   D
Sbjct: 518 PLWLFFYFAYMLWKRDFTFLTKLEDIDLDAHRRIYD 553

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  266 bits (681), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 169/546 (30%), Positives = 278/546 (50%), Gaps = 23/546 (4%)

Query: 7   TKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVR-----LKKELKARHISM 61
           + D+ +     +        S    E+E+    +++ +   +      LK  LK RH+ M
Sbjct: 47  SNDATIDHSKSVSRWTRIKDSFKRAEKEEVDPNLTEAERIAINTAKAPLKHTLKGRHMQM 106

Query: 62  IAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FTS 120
           +AI                    PA I+I +     +++ ++  LGE+A   P+ G FT+
Sbjct: 107 VAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMALGELAVVFPVSGGFTT 166

Query: 121 YATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIV 180
           YATR+ D + GFA  + Y  ++    P ++ + ++ + YW   E    G ++ +F +VIV
Sbjct: 167 YATRFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPERYRDG-FVALFWLVIV 225

Query: 181 IINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPY 240
           IIN  GVR FGE EF  S+ K++ + G I+   +++ GGGP    +G RYW NPGAF   
Sbjct: 226 IINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFVGGRYWHNPGAF--- 282

Query: 241 SESITGSKG-KFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILF 299
              +  + G +F    +VFV A F++ G EL GI AAEA NPR+++PRA K  ++RI+LF
Sbjct: 283 ---VGDNAGTQFKGVCSVFVTAAFSFAGSELVGITAAEAANPRKSVPRAAKQVVWRIVLF 339

Query: 300 YIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFS 359
           Y+ ++ ++G+ V Y DPRL+            PFV+AI   G+R LP + NV +LI V S
Sbjct: 340 YMGSLIMIGLLVPYTDPRLI--GASSVDASASPFVIAIVTHGIRGLPSVINVVILIAVLS 397

Query: 360 ACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQI 419
             NS ++ G+R++ +L+  G  P++F   +R G P             A++  S    ++
Sbjct: 398 VGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGLIAFIAASKKQGEV 457

Query: 420 FNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVL 479
           F + + +  +  + +W  I + +I F  A  AQ    N   + +P    G+   LF  +L
Sbjct: 458 FAWLMALSGLSSLFTWGGICLCHIRFRMALKAQGRSTNELPFVSPAGIIGSSWGLFMLLL 517

Query: 480 IAFIKNFTVFI----GEFDYKSFITGYIGLPLYVIFYFGYKIIYKT-KL-VKAEEADLYS 533
           + FI  F V +     +   + F   Y+  P+ + FYFG+KI  K  KL +KAE+ D+ +
Sbjct: 518 M-FIAQFYVALFPPGSKPSAEVFFESYLSFPIVLAFYFGHKIYKKNWKLFIKAEDMDIDT 576

Query: 534 FKEAID 539
            +   D
Sbjct: 577 GRRETD 582

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  266 bits (679), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 165/536 (30%), Positives = 272/536 (50%), Gaps = 33/536 (6%)

Query: 14  REDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXX 73
           R + ++L+ N T      E E  + K +        LK  LK RH+ MIAI         
Sbjct: 54  RAEEMELDPNLT------EAERIAIKTAQSP-----LKHHLKNRHLQMIAIGGAIGTGLF 102

Query: 74  XXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGF 132
                      PA ILI +   G +++ ++  +GE+A   P+  GFT+YATR+ D + GF
Sbjct: 103 VGSGTALRTAGPAGILIGWGLTGTMIYSMVMAVGELAVVFPVAGGFTTYATRFVDESFGF 162

Query: 133 AVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGE 192
           A  + Y+ ++ ++ P ++ A ++ + YW        G ++ +F VVIVIIN  GV+ +GE
Sbjct: 163 AANFIYMLQWLVVLPLEIVAASITVNYWGTDPKYRDG-FVALFYVVIVIINMFGVKGYGE 221

Query: 193 FEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGK-F 251
            EF  S  K++ + G I+   +++ GGG +H  +G +YW NPGAF      +  + G+ F
Sbjct: 222 AEFIFSFIKVITVIGFIIMAIVLICGGGKDHKYIGAQYWYNPGAF------VGDTAGQQF 275

Query: 252 VSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCV 311
             F  VFV A F++ G EL G+  +EAE PR+++P A K   +RI LFYI+ + L+GM V
Sbjct: 276 QGFCTVFVTAAFSFAGSELVGLAGSEAEEPRKSVPGAAKQVFWRITLFYILCLLLIGMLV 335

Query: 312 AYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRS 371
             + PRL+            PFV+AI N G++ LP + NV +LI V S  NS +Y  +R+
Sbjct: 336 PSDSPRLIGASSVDAAAS--PFVIAIVNHGIKGLPSVVNVVILIAVLSVGNSAIYSCSRT 393

Query: 372 LYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFG 431
           L +LA  G  P +    +R G P             A++  S     +FN+ + +  +  
Sbjct: 394 LAALADQGFLPSICGYIDRGGRPLVGIAISAFFGLIAFVAQSKKEGDVFNWLMALSGLSS 453

Query: 432 ILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIG 491
           + +W  I + +I +  A  AQ    +   ++AP   +G+Y   F C+L+ FI  F  ++G
Sbjct: 454 LFTWAGICLCHIRYRGALAAQGRSTDELPFQAPAGVWGSYWGFFMCILM-FIAQF--YVG 510

Query: 492 EF------DYKSFITGYIGLPLYVIFYFGYKIIYKT-KL-VKAEEADLYSFKEAID 539
            F      +   F   Y+   +++  Y  +KI  +  KL +  ++ D+ + +  +D
Sbjct: 511 LFPPGTKPNAYDFFLAYLSFCIFIALYAFHKIWKRNWKLFIPLKDLDIDTGRREVD 566

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  266 bits (679), Expect = 2e-80,   Method: Compositional matrix adjust.
 Identities = 160/525 (30%), Positives = 272/525 (51%), Gaps = 15/525 (2%)

Query: 22  KNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXX 81
           K TT+ + S E+  D++ +     +   L K+L  RH+  +A+                 
Sbjct: 58  KQTTNDITSSERSRDNDDVEQVDINNTNLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALS 117

Query: 82  XXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLF 140
              PAS++I +  +G  +F V+  LGE++   P+  GF  Y  R+ +P+  FAV   YL 
Sbjct: 118 TGGPASLVIDWVIIGTCLFTVINSLGELSAAFPVVGGFNVYGMRFVEPSFAFAVNLNYLA 177

Query: 141 KYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSF 200
           ++ ++ P +L A ++ I+YW D+  +N   W+ IF   I + N + V+ FGE EF LS  
Sbjct: 178 QWLVLLPLELVAASITIKYWNDK--INSDAWVAIFYATIALANMLDVKSFGETEFVLSMI 235

Query: 201 KIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVY 260
           KI+ + G  +   ++  GGGP+   +G +YW+NPGAF  ++     S  KF    +VFV 
Sbjct: 236 KILSIIGFSILGIVLSCGGGPHGGYIGGKYWRNPGAFVGHN-----SGTKFKGLCSVFVT 290

Query: 261 ALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLX 320
           A F+Y GIE+T + AAE++NPR  IP+A K T + I   Y+  + L+G  V  NDPRLL 
Sbjct: 291 AAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLL- 349

Query: 321 XXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGK 380
                      P V+AI+N  ++ LP + N  +LI V S  NS +Y  +R + ++A  G 
Sbjct: 350 NGSSSVDAASSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGN 409

Query: 381 APKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILI 440
            PK   + ++ G P NA          +++  S+  A++F +   +  +  I  W++I +
Sbjct: 410 LPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINL 469

Query: 441 TYIFFYRACIAQNVDRNSFAYRAPFQPYGAY---ITLFFCVLIAFIKN-FTVFIGEFDYK 496
           ++I F +A   Q    +   + +     G++   + LF  ++ +F  + F +       +
Sbjct: 470 SHIRFRKAMKVQERSLDELPFISQTGVLGSWYGFVVLFLVLIASFWTSLFPIGSSGASAE 529

Query: 497 SFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADLYSFKEAID 539
           SF  GY+  P+ ++ YFG+KI  +  T +VK E+ DL + ++ +D
Sbjct: 530 SFFEGYLSFPILIVCYFGHKIYTRNWTLMVKIEDIDLDTGRKQVD 574

>KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly
           similar to uniprot|P53388 Saccharomyces cerevisiae
           YPL265W Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-
           glutamate and L-aspartate
          Length = 541

 Score =  262 bits (670), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 175/538 (32%), Positives = 278/538 (51%), Gaps = 22/538 (4%)

Query: 14  REDIIDLEKNTTSSLNSFEQ-EDDSNKISDGKE--------DGVRLKKELKARHISMIAI 64
           +E++   E   T ++   E  E DS +  +  E        D  RLK+ LK RHI M+ +
Sbjct: 5   KEELPSGELKKTEAVQVCETYEADSVEPQNANEPEEGVLYNDRTRLKQGLKERHIKMLTL 64

Query: 65  XXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFT-SYAT 123
                               PA + +AY  VGI+V      + E+A+++P  G T  +A 
Sbjct: 65  VGVFGTGLFLSSGGTLKKAGPAGMFLAYVVVGIVVGCNQIAIAEVASFMPATGATIRHAE 124

Query: 124 RYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIIN 183
           ++ D ++GF  G+  +  Y  + P +L+A A+V++YW D   +NP VWITIF ++ V+ N
Sbjct: 125 QFIDESVGFTFGW--ISTYSSLMPGELSATAVVMRYWTD---INPAVWITIFGILFVLTN 179

Query: 184 TVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSES 243
              +R++GE E++    KI+++  +I+   +I LGG    +RLGF YW+ PG F  Y   
Sbjct: 180 IYTIRFYGEVEYFFGWMKIILIIILIVTGLVIDLGGA-KQERLGFHYWREPGPFAEYI-- 236

Query: 244 ITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVT 303
           + G  GKFV F A     +++Y GI+   I+A E +N R  I    +    RII+ Y++ 
Sbjct: 237 VKGEIGKFVGFWAALSSVVYSYSGIQNIAILAGETKNSRHAIFHGARNVFLRIIVLYLIA 296

Query: 304 IFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNS 363
           + +L + V YND  +             P+V+AIQ + ++ LPHI N  +L   +SA N 
Sbjct: 297 VLVLTLIVPYNDKLI---ATGTGTAKSSPYVIAIQRANIKILPHIINAIILTSAWSAGNL 353

Query: 364 DLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYF 423
            +  G+R+L++LA   +APK+F  TN+ G+PY            +YM+VSS SA +F++F
Sbjct: 354 AIVEGSRNLFALASKNQAPKIFLTTNKRGIPYVGIAFISAFLPLSYMSVSSSSANVFSWF 413

Query: 424 VNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFI 483
             +VS   +L WI I   +I   RA  AQ   R+   +     P+ A+ +    ++    
Sbjct: 414 QELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPHSTCLGPFAAWFSGIMSLIFLLT 473

Query: 484 KNFTVFI-GEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAIDR 540
             F  FI G FD +SF T Y  +PL +I +  +K+  KTK ++  E DL S  E I +
Sbjct: 474 GGFYNFIHGHFDIESFFTRYFIIPLAIILFTFWKLFKKTKYLRPAEVDLESIFEDIRQ 531

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  264 bits (674), Expect = 1e-79,   Method: Compositional matrix adjust.
 Identities = 166/551 (30%), Positives = 264/551 (47%), Gaps = 40/551 (7%)

Query: 2   SVYEVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISM 61
           S   + KD K    ++ DLE      L   E+ +  NK          LK+ +K RH+ +
Sbjct: 73  SSENLDKDGK----EVADLEVQENQVLT--EKSNQKNK---------ELKQTIKPRHVIL 117

Query: 62  IAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMA-TYIPLDG-FT 119
           I++                    PA +LI YS +G  ++ ++   GE+A +Y  L G F 
Sbjct: 118 ISLGTGIGTGLLVGNAKALHNAGPAGLLIGYSIMGTCLYCIIQAAGELAVSYSSLSGGFN 177

Query: 120 SYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVI 179
            Y +   DPA GF+V + Y  ++  + P +L   ++ I+YW    TVN  +++ IF V+I
Sbjct: 178 VYPSFLVDPAFGFSVAWVYCIQWLCVCPLELVTASMTIKYWT--TTVNADIFVGIFYVLI 235

Query: 180 VIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAF-- 237
           ++INT G R + E EF+ +  KI++M G  +   +I  GG  N   +G RYW  PGAF  
Sbjct: 236 IVINTFGARGYAEAEFFFNCCKILMMIGFFILGIVINTGGAGNDGYIGDRYWHTPGAFAG 295

Query: 238 -KPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRI 296
            +P           F   +A  V A FA+   E   + AAE  NPR+ IP A K  +YRI
Sbjct: 296 DRPIDH--------FKGIMATMVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRI 347

Query: 297 ILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIF 356
           +  ++ +I L+G  V Y+  +L+            P+V+A+   GV+ +PH  N  +L+ 
Sbjct: 348 LFIFLGSITLVGFLVPYDSDQLMGSGGSATKAS--PYVLAVSTHGVKVVPHFINAVILLS 405

Query: 357 VFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGS 416
           V S  NS  Y  +R LYSLA  G APK F   +R G P+ A          ++   S   
Sbjct: 406 VLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPFRAMVCAGVFAIISFCAASPKE 465

Query: 417 AQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFF 476
            Q+F + + +  +  + +W +I +++I F +A   Q        ++A    +G+Y   F 
Sbjct: 466 EQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRSLGEIGFKAQTGVWGSYYVCFM 525

Query: 477 CVLIAFIKNFTVFI-----GEFDYKSFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEA 529
            V+I  I  F V I     G+ D + F   Y+ +P+ ++FY GYKI  K  +  ++A   
Sbjct: 526 LVMI-LIAQFWVAIAPIGEGKLDAQGFFENYLAMPILILFYVGYKIWKKDWSLFIRANNI 584

Query: 530 DLYSFKEAIDR 540
           DL   ++  D 
Sbjct: 585 DLDKHRQIFDE 595

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  263 bits (671), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 166/538 (30%), Positives = 273/538 (50%), Gaps = 27/538 (5%)

Query: 9   DSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXX 68
           DSK+  E I    + TT   +    EDD N         V L K L  RH+  +A+    
Sbjct: 46  DSKVPHEKI----QTTTDFASVISHEDDINN--------VNLNKNLSIRHLLTLAVGGSI 93

Query: 69  XXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCD 127
                           PAS++I +  +   +F V+  LGEMA   P+  GF  Y TR+ D
Sbjct: 94  GVGLFVNSGAALASGGPASLVIDWIIISTCLFTVINALGEMAAAFPVVGGFNVYITRFID 153

Query: 128 PALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGV 187
           P++GFAV   YL ++ ++ P +L A ++ I+YW   ET+N   W+ IF  VI + N + V
Sbjct: 154 PSVGFAVNINYLAQWLVLLPLELVAASMTIKYW--NETINSDAWVAIFYCVIALANMLEV 211

Query: 188 RYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGS 247
           + FGE EF LS  KI+ + G  +   ++  GGGP+   +G +YW +PG+F  ++     S
Sbjct: 212 KSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGGFIGGKYWNHPGSFVGHN-----S 266

Query: 248 KGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLL 307
             KF    +VFV A F+Y GIE+T + AAE+++PR  IP+A K T + I   Y+  + L+
Sbjct: 267 GTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTIPKAAKRTFWLITASYVTILTLI 326

Query: 308 GMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYV 367
           G  V Y+DPRLL            P V+AI+N G++ LP + N  +LI + S  NS +Y 
Sbjct: 327 GCLVPYDDPRLLSGTSSVDAASS-PLVIAIENDGIKGLPSLMNAIILISIISVANSAVYA 385

Query: 368 GTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVV 427
            +R + ++A  G  P++  + +  G P NA          +++  S   A +F +   + 
Sbjct: 386 CSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGLLSFVAASDRQADVFTWLSALS 445

Query: 428 SIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAY---ITLFFCVLIAFIK 484
            +  I  W++I +++I F ++   QN   +   + +    +G++   I LF  ++ +F  
Sbjct: 446 GLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQTGVWGSWYGTIVLFLVLVASFWT 505

Query: 485 NFTVFIG-EFDYKSFITGYIGLPLYVIFYFGYKIIYKTK--LVKAEEADLYSFKEAID 539
           +     G   D +SF  GY+  P+ +  YFG+K+  + +  +V   + DL + +  +D
Sbjct: 506 SLFPLGGTSADAESFFEGYLSFPILLACYFGHKLYVRKREFMVGLADMDLDTGRRQVD 563

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  260 bits (664), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 164/501 (32%), Positives = 257/501 (51%), Gaps = 20/501 (3%)

Query: 5   EVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGK----EDGVRLKKELKARHIS 60
           E  + S L +E +    K+     N  EQE +    +  +     D  RLK+ LK RHI 
Sbjct: 3   ESGEASGLSQEKV----KSKICETNVDEQELECGSETAKQGVLYNDRTRLKQGLKERHIK 58

Query: 61  MIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDGFT- 119
           M+ +                    P  +LIAY FVGI+V      + E+A+++P  G T 
Sbjct: 59  MLTLVGVFGTGLFLSSGGTLKKIGPVGLLIAYLFVGIVVGCNQIAIAEVASFMPATGATI 118

Query: 120 SYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVI 179
            +A ++ D ++GF  G+  +  Y  + P +L+A A++++YW D   V+P V+IT+F V+ 
Sbjct: 119 RHAEQFIDESVGFTFGW--ISTYSSLMPGELSATAVIMKYWTD---VSPAVFITVFGVLF 173

Query: 180 VIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKP 239
           V  N   +R++GE E+     K++++F +I+   +I LGG    +RLGF YW++PG F  
Sbjct: 174 VATNIYTIRFYGEIEYVFGWLKLVLIFILIISGLVIDLGGVKGQERLGFHYWRDPGPFAN 233

Query: 240 YSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILF 299
           Y   + G  GKFV F A     +++Y GI+   I+A E +N R  I    K    RII+ 
Sbjct: 234 YL--VAGHIGKFVGFWAAISSVVYSYSGIQNIAILAGETKNSRYAIFHGAKNVFLRIIVL 291

Query: 300 YIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFS 359
           Y+VT+F+L + V YND  +             PFV+A+  +G++ LPHI N  +L   +S
Sbjct: 292 YLVTVFVLTLIVPYNDKLI---ATGTGTAKSSPFVIAMNRAGIKVLPHIVNALILTSAWS 348

Query: 360 ACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQI 419
           A N  +  G+R+L+ LA   +AP++F KT++ G+PY            AYM+ S  SA +
Sbjct: 349 AGNLAIIEGSRNLFCLATKNQAPQIFLKTSKRGIPYVGVIFISSFLPLAYMSCSESSATV 408

Query: 420 FNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVL 479
           F +F  +VS   +L WI I   +I   RA  AQ   R+         P+ A+ +    V+
Sbjct: 409 FGWFQELVSSNTLLRWILISANHIHMDRALKAQGYSRSDLPCSTRIAPFAAWFSGIMSVI 468

Query: 480 IAFIKNFTVFI-GEFDYKSFI 499
             F   F  F+ G FD +SF+
Sbjct: 469 FLFTGGFYNFMHGHFDIESFL 489

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  263 bits (671), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 172/542 (31%), Positives = 280/542 (51%), Gaps = 32/542 (5%)

Query: 5   EVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAI 64
           E +KDS +  ED ID+   ++ +      ++D NK          L K+L  RH+  +A+
Sbjct: 50  EKSKDSPI--EDNIDITSQSSVT------KEDINK---------SLNKDLSIRHLLTLAV 92

Query: 65  XXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYAT 123
                               PAS++I +  +   +F V+  LGE+A   P+  GF  Y T
Sbjct: 93  GGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINSLGELAAAFPVVGGFNVYIT 152

Query: 124 RYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIIN 183
           R+ DP+  FAV   YL ++ ++ P +L A ++ I+YW    T+N   W+ IF  VI + N
Sbjct: 153 RFVDPSFAFAVNLNYLAQWLVLLPLELVAASITIKYW--NSTINSDAWVAIFYTVITLAN 210

Query: 184 TVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSES 243
            + V+ FGE EF LS  KI+ + G  +   ++  GGGP    LG +YW NPGAF  ++  
Sbjct: 211 MLDVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPKGGYLGGKYWHNPGAFVGHT-- 268

Query: 244 ITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVT 303
              S  KF    +VFV A F+Y GIE+T + AAE+++PR+ IP+A K T + I   Y+  
Sbjct: 269 ---SGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRKTIPKAAKRTFWLITASYVTI 325

Query: 304 IFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNS 363
           + L+G  V Y+DPRL+            P V+AI+N G++ L  + N  +LI + S  NS
Sbjct: 326 LTLVGCLVPYDDPRLMSGTSSVDAAAS-PLVIAIENGGIKGLDSLMNAIILISIISVANS 384

Query: 364 DLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYF 423
            +Y  +R + S+A  G  PK   K ++ G P NA          +++  S    ++F + 
Sbjct: 385 AVYACSRCMVSMAHIGNLPKKLGKVDKRGRPINATLVTLFFGLLSFIAASDKQNEVFTWL 444

Query: 424 VNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGA---YITLFFCVLI 480
             +  +  I  W++I I++I F +A I QN   +   Y +    +G+    + LF  ++ 
Sbjct: 445 SALSGLSTIFCWMAINISHIRFRQAMIKQNRSLDEMPYLSQTGVWGSLYGVVVLFLVLVA 504

Query: 481 AFIKNFTVFIGE-FDYKSFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADLYSFKEA 537
           +F  +     G+  D +SF  GY+ LP+ ++ Y G+K+ +K  + +V  EE DL + ++A
Sbjct: 505 SFWTSLFPLGGDSADVQSFFEGYLSLPILIVCYIGHKLYFKNWSWVVTLEEMDLDTGRKA 564

Query: 538 ID 539
           +D
Sbjct: 565 LD 566

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  262 bits (670), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 156/524 (29%), Positives = 267/524 (50%), Gaps = 21/524 (4%)

Query: 5   EVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKED---GVRLKKELKARHISM 61
           + +   KLI       ++   S+  + +  ++++ + DG E      +LKK +K+RH+ M
Sbjct: 43  QKSGSDKLIHRFADSFKRAEGSTTRTKQINENTSDLEDGVESITSDSKLKKSMKSRHVVM 102

Query: 62  IAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL--DGFT 119
           +++                    PA+++I Y  V  + +F++   GEMA   P     F 
Sbjct: 103 MSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFVTYFMIQAAGEMAVTYPTLPANFN 162

Query: 120 SYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVI 179
           +Y++ +   + GFA  + Y F++  + P +L   ++ IQ+W D+  +NP ++I IF V +
Sbjct: 163 AYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQFWNDK--INPDIYILIFYVFL 220

Query: 180 VIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKP 239
           V I+  GV+ +GE EF  +  KI+++ G I+   +I  GG  N   +G  YW NPGAF  
Sbjct: 221 VFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAGNDGYIGATYWHNPGAFAG 280

Query: 240 YSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILF 299
            +     S G+F +   + V A F++ G+EL  +   E  NPR++ P A K ++YRI++ 
Sbjct: 281 DT-----SIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVVI 335

Query: 300 YIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFS 359
           Y++T+ L+G  V YND +L+            P+V+A    GV+ +PHI N  +LI V S
Sbjct: 336 YLLTMILIGFNVPYNDDQLMGAGGSATHAS--PYVLAASIHGVKIVPHIINAVILISVVS 393

Query: 360 ACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQI 419
             NS LY G R + SLA  G APK     +R G P  A          A++  SS    +
Sbjct: 394 VANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVFGVIAFVAASSKEEIV 453

Query: 420 FNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVL 479
           F +   +  +  + +W SI+++++ F +A   Q    +   Y+A    +G+   +FF +L
Sbjct: 454 FTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSIYGVFFNIL 513

Query: 480 IAFIKNFTVFI------GEFDYKSFITGYIGLPLYVIFYFGYKI 517
           + F+  F V +      G+ D +SF   Y+  P+++ FYFGY +
Sbjct: 514 V-FVAQFWVALAPLGNGGKCDAESFFQNYLAFPIWLAFYFGYMV 556

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  261 bits (667), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 159/498 (31%), Positives = 264/498 (53%), Gaps = 18/498 (3%)

Query: 50  LKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEM 109
           LK +LK RH+ MIAI                    PAS+LI +  +G +++ ++  LGE+
Sbjct: 85  LKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMVMALGEL 144

Query: 110 ATYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNP 168
           A   P+ G FT+YATR+ D + GFA  + Y+ ++ +  P ++ + ++ + YW        
Sbjct: 145 AVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVSASITVNYWGTDPKYRD 204

Query: 169 GVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGF 228
           G ++ +F +VIV IN  GV+ +GE EF  S  K++ + G I+   I+  GGGP    +G 
Sbjct: 205 G-FVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEKGYIGG 263

Query: 229 RYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRA 288
           +Y+ +PGAF   +        KF    +VFV A F++ G EL G+ A+E+ +PR+++P+A
Sbjct: 264 KYFHDPGAFAGDTPG-----AKFKGVCSVFVTAAFSFAGSELVGLAASESVDPRKSVPKA 318

Query: 289 IKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHI 348
            K   +RI LFYI+++ ++G+ V YND RL+            PFV+AI   G++ LP +
Sbjct: 319 AKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVDAAAS--PFVIAIVTHGIKGLPSV 376

Query: 349 FNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXA 408
            NV +LI V S  NS ++  +R+  +LA  G  P++FA  +R G P             A
Sbjct: 377 VNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPLVGIIITSAVGLIA 436

Query: 409 YMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPY 468
           ++  S+    +FN+ + +  +  + +W  I I +I F +A  +Q    +  ++++P   +
Sbjct: 437 FVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRSVDELSFKSPTGVW 496

Query: 469 GAYITLFFCVLIAFIKNFTVFI----GEFDYKSFITGYIGLPLYVIFYFGYKIIYKTK-- 522
           G+Y  LF  ++I FI  F V +    G    + F   Y+  PL +  Y G+K IYK    
Sbjct: 497 GSYWGLFM-IVIMFIAQFYVALFPVNGSPSAEGFFEAYLSFPLVLAMYIGHK-IYKRNWK 554

Query: 523 -LVKAEEADLYSFKEAID 539
            L+ A E D+ S +  +D
Sbjct: 555 LLIPAGEMDIDSGRREVD 572

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  262 bits (670), Expect = 8e-79,   Method: Compositional matrix adjust.
 Identities = 173/551 (31%), Positives = 277/551 (50%), Gaps = 35/551 (6%)

Query: 2   SVYEVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISM 61
           S+   + D+ L +    D   ++ S  N   Q + S       ED   LKK +K RH+ M
Sbjct: 82  SISRTSMDAALNKTKFDDAISSSISETNKGHQNEKS-------ED---LKKTIKPRHVIM 131

Query: 62  IAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMAT-YIPLDG-FT 119
           I++                    PA+++I Y+ +G  ++ ++   GE+A  Y  L+G F 
Sbjct: 132 ISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTCLYCIIQAAGELAVVYSDLNGGFN 191

Query: 120 SYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVI 179
           +Y +   DPALGF+V + Y  ++  + P +L   ++ I+YW  +  V+P V++ IF V+I
Sbjct: 192 AYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTTK--VDPDVFVVIFYVLI 249

Query: 180 VIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKP 239
           + INT G R + E EF+ +  K+++M G  +   II  GG  N   LG +YW +PGAF  
Sbjct: 250 IAINTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITAGGAGNDGYLGAKYWHDPGAFNG 309

Query: 240 YSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILF 299
             +SI     +F   +  FV A FA+   E   + AAE  NPR+ IP A K  +YRI+  
Sbjct: 310 -DKSID----RFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRIVCI 364

Query: 300 YIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFS 359
           ++ +I L+G  V YN  +LL            P+V+A+ + GVR +PH  N  +L+ V S
Sbjct: 365 FLASITLIGFLVPYNSDQLLGSGGSGIKAS--PYVIAVSSHGVRVVPHFINAVILLSVLS 422

Query: 360 ACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQI 419
             NS  Y  +R L SLA  G APK F   +R G P+ A          A+   S    ++
Sbjct: 423 VGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAMLMSALFGVIAFCATSPKETEV 482

Query: 420 FNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYG---AYITLFF 476
           F++ + +  +  + +WI+I +++I F RA   Q        Y +    YG   A I LF 
Sbjct: 483 FSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEVGYLSQSGVYGSAYAAIMLF- 541

Query: 477 CVLIAFIKNFTVFI-----GEFDYKSFITGYIGLPLYVIFYFGYKIIYKT-KL-VKAEEA 529
              +A I  F V I     G+ D ++F   Y+ +P+ + FYFGY++  +  KL ++A++ 
Sbjct: 542 ---LALIAQFWVAIAPIGEGKLDAENFFQNYLAMPILIAFYFGYRVWKRDWKLFIRAKDI 598

Query: 530 DLYSFKEAIDR 540
           DL + ++  D 
Sbjct: 599 DLDTHRQIFDE 609

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  261 bits (666), Expect = 9e-79,   Method: Compositional matrix adjust.
 Identities = 163/497 (32%), Positives = 267/497 (53%), Gaps = 16/497 (3%)

Query: 50  LKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEM 109
           L++ LK RH+ MIAI                    PA +LI +  +G++++ V+  +GE+
Sbjct: 77  LQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVVMSMGEL 136

Query: 110 ATYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNP 168
           A   P+ G FT+YATR+ D + GFA+ Y Y+ ++ ++ P ++ A ++ + +W        
Sbjct: 137 AVTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGTPPKYRD 196

Query: 169 GVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGF 228
           G ++ +F +VIVIIN  GVR +GE EF  S  K++ + G I+   +++ GGGP    +G 
Sbjct: 197 G-FVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVGGYIGG 255

Query: 229 RYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRA 288
           +YW NPGAF   S    GS+  F    +VFV A F++ G EL G+ +AE  NPR+ +PRA
Sbjct: 256 KYWHNPGAF---SGDDAGSR--FKGVCSVFVTAAFSFAGTELVGLASAETANPRKALPRA 310

Query: 289 IKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHI 348
            K   +RI+LFYI+++ L+G+ V +   RL+            PFV+AIQ  G++ LP +
Sbjct: 311 AKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAAS--PFVLAIQTHGIKGLPSV 368

Query: 349 FNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXA 408
            NV +LI V S  NS +Y  +RS+ +LA  G  P +FA  +R G P  A          +
Sbjct: 369 INVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFGLLS 428

Query: 409 YMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPY 468
           ++  S     +FN+ + +  +  + SW +I I +I F RA  AQ    +  A+ +     
Sbjct: 429 FIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSYAGIA 488

Query: 469 GAYITLFFCVLIAFIKNFTVFI----GEFDYKSFITGYIGLPLYVIFYFGYKIIYKT-KL 523
           G+Y  +   VL+  I  F V +    G  + + F + Y+  P+ + FY  +KI  +  KL
Sbjct: 489 GSYFGVIL-VLLVLIAQFWVAVWPIGGSPNAEDFFSAYLSFPVLLAFYIFHKIWKRNWKL 547

Query: 524 -VKAEEADLYSFKEAID 539
             +A++ D+ + +  +D
Sbjct: 548 FTRAKDIDIDTGRREMD 564

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  261 bits (666), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 169/565 (29%), Positives = 288/565 (50%), Gaps = 42/565 (7%)

Query: 6   VTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVR---------------- 49
           +T DS+ + ++ I +  N +++ N  ++    +K  D K+   R                
Sbjct: 20  ITIDSEFLTQEPITIPSNGSATTN--DEAGSGSKWQDFKDSFRRVEPVEVDPNLTEAEKV 77

Query: 50  --------LKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFF 101
                   LK  LK RH+ MIAI                    PAS+LI +   G +++ 
Sbjct: 78  AFVTAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYS 137

Query: 102 VMACLGEMATYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYW 160
           ++  LGE+A   P+ G FT+YATR+ D + G+A  + Y+ ++ ++ P ++ + ++ + +W
Sbjct: 138 MVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFW 197

Query: 161 IDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGG 220
                   G ++ +F +VIVIIN  GV+ +GE EF  S  K++ + G I+   I+  GGG
Sbjct: 198 GTDPKYRDG-FVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGG 256

Query: 221 PNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAEN 280
           P    +G +YW +PGAF   +        KF    +VFV + F++ G EL G+ A+E+ +
Sbjct: 257 PEGGYIGGKYWHDPGAFAGDTPG-----AKFKGLCSVFVTSAFSFAGSELVGLAASESVD 311

Query: 281 PRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNS 340
           PR+++P+A K   +RI LFYI+++ ++G+ V YNDP L+            PFV+AI+  
Sbjct: 312 PRKSVPKAAKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAAS--PFVIAIKTH 369

Query: 341 GVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXX 400
           G++ LP + NV +LI V S  NS +Y  +R++ +LA     P++FA  +R G P      
Sbjct: 370 GIKGLPTVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIAV 429

Query: 401 XXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFA 460
                  A++  S     +FN+ + +  +  + +W  I I +I F +A  AQ  D +  +
Sbjct: 430 TSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELS 489

Query: 461 YRAPFQPYGAYITLFFCVLIAFIKNFTVFI----GEFDYKSFITGYIGLPLYVIFYFGYK 516
           +++P   +G+Y  LF  V+I FI  F V +         + F   Y+  PL V  Y G+K
Sbjct: 490 FKSPTGVWGSYWGLFM-VVIMFIAQFYVALFPVGASPSAEGFFEAYLSFPLVVAMYLGHK 548

Query: 517 IIYKT-KL-VKAEEADLYSFKEAID 539
           I  +  KL + AE+ D+ + +  +D
Sbjct: 549 IYKRNWKLFIPAEDMDIDTGRREVD 573

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  260 bits (665), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 172/530 (32%), Positives = 281/530 (53%), Gaps = 27/530 (5%)

Query: 26  SSLNSFEQEDDSNKISDGKEDGVR-----LKKELKARHISMIAIXXXXXXXXXXXXXXXX 80
            S    E E+    ++D ++  +      LK  LK+RH+ MIA+                
Sbjct: 58  DSFKRIELEELDPNLTDAEKIAIATARSPLKHTLKSRHLHMIAVGGAIGTGLFVGSGKAL 117

Query: 81  XXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRYCDPALGFAVGYCYL 139
               PA ILI ++  G +++ ++  +GE+A   P+ G FT+YATR+ D + GFA+ + Y+
Sbjct: 118 RTAGPAGILIGWTVTGTMIYSMVMAVGELAVVFPVSGGFTTYATRFIDESFGFAINFNYM 177

Query: 140 FKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSS 199
            ++ I  P ++ + ++ + YW        G ++ +F V  VIIN  GV+ +GE EF  + 
Sbjct: 178 LQWLITLPLEIVSASITVNYWGVDAKYRDG-FVALFWVFTVIINLFGVKGYGEAEFVFAI 236

Query: 200 FKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKG-KFVSFVAVF 258
            K++ + G I+   I++ GGGP    +G +YW +PGAF      +  + G KF  F  VF
Sbjct: 237 IKVVTIIGFIIMAVILICGGGPVGGYIGAKYWHHPGAF------VGDTAGQKFKGFCTVF 290

Query: 259 VYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRL 318
           + A F++ G E+ G+  +E+ENPR+++P A K   +RI LFY++ + L+GM V YND RL
Sbjct: 291 ITASFSFGGSEVVGVAGSESENPRKSVPGAAKQVFWRITLFYVLCLLLIGMLVPYNDKRL 350

Query: 319 LXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAID 378
           +            PFV+A+ N G+R LP + NV +LI V S  NS +Y+ +R+L +LA  
Sbjct: 351 IGASSVDAAAS--PFVIAVVNQGIRGLPSVINVVILISVLSVGNSSIYLCSRTLTALAEQ 408

Query: 379 GKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISI 438
           G  PK+ A  +R G P  A          A++  SS   ++FN+ + +  +  + SW +I
Sbjct: 409 GFLPKIVAYIDRNGRPLVAIGIASAFGLIAFVAESSHEGEVFNWLLALSGLSSLFSWSAI 468

Query: 439 LITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEF----- 493
            I +I F RA +AQ    +   + +     G+Y  +F CVL+  I  F  ++G F     
Sbjct: 469 CICHIRFRRALVAQGRSTDELPFVSTVGIAGSYWGIFICVLM-LIAQF--YVGLFPAGAS 525

Query: 494 -DYKSFITGYIGLPLYVIFYFGYKIIYKT-KL-VKAEEADLYSFKEAIDR 540
            + K F   Y+  P+ + FY  +KI  K  KL +KAE+ D+ + +  +DR
Sbjct: 526 PNAKDFFMAYLSFPIVLAFYIFHKIWKKNWKLYIKAEDMDIDTGRREVDR 575

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  260 bits (664), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 164/551 (29%), Positives = 269/551 (48%), Gaps = 41/551 (7%)

Query: 8   KDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXX 67
           +DS +I   +   ++     L   +Q+ D  + +D      +LKK +K+RH+ M+++   
Sbjct: 36  QDSTMIHRFVNSFKRAEQPPL---KQDSDLEEDTDTIVTDTQLKKTMKSRHVVMMSLGTG 92

Query: 68  XXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIP-LDG-FTSYATRY 125
                            PA ++IAY  V  + +F++   GEMA   P L G F +Y + +
Sbjct: 93  IGTGLLVANAQGLHKAGPAPLVIAYGMVSFVTYFMIQAAGEMAVVYPTLPGNFNAYISTF 152

Query: 126 CDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTV 185
                GFA  + +  ++  + P +L   A+ +QYW D  ++N  V++ IF V ++ I+  
Sbjct: 153 ISKPFGFATVWLFFIQWLTVLPLELITAAMTVQYWND--SINADVYVVIFYVFLLFIHFF 210

Query: 186 GVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESIT 245
           GV+ +GE EF  +  KI+ + G I+F  ++ +GG  N   +G +YW +PGAF   + +  
Sbjct: 211 GVKAYGETEFIFNLCKILFVGGFIIFSIVVNVGGAGNSGYIGAKYWHDPGAFTSDTNA-- 268

Query: 246 GSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIF 305
              G+F     V V A F+Y G+EL  +   E ENPRR+ P A K ++YRI++ Y++T+ 
Sbjct: 269 ---GRFKGVCYVLVTAYFSYGGMELFALSVNEQENPRRSTPTAAKQSIYRIVVIYLLTMI 325

Query: 306 LLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDL 365
           L+G  V  N   L+            P+V+A    GV+ +PHI N  +LI + S  NS L
Sbjct: 326 LVGFNVPSNSNELMGSGGSVTHAS--PYVLAASIHGVKVVPHIVNAVILISLISVGNSAL 383

Query: 366 YVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVN 425
           Y   R + +LA  G APK     +R G P  A           ++  SS   Q+FN+   
Sbjct: 384 YAAPRLMCALAQQGFAPKFMDYVDREGRPLFALIVCSVFGVIGFVACSSKEEQVFNWLAA 443

Query: 426 VVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKN 485
           +  +  + +W  I+I++I F +A   QN   +   Y++PF  YG+Y  +FF +L+ F+  
Sbjct: 444 IAGLAELFTWSGIMISHIRFRQAMKLQNKSLDEVGYKSPFGVYGSYFGVFFNLLV-FVAQ 502

Query: 486 FTVFIG-----EFDYKSFITGYIGLPLYVIFYFGYKI---------------------IY 519
           F V +      E    +F   Y+  P++  FYFGY I                     IY
Sbjct: 503 FWVALAPPMYTEMSADTFFESYLAFPIFFAFYFGYMIWKRDFTLFSDLESVDLDYHRRIY 562

Query: 520 KTKLVKAEEAD 530
             +LVK E+ +
Sbjct: 563 DPELVKQEDEE 573

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  261 bits (668), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 161/532 (30%), Positives = 260/532 (48%), Gaps = 23/532 (4%)

Query: 19  DLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXX 78
           D+E   T++L+      D       +E    L+K +K RH+ ++++              
Sbjct: 100 DIENELTTTLSPLSATKDPQFAPHAEEKDDHLQKTIKPRHVLLMSLGTGIGTGLLVGNGS 159

Query: 79  XXXXXXPASILIAYSFVGILVFFVMACLGEMA-TYIPLDG-FTSYATRYCDPALGFAVGY 136
                 P  ++I Y+ +G  ++ ++   GEMA  Y  L G F +Y +   D A GF+V +
Sbjct: 160 ALHKAGPGGLVIGYAIMGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAW 219

Query: 137 CYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFW 196
            Y  ++  + P +L   ++ IQYW    TVN  V++ IF V+I+ IN  G + + E EF+
Sbjct: 220 VYCLQWLCVMPLELVTASMTIQYWT--TTVNADVFVVIFYVLIIFINVFGAKGYAEAEFF 277

Query: 197 LSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKG--KFVSF 254
            +S K+++M G  +   +I  GG  N   +G +YW NPGAF+       G K   +F   
Sbjct: 278 FNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR-------GDKSIDRFKDV 330

Query: 255 VAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYN 314
           ++ F  A FA+   E   I A+E  NPRR IP A K  +YRI+  ++ +I L+G  V YN
Sbjct: 331 MSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYN 390

Query: 315 DPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYS 374
              L+            P+V+A+ + GVR +PH  N  +L+ V S  NS  Y   R LYS
Sbjct: 391 STELMGSGSAATKAS--PYVIAVASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYS 448

Query: 375 LAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILS 434
           L+  G AP  F   +R G P  A          A+   SS    +F + + +  +  + +
Sbjct: 449 LSQQGYAPSWFNYIDREGRPARAMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFT 508

Query: 435 WISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVF---IG 491
           WI+I +++I F RA   Q    +   +++    +G+        L A I  F V    IG
Sbjct: 509 WIAICVSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSSYAAIMMTL-ALIAEFWVSIAPIG 567

Query: 492 E--FDYKSFITGYIGLPLYVIFYFGYKIIYKT-KL-VKAEEADLYSFKEAID 539
           E   D ++F   Y+ +P+ ++ YFGYKI  +  KL ++A++ DL S ++  D
Sbjct: 568 EDHLDAQNFFENYLAMPILIVLYFGYKICKRDWKLFIRAKDIDLVSHRKIYD 619

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  260 bits (664), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 158/498 (31%), Positives = 258/498 (51%), Gaps = 17/498 (3%)

Query: 50  LKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEM 109
           L+  LK RH+ MIAI                    PA ILI +   G +++ ++  LGE+
Sbjct: 81  LQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMALGEL 140

Query: 110 ATYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNP 168
           A   P+ G FT+YATR+ D + GFA    Y+ ++ ++ P ++ A ++ + YW        
Sbjct: 141 AVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEIVAASITVNYWGTNPRYRD 200

Query: 169 GVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGF 228
           G ++ +F + I IIN  GV+ +GE EF  S  K++ + G I+   I+  GGGP    +G 
Sbjct: 201 G-FVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIILGIILNCGGGPVKGYIGG 259

Query: 229 RYWKNP-GAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPR 287
           RYW +P GAF   S     +  +F    +VFV A F++ G EL G+ +AE  NPR+++P+
Sbjct: 260 RYWHHPYGAFVGDS-----AGARFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSVPK 314

Query: 288 AIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPH 347
           A K   +RI LFY++ + ++G+ V Y + RL+            PFV+AI   G+R LP 
Sbjct: 315 AAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAAS--PFVIAITTHGIRGLPS 372

Query: 348 IFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXX 407
           + NV +LI V S  NS +Y  +R+L +LA     PK F   +R G P  +          
Sbjct: 373 VVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGRPLYSILVTSGFGLV 432

Query: 408 AYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQP 467
           A++  S    ++FN+ + +  +  + +W  I + +I F +A  AQ    +  ++ +P   
Sbjct: 433 AFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQGRGTDELSFVSPAGV 492

Query: 468 YGAYITLFFCVLIAFIKNFTVFI----GEFDYKSFITGYIGLPLYVIFYFGYKIIYKTK- 522
           YG+Y  LF  +L+ FI  F V +     + + K+F   Y+  P+ +  Y G+KI  K   
Sbjct: 493 YGSYWGLFMIILM-FIAQFYVALFPPGAKPNAKAFFEAYLSFPIVIACYLGHKIYKKNWK 551

Query: 523 -LVKAEEADLYSFKEAID 539
             +KAE+ D+ + ++  D
Sbjct: 552 IFIKAEDMDIDTGRKDDD 569

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  260 bits (664), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 174/545 (31%), Positives = 276/545 (50%), Gaps = 22/545 (4%)

Query: 8   KDSKLIREDIIDLEKNTTS-SLNSFEQEDDSNKIS--DGKED--GVRLKKELKARHISMI 62
           + S L  ++  D ++ TTS S + F  +   N  S  D KED     + ++L  RH+  +
Sbjct: 39  ESSFLSEKNRYDFKEETTSFSDDRFNSQHSYNPGSPDDIKEDIHTSNMNQDLNVRHLITL 98

Query: 63  AIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSY 121
           A+                    PAS++I ++ V   +F V+  LGE+A   P+  GF  Y
Sbjct: 99  AVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTALFTVINSLGELAAAYPVVGGFNVY 158

Query: 122 ATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVI 181
            TR+ DP+  F+V   YL ++ ++ P +L A +L I+YW D  T+N   W+ IF  +I+I
Sbjct: 159 MTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTIRYWDD--TINSDAWVAIFYTLILI 216

Query: 182 INTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYS 241
            N + V+ FGE EF LS  KI+ + G  +   ++  GGGP    +G +YW +PGAF    
Sbjct: 217 ANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCGGGPKGGYIGGKYWHDPGAF---- 272

Query: 242 ESITGSKG-KFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFY 300
             +  S G +F    +VFV A F+Y GIE+  + AAE++NPR+ IP A K T + I   Y
Sbjct: 273 --VGDSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAESQNPRKTIPTAAKRTFWIITFSY 330

Query: 301 IVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSA 360
           I  + L+G  VAYND RLL            P V+AI+N G++ LP + N  +LI + S 
Sbjct: 331 ITILTLVGCLVAYNDTRLLNGSSSVDVAAS-PLVIAIENGGIKGLPSLMNAIILIAILSV 389

Query: 361 CNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIF 420
            NS +Y  +R + S+A+ G  PK  +  ++ G P  A          +++  S    ++F
Sbjct: 390 ANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIFTTLFFGLLSFVAASDKQEEVF 449

Query: 421 NYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAY--ITLFFCV 478
            +   +  +  I  W+ I I +I F +A   QN   +   Y +    YG+Y    + F V
Sbjct: 450 TWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEMPYLSQTGIYGSYYGTAILFLV 509

Query: 479 LIA--FIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKT--KLVKAEEADLYSF 534
           LIA  +   F +     D ++F  GY+  P+ +  Y G+K+ +K    +   EE DL + 
Sbjct: 510 LIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGHKLYFKNWRIMTPLEEIDLLTG 569

Query: 535 KEAID 539
           ++ +D
Sbjct: 570 RKEVD 574

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  260 bits (665), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 163/523 (31%), Positives = 249/523 (47%), Gaps = 28/523 (5%)

Query: 28  LNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPAS 87
           LN      D+N       D   LK+ ++ RH+ MI++                    PA 
Sbjct: 115 LNQLRTPTDAN-------DNKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAG 167

Query: 88  ILIAYSFVGILVFFVMACLGEMA---TYIPLDGFTSYATRYCDPALGFAVGYCYLFKYFI 144
           ++I YS +G +++ ++   GEMA   + +P  G+  Y +   +   GFA+ + Y  ++  
Sbjct: 168 LVIGYSIMGSIIYCIIQATGEMAIAYSNLP-GGYNVYPSFLVEKGFGFAIAWVYCIQWLT 226

Query: 145 ITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMV 204
           + P +L   +L I+YW    +VN  +++ IF  +I+IIN  G + + E EF+ +  K+++
Sbjct: 227 VCPLELVTASLTIKYWT--TSVNSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLM 284

Query: 205 MFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFA 264
           M G  +    I  GG  N   LG  YW  PGAF+  S     S   F       V A FA
Sbjct: 285 MIGFFILSITITAGGAGNDGYLGGLYWHTPGAFRGDS-----SIDHFKGICGTLVTAAFA 339

Query: 265 YLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXX 324
           Y G E   + AAE  NPR  IP A K  +YRII  Y+++I ++G  V ++  RLL     
Sbjct: 340 YGGTEFLALTAAEQSNPRAAIPSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGS 399

Query: 325 XXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKL 384
                  P+V+A    GVR +PH  N  +LI V S  NS  Y  +R L SLA  G APK 
Sbjct: 400 ATSAS--PYVLAASLHGVRVVPHFINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKW 457

Query: 385 FAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIF 444
           F   +R G P  A          A+   S    ++F + + +  +  + +W +I +++I 
Sbjct: 458 FDYIDREGRPARAMLMSALFGVIAFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIR 517

Query: 445 FYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI-----GEFDYKSFI 499
           F  A   Q        Y A    +G++  LF   LI +I  F V I     GE   ++F 
Sbjct: 518 FRTAMKVQGRSLGEVGYLAQTGVWGSWYALFMMFLI-YIAQFWVAIAPIGSGELSAQNFF 576

Query: 500 TGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADLYSFKEAIDR 540
             Y+ +P+ ++ Y GYKI YK  T L+KAE+ DL S ++  D 
Sbjct: 577 ENYLAMPILIVLYLGYKIYYKDWTLLIKAEDIDLQSHRQIFDE 619

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  259 bits (663), Expect = 7e-78,   Method: Compositional matrix adjust.
 Identities = 164/538 (30%), Positives = 265/538 (49%), Gaps = 26/538 (4%)

Query: 16  DIIDLEKNTTSSLNSFEQEDDSNKISD--GKEDGVRLKKELKARHISMIAIXXXXXXXXX 73
           D+      ++ +    E+ D ++KI+   G + G  LKK ++ RH+ MIA+         
Sbjct: 81  DLTSAISPSSRNAQGLEKNDSTDKINPPAGNKSG-SLKKTIQPRHVLMIALGTGIGTGLL 139

Query: 74  XXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMA-TYIPL-DGFTSYATRYCDPALG 131
                      PA +LI Y+ +G +++ ++   GE+A  Y  L  G+ +Y +   D   G
Sbjct: 140 VGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGELALVYSNLTGGYNAYPSFLVDDGFG 199

Query: 132 FAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFG 191
           FAV + Y  ++  + P +L   ++ I+YW    +VNP V++ IF V+++ IN  G R + 
Sbjct: 200 FAVAWVYCLQWLCVCPLELVTASMTIKYWT--TSVNPDVFVIIFYVLVITINIFGARGYA 257

Query: 192 EFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKF 251
           E EF+ +  KI++M G  +   II +GG  N   +G +YW +PGAF         S  +F
Sbjct: 258 EAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGFIGGKYWHDPGAFNGKH-----SIDRF 312

Query: 252 VSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCV 311
              VA  V A FA+ G E   I  AE  NPR+ IP A K  +YRI+  ++ TI +LG  V
Sbjct: 313 KGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIIMLGFLV 372

Query: 312 AYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRS 371
            YN  +LL            P+V+AI + GVR +PH  N  +L+ V S  NS  Y   R 
Sbjct: 373 PYNSDQLLGSGGGGTKAS--PYVIAIASHGVRVVPHFVNAVILLSVLSMANSSFYSSARL 430

Query: 372 LYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFG 431
             +L+  G APK F+  +R G P  A          A+   S    Q+F + + +  +  
Sbjct: 431 FLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTWLLAISGLSQ 490

Query: 432 ILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCV--LIAFIKNFTVF 489
           + +W +I  ++I F RA   Q        +++     G + +++ C+  L+  I  F V 
Sbjct: 491 LFTWTAICFSHIRFRRAMKVQGRSLGELGFKS---QTGVWGSMYACIMMLLILIGQFWVA 547

Query: 490 I-----GEFDYKSFITGYIGLPLYVIFYFGYKIIYKT-KL-VKAEEADLYSFKEAIDR 540
           I     G+ D ++F   Y+ +P+ +  Y GYKI  K  KL ++A++ DL S ++  D 
Sbjct: 548 IAPIGEGKLDAQAFFENYLAMPILIALYVGYKIWTKDWKLFIRADKIDLESHRQIFDE 605

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  258 bits (658), Expect = 1e-77,   Method: Compositional matrix adjust.
 Identities = 155/522 (29%), Positives = 271/522 (51%), Gaps = 26/522 (4%)

Query: 31  FEQEDDSNK-ISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASIL 89
           +E  DD  K I +  +  + L ++L  RH+  +A+                    PAS++
Sbjct: 51  YEDMDDVEKAIFNTTKRSLNLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPASLV 110

Query: 90  IAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPN 148
           IA++ +   +F ++  LGE+A   P+  GF  Y TR  DP+LGFAV   YL ++ ++ P 
Sbjct: 111 IAWTIISTCLFTIVNALGELAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPL 170

Query: 149 QLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGV 208
           +L A ++ I+YW    +VN   W+ +F V I + + + V+ FGE EF LS  KI+ + G 
Sbjct: 171 ELVAASITIRYW--NNSVNSDAWVAVFYVCIFLASLLDVKSFGETEFILSMVKILAIGGF 228

Query: 209 ILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKG-KFVSFVAVFVYALFAYLG 267
            +   +++ GGGP +  +G +YW +PG+F      +  S G +F    +VFV A F+Y G
Sbjct: 229 TILGIVLICGGGPKNGYIGAKYWNDPGSF------VGASPGSQFKGLCSVFVTAAFSYSG 282

Query: 268 IELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXX 327
            EL G+ AAE+ NPR  +P+A K T + I L Y++ + ++G  V ++DP+LL        
Sbjct: 283 TELVGVSAAESANPRYTLPKASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLSASSSVDV 342

Query: 328 XXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAK 387
               P V+AI+N G++ LP + N  +LI + S  NS +Y  +R + S+A  G  P++F  
Sbjct: 343 AAS-PLVIAIENGGIQGLPSLMNAIILIAIISVANSSVYACSRCMVSMAEIGNLPRIFTY 401

Query: 388 TNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYR 447
            +  G P  A          +++  S+   +IF +   +  +  +  W++I I++I F R
Sbjct: 402 IDNRGRPIVAIIFTLVFGLLSFIAASNKQEEIFVWLSALSGLSTLFCWLAINISHIRFRR 461

Query: 448 ACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEF-------DYKSFIT 500
           A   Q    +   Y +     G++   + CV+I  +   + +   F       D++SF  
Sbjct: 462 ALNTQGYSLDELPYLSMTGVIGSW---YGCVVIILVLIASFWTSLFPAGSSGADWESFFK 518

Query: 501 GYIGLPLYVIFYFGYKIIYKTK---LVKAEEADLYSFKEAID 539
           GY+ LP+++  + G+K +YK     ++++ + D+ + +  ID
Sbjct: 519 GYLSLPIFLFCFVGHK-LYKRNWSWMIRSNKIDVNTGRRMID 559

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  258 bits (658), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 159/525 (30%), Positives = 268/525 (51%), Gaps = 15/525 (2%)

Query: 22  KNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXX 81
             TT+ + S +    S  I     +   L K+L  RH+  +A+                 
Sbjct: 58  NQTTNDVTSSDHFRGSEGIEQEDINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALS 117

Query: 82  XXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLF 140
              PAS++I +  +   +F V+  LGE++   P+  GF  Y+ R+ +P+  FAV   YL 
Sbjct: 118 TGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLA 177

Query: 141 KYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSF 200
           ++ ++ P +L A ++ I+YW D+  +N   W+ IF   I + N + V+ FGE EF LS  
Sbjct: 178 QWLVLLPLELVAASITIKYWNDK--INSDAWVAIFYATIALANMLDVKSFGETEFVLSMI 235

Query: 201 KIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVY 260
           KI+ + G  +   ++  GGGP+   +G +YW +PGAF  +S     S  +F    +VFV 
Sbjct: 236 KILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAFVGHS-----SGTQFKGLCSVFVT 290

Query: 261 ALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLX 320
           A F+Y GIE+T + AAE++NPR  IP+A K T + I   Y+  + L+G  V  NDPRLL 
Sbjct: 291 AAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLN 350

Query: 321 XXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGK 380
                      P V+AI+N G++ LP + N  +LI V S  NS +Y  +R + ++A  G 
Sbjct: 351 GSSSVDAASS-PLVIAIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGN 409

Query: 381 APKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILI 440
            PK   + ++ G P NA          +++  S   A++F +   +  +  I  W++I +
Sbjct: 410 LPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINL 469

Query: 441 TYIFFYRACIAQNVDRNSFAYRAPFQPYGAY---ITLFFCVLIAFIKN-FTVFIGEFDYK 496
           ++I F +A   Q    +   + +     G++   I LF  ++ +F  + F +     + +
Sbjct: 470 SHIRFRQAMKVQERSLDELPFISQTGVKGSWYGFIVLFLVLIASFWTSLFPLGSSGANAE 529

Query: 497 SFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADLYSFKEAID 539
           SF  GY+  P+ ++ YFG+KI  +  T +VK E+ DL + ++ +D
Sbjct: 530 SFFEGYLSFPILIVCYFGHKIYTRNWTLMVKLEDIDLDTGRKQVD 574

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  258 bits (660), Expect = 2e-77,   Method: Compositional matrix adjust.
 Identities = 165/531 (31%), Positives = 258/531 (48%), Gaps = 29/531 (5%)

Query: 19  DLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXX 78
           +LEKN        E  D+    +  K D   LKK ++ RH+ MIA+              
Sbjct: 95  ELEKN--------ESSDNIGARTGNKSD--SLKKTIQPRHVLMIALGTGIGTGLLVGNGT 144

Query: 79  XXXXXXPASILIAYSFVGILVFFVMACLGEMA-TYIPL-DGFTSYATRYCDPALGFAVGY 136
                 PA +LI Y  +G +++ ++   GEMA  Y  L  G+ +Y +   D   GFAV +
Sbjct: 145 ALVHAGPAGLLIGYGIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAW 204

Query: 137 CYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFW 196
            Y  ++  + P +L   ++ I+YW    +VNP V++ IF V+++ IN  G R + E EF+
Sbjct: 205 VYCLQWLCVCPLELVTASMTIKYWT--TSVNPDVFVIIFYVLVITINIFGARGYAEAEFF 262

Query: 197 LSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVA 256
            +  KI++M G  +   II +GG  N   +G +YW +PGAF         S  +F   VA
Sbjct: 263 FNCCKILMMTGFFILGIIIDVGGAGNDGFIGGKYWHDPGAFNGKH-----SIDRFKGVVA 317

Query: 257 VFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDP 316
             V A FA+ G E   I  AE  NPR+ +P A K  +YRI+  ++ TI LLG  V YN  
Sbjct: 318 TLVTAAFAFGGSEFIAITTAEQANPRKAVPGAAKQMIYRILFLFLATIILLGFLVPYNSN 377

Query: 317 RLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLA 376
           +LL            P+V+A+ + GVR +PH  N  +L+ V S  NS  Y   R L +L+
Sbjct: 378 QLLGSSGGGTKAS--PYVIAVASHGVRVVPHFINAVILLSVLSMANSSFYSSARILLTLS 435

Query: 377 IDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWI 436
             G AP++F   ++ G P  A          A+   S    Q+F + + +  +  + +W 
Sbjct: 436 EQGYAPRVFTYIDKAGRPLIAMGVSALFGVIAFCAASPKEDQVFTWLLAISGLSQLFTWT 495

Query: 437 SILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI-----G 491
           +I +++I F RA   Q        +R+    +G+       +LI  I  F V I     G
Sbjct: 496 AICLSHIRFRRAMKVQGRSLGELGFRSQTGVWGSTYACIMMILI-LIGQFWVAIAPIGEG 554

Query: 492 EFDYKSFITGYIGLPLYVIFYFGYKIIYKT-KL-VKAEEADLYSFKEAIDR 540
           + D ++F   Y+ +P+ +  Y GYKI  K  KL ++A++ DL S ++  D 
Sbjct: 555 KLDAQAFFENYLAMPILIALYVGYKIWKKDWKLFIRADKIDLISHRQIFDE 605

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  257 bits (657), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 168/529 (31%), Positives = 271/529 (51%), Gaps = 21/529 (3%)

Query: 23  NTTSSLNSFEQEDDSNKISDGKEDGVR-----LKKELKARHISMIAIXXXXXXXXXXXXX 77
           N   S    E E+    ++D ++  ++     L+ +LK+RH+ MIAI             
Sbjct: 56  NFLDSFKRVEVEEVDPNLTDLEKIAIKTARSPLQHKLKSRHLQMIAIGGAIGTGLFVGSG 115

Query: 78  XXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRYCDPALGFAVGY 136
                  PA ILI +S  G ++F ++  LGE+A   P+ G FT+YATR+ D + GFA  +
Sbjct: 116 RALRTAGPAGILIGWSITGTMIFTMVMALGELAVMFPVSGGFTTYATRFIDESFGFACNF 175

Query: 137 CYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFW 196
            Y+ ++ ++ P ++ A ++ + YW        G ++ +F +V+VIIN  GVR +GE EF 
Sbjct: 176 NYMLQWLVVLPLEIVAASITVAYWETPVRYTDG-FVALFWLVVVIINMFGVRGYGEAEFV 234

Query: 197 LSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVA 256
            S  K+  + G I+   +++ GGGP    +G RYW NPGAF   +     S  KF  F +
Sbjct: 235 FSIIKVTAVIGFIILGIVLVCGGGPVGGYVGARYWHNPGAFVGST-----SGQKFHGFCS 289

Query: 257 VFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDP 316
           VFV A F++ G EL G+  +EA+NPR+ +P A K   +RI+LFYI+ + L+G  V YNDP
Sbjct: 290 VFVTAAFSFAGSELIGLAGSEAKNPRKAVPSAAKQVFWRILLFYIICLLLIGFLVPYNDP 349

Query: 317 RLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLA 376
           RL+            PFV+AI   G+  LP + NV +LI V S  NS +Y  +R+L +L+
Sbjct: 350 RLI--SSSSVDASASPFVIAIVTHGISGLPSVINVVILISVLSVGNSAIYSCSRTLVALS 407

Query: 377 IDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWI 436
             G  PK+ +  +R G P             A++  S+   ++FN+ + +  +    +W 
Sbjct: 408 EQGFLPKIVSYIDRKGRPLVGIAISSTFGLIAFVAASNKQNEMFNWLLAISGLSSFFTWS 467

Query: 437 SILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI----GE 492
           +I I +I F  A  AQ    +   + +P    G+Y  LF  +L+  I  F + +    G 
Sbjct: 468 AICICHIRFRGALKAQGRGTDELPFVSPAGVIGSYWGLFLNILM-LIAQFYIALFPIGGS 526

Query: 493 FDYKSFITGYIGLPLYVIFYFGYKIIYKTK--LVKAEEADLYSFKEAID 539
                F + Y+  P+ + FY  +K+  K    L+  E+ D+ + +   D
Sbjct: 527 PSAYEFFSAYLAAPVILAFYIAHKLWKKNWKFLIPLEDVDIDTGRRDTD 575

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  258 bits (658), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 161/522 (30%), Positives = 258/522 (49%), Gaps = 24/522 (4%)

Query: 33  QEDDSNKISD--GKEDGVR---LKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPAS 87
           QE + N+ SD  G   G +   LKK ++ RH+ MIA+                    PA 
Sbjct: 94  QELEKNESSDNIGANTGHKSDSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAG 153

Query: 88  ILIAYSFVGILVFFVMACLGEMA-TYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFII 145
           +LI Y+ +G +++ ++   GEMA  Y  L  G+ +Y +   D   GFAV + Y  ++  +
Sbjct: 154 LLIGYAIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCV 213

Query: 146 TPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVM 205
            P +L   ++ I+YW    +VNP V++ IF V+++ IN  G R + E EF+ +  KI++M
Sbjct: 214 CPLELVTASMTIKYWT--TSVNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMM 271

Query: 206 FGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAY 265
            G  +   II +GG  N   +G +YW +PGAF         +  +F    A  V A FA+
Sbjct: 272 TGFFILGIIIDVGGAGNDGFIGGKYWHDPGAFNGKH-----AIDRFKGVAATLVTAAFAF 326

Query: 266 LGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXX 325
            G E   I  AE  NPR+ IP A K  +YRI+  ++ TI LLG  V YN  +LL      
Sbjct: 327 GGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGG 386

Query: 326 XXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLF 385
                 P+V+A+ + GVR +PH  N  +L+ V S  NS  Y   R   +L+  G APK+F
Sbjct: 387 TKAS--PYVIAVASHGVRVVPHFINAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKVF 444

Query: 386 AKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFF 445
           +  +R G P  A          A+   S    Q+F + + +  +  + +W +I ++++ F
Sbjct: 445 SYIDRAGRPLIAMGVSALFAVIAFCAASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRF 504

Query: 446 YRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI-----GEFDYKSFIT 500
            RA   Q        +++    +G+       +LI  I  F V I     G+ D ++F  
Sbjct: 505 RRAMKVQGRSLGELGFKSQTGVWGSAYACIMMILI-LIAQFWVAIAPIGEGKLDAQAFFE 563

Query: 501 GYIGLPLYVIFYFGYKIIYKT-KL-VKAEEADLYSFKEAIDR 540
            Y+ +P+ +  Y GYK+ +K  KL ++A++ DL S ++  D 
Sbjct: 564 NYLAMPILIALYVGYKVWHKDWKLFIRADKIDLDSHRQIFDE 605

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  257 bits (656), Expect = 4e-77,   Method: Compositional matrix adjust.
 Identities = 156/530 (29%), Positives = 264/530 (49%), Gaps = 31/530 (5%)

Query: 29  NSFEQEDDSNKISDGKEDGV--------RLKKELKARHISMIAIXXXXXXXXXXXXXXXX 80
           NSF++   SN  +  KEDG         +LKK +K+RH+ MI++                
Sbjct: 69  NSFKRAPGSN--NPDKEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKAL 126

Query: 81  XXXXPASILIAYSFVGILVFFVMACLGEMAT-YIPLDG-FTSYATRYCDPALGFAVGYCY 138
               PA ++I Y+ +G  ++ ++   GE+A  Y  L G F +Y +   DPALGF+V + Y
Sbjct: 127 RNGGPAGLVIGYAIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVY 186

Query: 139 LFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLS 198
             ++  + P +L   ++ I+YW    +VNP +++ IF VVI+ IN  G R + E EF+ +
Sbjct: 187 CLQWLCVMPLELVTASITIKYWTT--SVNPDIFVAIFYVVIITINVFGARGYAEAEFFFN 244

Query: 199 SFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSK--GKFVSFVA 256
           +FK++++ G ++   I+  GG  N   +G +YW +PG+F       +G K    F   V+
Sbjct: 245 TFKVLMISGFLILGIIVNCGGAGNDGYIGGKYWNDPGSF-------SGDKPIDHFKGVVS 297

Query: 257 VFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDP 316
             V A FA+   E   + AAE  NPR++IP A K  +YRI++ Y+ +I L+G  V +N  
Sbjct: 298 TLVTAAFAFGATEFIALTAAEQANPRKSIPSAAKKILYRILVLYVGSIILIGFLVPHNSE 357

Query: 317 RLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLA 376
            L+            P+V+AI + GV+ +PH+ N  +L+ V S  NS  Y  +R L +LA
Sbjct: 358 ELMGSGGSATHAS--PYVIAIASHGVKVVPHLINAVILLSVISMGNSAFYSSSRLLLTLA 415

Query: 377 IDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWI 436
             G AP      +R G P  A          +++  S     +F + + +  +  + +W 
Sbjct: 416 EQGYAPSFLKYVDREGRPTLAMVISSVFGLISFVAASPKEETVFTWLLAISGLSQLFTWS 475

Query: 437 SILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI----GE 492
           +I +++I F RA   Q        +++    +G+Y      +LI   + +T       G+
Sbjct: 476 AICLSHIRFRRAMKVQGRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGK 535

Query: 493 FDYKSFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADLYSFKEAIDR 540
            D ++F   Y+ +P+ +  YFGYK+  +  T  + A + DL S +   D 
Sbjct: 536 LDAEAFFENYLAMPILIALYFGYKVWKRDWTLYIPASKIDLISNRRIFDE 585

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  256 bits (655), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 158/529 (29%), Positives = 269/529 (50%), Gaps = 18/529 (3%)

Query: 18  IDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXX 77
           ++   N  +S   F  +DD   +     +   L KEL  RH+  +A+             
Sbjct: 57  VNQTTNDITSSGRFHSDDD---VQQEDINNTNLSKELSVRHLLTLAVGGAIGTGLFVNTG 113

Query: 78  XXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGY 136
                  PAS++I +  +   +F V+  LGE++   P+  GF  Y+ R+ +P+  FAV  
Sbjct: 114 AALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNL 173

Query: 137 CYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFW 196
            YL ++ ++ P +L A ++ I+YW D+  +N   W+ IF   I + N + V+ FGE EF 
Sbjct: 174 NYLAQWLVLLPLELVAASITIKYWNDK--INSDAWVAIFYATIAMANMLDVKSFGETEFV 231

Query: 197 LSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVA 256
           LS  KI+ + G  +   ++  GGGP+   +G +YW +PGAF  +      S  KF    +
Sbjct: 232 LSMIKILAIIGFTILGIVLSCGGGPHGGYIGGKYWNDPGAFVGHD-----SGTKFKGLCS 286

Query: 257 VFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDP 316
           VFV A F+Y GIE+T + AAE++NPR  IP+A K T + I + Y+  + L+G  V  NDP
Sbjct: 287 VFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITISYVTILTLIGCLVPSNDP 346

Query: 317 RLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLA 376
           RLL            P V+AI+N  ++ LP + N  +LI V S  NS +Y  +R + ++A
Sbjct: 347 RLL-NGSSSVDAASSPLVIAIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMA 405

Query: 377 IDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWI 436
             G  PK   + ++ G P NA          +++  S   A++F +   +  +  I  W+
Sbjct: 406 HIGNLPKFLRRVDKRGRPINAIVLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWM 465

Query: 437 SILITYIFFYRACIAQNVDRNSFAYRAPFQPYGA---YITLFFCVLIAFIKN-FTVFIGE 492
           +I +++I F +A   Q    +   + +    +G+   ++ LF  ++ +F  + F +    
Sbjct: 466 AINLSHIRFRQAMKFQERSLDELPFISQTGVWGSIYGFVVLFLVLIASFWTSMFPIGSSG 525

Query: 493 FDYKSFITGYIGLPLYVIFYFGYKIIYKT--KLVKAEEADLYSFKEAID 539
            + +SF  GY+  P+ ++ YFG+KI  +    LVK E+ DL + ++ +D
Sbjct: 526 ANAESFFEGYLSFPILIVCYFGHKIYTRDWRLLVKLEDMDLDTGRKQVD 574

>Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON}
           (39793..41601) [1809 nt, 603 aa]
          Length = 602

 Score =  256 bits (655), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 174/531 (32%), Positives = 269/531 (50%), Gaps = 27/531 (5%)

Query: 2   SVYEVTKDSKLIREDIIDLEKNTTSSL-NSFEQE---DDSNKISDGKEDGVRLKKELKAR 57
           SV E+ +  K+  E I + +   TS + NSFE E   DDS  + + ++   +L + +K+R
Sbjct: 40  SVNELNEGDKVKYEGIKNGDTQVTSGITNSFESESLRDDSKPLENEEKTENQLNRSIKSR 99

Query: 58  HISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMA-TYIPLD 116
           H+ MI++                    PA ++I Y    I+V+F++   GE+   Y  L 
Sbjct: 100 HLLMISLGTGIGTGLLVGNGQVLAKSGPAGLVIGYGVASIMVYFIVQAAGELGICYSGLT 159

Query: 117 G-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIF 175
           G +  Y +   DPALGFA+   Y  ++  + P QL   A+ I YW +   +NP +++ I 
Sbjct: 160 GNYIRYPSILVDPALGFAISIIYTLQWLTVMPLQLVTAAMTIGYWTN---INPNIFVAIV 216

Query: 176 LVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPG 235
           LV++V+ N  G + + E EF  + FK+++M G +L   +I  G       +G  YWKNPG
Sbjct: 217 LVIVVLTNCFGAKGYVEAEFLCNIFKVLMMVGFVLLAILINTGAIGTDGYIGTIYWKNPG 276

Query: 236 AFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYR 295
           AF        G KG      +VF YA F+Y GIE+  + AAE ENP + IP A K T+YR
Sbjct: 277 AFA------NGFKG----VCSVFCYAAFSYGGIEVLALTAAEQENPIKAIPSACKKTVYR 326

Query: 296 IILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLI 355
           I+  Y++T  L+G  V Y+ P+L+            PFV+AI + GV+ +PH+ N  +LI
Sbjct: 327 ILFLYMLTTILIGFLVPYDSPQLMGSTSGGGSHSS-PFVIAIASHGVKVVPHLINAVILI 385

Query: 356 FVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSG 415
            + S  NS  Y  TR L SL+  GK PK+F   ++ G P+             ++  S  
Sbjct: 386 SIVSVANSAFYSSTRLLLSLSEQGKIPKIFNYVDKEGRPWYCILFASLFGSIGFVASSPY 445

Query: 416 SAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLF 475
             ++F + + +  +  I  W+SI +++I F RA I Q    +   Y+AP   +G++I L 
Sbjct: 446 KEEVFTWLLAISGLSQIFLWMSICLSHIRFRRAMIKQGKSLDEIGYKAPTGCWGSWIALS 505

Query: 476 FCVLIAFIKNFTVFI------GEFDYKSFITGYIGLPLYVIFYFGYKIIYK 520
              L + I  F V I      G+ D   F   Y+  P+ +I Y GYK  YK
Sbjct: 506 IA-LFSLISQFWVAIAPIGKDGKLDVLVFFQNYLAAPIVLIAYLGYKTYYK 555

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  257 bits (656), Expect = 6e-77,   Method: Compositional matrix adjust.
 Identities = 161/537 (29%), Positives = 264/537 (49%), Gaps = 24/537 (4%)

Query: 16  DIIDLEKNTTSSLNSFEQEDDSNKI---SDGKEDGVRLKKELKARHISMIAIXXXXXXXX 72
           D+      ++   +  E+++ ++KI   +  K D   LKK ++ RH+ MIA+        
Sbjct: 81  DLTSAISPSSRQAHELEKDETTDKIAPHTGHKSD--SLKKTIQPRHVLMIALGTGIGTGL 138

Query: 73  XXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMA-TYIPL-DGFTSYATRYCDPAL 130
                       PA +LI Y+ +G +++ ++   GEMA  Y  L  G+ +Y +   D   
Sbjct: 139 LVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEMALVYSNLTGGYNAYPSFLVDDGF 198

Query: 131 GFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYF 190
           GFAV + Y  ++  + P +L   ++ I+YW    +VNP V++ IF V+++ IN  G R +
Sbjct: 199 GFAVAWVYCLQWLCVCPLELVTASMTIKYWT--TSVNPDVFVIIFYVLVITINIFGARGY 256

Query: 191 GEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGK 250
            E EF+ +  KI++M G  +   II +GG  N   +G +YW  PGAF         +  +
Sbjct: 257 AEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGYIGGKYWHEPGAFNGVH-----AIDR 311

Query: 251 FVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMC 310
           F   VA  V A FA+ G E   I  AE  NPR+ IP A K  +YRI+  ++ TI ++G  
Sbjct: 312 FKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAAKQMIYRILFLFLATIIIVGFL 371

Query: 311 VAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTR 370
           V YN  +LL            P+V+AI + GVR  PH  N  +L+ V S  NS  Y   R
Sbjct: 372 VPYNSDQLLGSSGGGTKAS--PYVIAIASHGVRVAPHFVNAVILLSVLSMANSSFYSSAR 429

Query: 371 SLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIF 430
              +L+  G APK+F+  +R G P  A          A+   S    Q+F + + +  + 
Sbjct: 430 LFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSALFAVIAFCAASPKEDQVFTWLLAISGLS 489

Query: 431 GILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI 490
            + +W +I +++I F RA   Q        +++    +G+  +    +LI  I  F V I
Sbjct: 490 QLFTWTAICLSHIRFRRAMKVQGRSLGELGFKSQTGVWGSIYSCIMMILI-LIGQFWVAI 548

Query: 491 -----GEFDYKSFITGYIGLPLYVIFYFGYKIIYKT-KL-VKAEEADLYSFKEAIDR 540
                G+ D ++F   Y+ +P+ ++ Y GYK+  K  KL ++A++ DL S ++  D 
Sbjct: 549 APIGEGKLDAQAFFENYLAMPILIVLYVGYKMWNKDWKLFIRADKIDLTSHRQIFDE 605

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  255 bits (651), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 167/541 (30%), Positives = 273/541 (50%), Gaps = 29/541 (5%)

Query: 12  LIREDIIDLEKNTTSSLNSFEQEDDSNKISDGK--------------EDGVRLKKELKAR 57
           L+ + ++D+    +S       +D   KIS G               E G  L K+L  R
Sbjct: 26  LVEKAVVDIPDPGSSHDLGQSSKDSGYKISTGSAIDSDSLHGNNVAFEYGENLNKDLDIR 85

Query: 58  HISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-D 116
           H+  +AI                    PAS++I +  +   +F V+  LGE+A   P+  
Sbjct: 86  HLLTLAIGGSIGTGLFVNSGTSLNTGGPASLIIGWVIISSALFTVINALGELAATFPIVG 145

Query: 117 GFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFL 176
           GF  Y TR+ DP+  FAV   YL  + +  P +L A ++ I+YW +RE +N   W+TIF 
Sbjct: 146 GFNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELVAASITIRYW-NRE-INSDAWVTIFF 203

Query: 177 VVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGA 236
           V I ++N + V++F E EF +S  KI+ + G  +   ++ +GGGP    +G +YW +PGA
Sbjct: 204 VFIALLNMMDVKFFSEAEFVMSIIKILAIVGFFILGIVLAVGGGPTGGYIGGKYWNDPGA 263

Query: 237 FKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRI 296
           F   S     +  +F    +VFV A F+Y G+E+T + AAE++NPR+ IP+A K T + I
Sbjct: 264 FHGDS-----AGSRFKGLCSVFVIAAFSYSGVEMTAVSAAESKNPRKTIPKATKRTFWVI 318

Query: 297 ILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIF 356
              YI  + L+G+ V YND RLL            P V+AI+N+G++ LP + N  +LI 
Sbjct: 319 TFSYISILTLIGILVPYNDKRLLSGSSSVDASAS-PLVIAIENAGIKGLPSLMNAIILIA 377

Query: 357 VFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGS 416
           + S  NS +YV +R + S+A+    PK+F+K ++ G P  +          +++  S   
Sbjct: 378 LLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRPLYSIFATLFVGLLSFIAASDKQ 437

Query: 417 AQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAY--ITL 474
            ++F +   +  +  I  WI I + +I F  A   QN   +  AY +    +G++  + +
Sbjct: 438 EEVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNRSLDELAYISQSGIWGSWYGVII 497

Query: 475 FFCVLIA--FIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKT--KLVKAEEAD 530
              VLIA  ++  F V     D ++F  GY+  P+ +  Y G+K+  K    ++  EE D
Sbjct: 498 LVLVLIASFWVSLFPVGESSADAEAFFEGYLSFPILIASYIGHKVYIKNWKWVIPLEEID 557

Query: 531 L 531
           +
Sbjct: 558 I 558

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  256 bits (653), Expect = 1e-76,   Method: Compositional matrix adjust.
 Identities = 162/514 (31%), Positives = 266/514 (51%), Gaps = 22/514 (4%)

Query: 37  SNKISDGKED-GVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFV 95
           S + S  KED    L K+L  RH+  +A+                    PAS++I +  +
Sbjct: 78  SEQFSIAKEDINENLNKDLSIRHLITLAVGGSIGVGLFVNSGAALASGGPASLVIDWVII 137

Query: 96  GILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGA 154
              +F V+  LGE+A   P+  GF  Y TR+ DP++ FA+   YL ++ ++ P +L A +
Sbjct: 138 STCLFTVINALGELAAAYPVVGGFNVYITRFVDPSVAFAINLNYLAQWLVLLPLELVAAS 197

Query: 155 LVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFI 214
           + I+YW D  T+N   W+ IF  VI + N + V+ FGE EF LS  KI+ + G  +   +
Sbjct: 198 ITIKYWND--TINSDAWVAIFYSVIALANMLDVKSFGETEFVLSMVKILAIIGFTILGIV 255

Query: 215 IMLGGGPNHDRLGFRYWKNPGAF---KPYSESITGSKGKFVSFVAVFVYALFAYLGIELT 271
           +  GGGP    LG  YW +PG+F   KP ++        F    +VFV A F+Y GIELT
Sbjct: 256 LACGGGPQGGFLGGHYWHDPGSFVGDKPGTQ--------FKGLCSVFVTAAFSYSGIELT 307

Query: 272 GIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXX 331
            + AAE+++PR+ IP+A K T + +   Y+  + ++G  V ++DPRLL            
Sbjct: 308 AVSAAESKDPRKTIPKATKRTFWLVTASYVTILTIIGCLVPFDDPRLLNGSSSVDAAAS- 366

Query: 332 PFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRW 391
           P V++I+N+G++ L  + N  +LI + S  NS +Y  +R + S+A  G  PK+ ++ ++ 
Sbjct: 367 PLVISIKNAGIKGLDSLMNAIILISIVSVANSAVYACSRCMVSMAHIGNLPKVLSRVDKR 426

Query: 392 GVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIA 451
           G P NA          +++  S   A++F +   +  +  I  W++I  ++I F  A   
Sbjct: 427 GRPVNAILSTLFFGLLSFIAASDKQAEVFTWLSALSGLSTIFCWMAINYSHIRFRAAMKV 486

Query: 452 QNVDRNSFAYRAPFQPYGAY--ITLFFCVLIA--FIKNFTVFIGEFDYKSFITGYIGLPL 507
           QN   +   Y +     G++  + + F VL+A  +   F +  G  D  SF  GY+ LP+
Sbjct: 487 QNKTLDELPYLSQCGVIGSWYGVIVLFLVLVASFWTSLFPLGSGTADVTSFFEGYLSLPI 546

Query: 508 YVIFYFGYKIIYKT--KLVKAEEADLYSFKEAID 539
            +  Y G+K+  +    LVK E+ DL + ++ ID
Sbjct: 547 LIACYVGHKLYVRNLQVLVKLEDMDLETGRKHID 580

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  254 bits (648), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 164/541 (30%), Positives = 274/541 (50%), Gaps = 40/541 (7%)

Query: 6   VTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVR---------------- 49
           +T DS+ + ++ I +  N +++  S E+    +K  D K+   R                
Sbjct: 20  ITIDSEFLTQEPITIPSNGSAA--SAEEAGSGSKWQDFKDSFKRVEPIAVDPNLTEAEKV 77

Query: 50  --------LKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFF 101
                   LK  LK RH+ MIAI                    PAS+LI +   G +++ 
Sbjct: 78  AIVTAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYA 137

Query: 102 VMACLGEMATYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYW 160
           ++  LGE+A   P+ G FT+YATR+ D + G+A  + Y+ ++ ++ P ++ + ++ + +W
Sbjct: 138 MVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFW 197

Query: 161 IDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGG 220
                   G ++ +F VVIVIIN  GV+ +GE EF  S  K++ + G I+   I+  GGG
Sbjct: 198 GTDPKYRDG-FVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGG 256

Query: 221 PNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAEN 280
           P    +G +YW +PGAF   +        KF    +VFV + F++ G EL G+ A+E+  
Sbjct: 257 PEGGYIGGKYWHDPGAFAGDTPG-----AKFKGVCSVFVTSAFSFAGSELVGLAASESVE 311

Query: 281 PRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNS 340
           PR+++P+A K   +RI LFYI+++ ++G+ V YND  L+            PFV+AI+  
Sbjct: 312 PRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAAS--PFVIAIKTH 369

Query: 341 GVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXX 400
           G++ LP + NV +LI V S  NS +Y  +R++ +LA     P++FA  +R G P      
Sbjct: 370 GIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIGV 429

Query: 401 XXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFA 460
                  A++  S     +FN+ + +  +  + +W  I I +I F +A  AQ  D +  +
Sbjct: 430 TSAFGLIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELS 489

Query: 461 YRAPFQPYGAYITLFFCVLIAFIKNFTVFI----GEFDYKSFITGYIGLPLYVIFYFGYK 516
           +++P   +G+Y  LF  V+I FI  F V +    G    + F   Y+  PL +  Y G+K
Sbjct: 490 FKSPTGVWGSYWGLFM-VVIMFIAQFYVALFPVGGSPSAEGFFEAYLSFPLVMAMYIGHK 548

Query: 517 I 517
           I
Sbjct: 549 I 549

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  255 bits (651), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 160/540 (29%), Positives = 271/540 (50%), Gaps = 23/540 (4%)

Query: 7   TKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXX 66
           +KDS  I +   D+  +     N   +++D N           L K+L  RH+  +A+  
Sbjct: 51  SKDSPGINQTTNDITSSDRFRRNEDTEQEDINN--------TNLSKDLSVRHLLTLAVGG 102

Query: 67  XXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRY 125
                             PAS++I +  +   +F V+  LGE++   P+  GF  Y+ R+
Sbjct: 103 AIGTGLYVNTGAALSTGGPASLVIDWVIISTCLFTVINSLGELSAAFPVVGGFNVYSMRF 162

Query: 126 CDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTV 185
            +P+  FAV   YL ++ ++ P +L A ++ I+YW D+  +N   W+ IF   I + N +
Sbjct: 163 IEPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNDK--INSDAWVAIFYATIALANML 220

Query: 186 GVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESIT 245
            V+ FGE EF LS  KI+ + G  +   ++  GGGP+   +G +YW +PGAF  +S    
Sbjct: 221 DVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGGPHGGYIGGKYWHDPGAFVGHS---- 276

Query: 246 GSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIF 305
            S  +F    +VFV A F+Y GIE+T + AAE++NPR  IP+A K T + I   Y+  + 
Sbjct: 277 -SGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKNPRETIPKAAKRTFWLITASYVTILT 335

Query: 306 LLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDL 365
           L+G  V  NDPRLL            P V+AI+N G++ LP + N  +LI V S  NS +
Sbjct: 336 LIGCLVPSNDPRLLNGSSSVDAASS-PLVIAIENGGIKGLPSLMNAIILIAVVSVANSAV 394

Query: 366 YVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVN 425
           Y  +R + ++A  G  PK   + ++ G P NA          +++  S   A++F +   
Sbjct: 395 YACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLTLFFGLLSFVAASDKQAEVFTWLSA 454

Query: 426 VVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAY---ITLFFCVLIAF 482
           +  +  I  W++I +++I F +A   Q    +   + +     G++   I LF  ++ +F
Sbjct: 455 LSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPFISQTGVKGSWYGFIVLFLVLIASF 514

Query: 483 IKNFTVFIGE-FDYKSFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADLYSFKEAID 539
             +     G     +SF  GY+  P+ ++ Y G+K+  +  T +VK E+ DL + ++ +D
Sbjct: 515 WTSLFPLGGSGASAESFFEGYLSFPILIVCYVGHKLYTRNWTLMVKLEDMDLDTGRKQVD 574

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  254 bits (649), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 157/555 (28%), Positives = 268/555 (48%), Gaps = 31/555 (5%)

Query: 2   SVYEVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKED------GVRLKKELK 55
           S Y + + S    +    +       +NSF ++ +S  + + K +        ++KK +K
Sbjct: 16  STYAIIQTSSPCSKKYSYISGQVNRFINSFRRKGESEDVKELKGENEECGAATKMKKSIK 75

Query: 56  ARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMA-TYIP 114
           +RH+ MI++                    PA ++I Y+   I+++ ++   GE+   Y  
Sbjct: 76  SRHLLMISLGTGIGTGLLVGNGKALAKAGPAGLVIGYAVASIMLYCIIQAAGELGICYSG 135

Query: 115 LDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWIT 173
           + G +T+Y++   DPALGF+V + Y  ++  + P QL   A+ ++YW +    NP +++ 
Sbjct: 136 MAGNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPLQLVTAAMTVRYWTN---ANPDIFVA 192

Query: 174 IFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKN 233
           +F VVI++IN  G + + E EF  +  K++++ G ++    I  GG      +G +YW +
Sbjct: 193 VFFVVIMVINMFGAKGYAEAEFLFNICKVLMIAGFVILGIAINCGGAGTSGYIGAKYWHS 252

Query: 234 PGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTM 293
           PG+F        G KG       VF YA F+Y GIE+  + A+E ENPR++IP A K  +
Sbjct: 253 PGSFA------AGFKG----VCYVFCYAAFSYGGIEVMVLTASEQENPRKSIPNACKKVI 302

Query: 294 YRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCV 353
           YRI++ Y++T  ++   V YN   L+            P V+A+ + GV+ +PHI N  +
Sbjct: 303 YRILMIYMLTTIIVCFLVPYNSSELMGSSGESASHAS-PLVIAVASHGVKIVPHIINAVI 361

Query: 354 LIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVS 413
           LI V S  NS +Y   R L SL+  G APK     +R G P             A++  S
Sbjct: 362 LISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQGRPLICFAITLLVALIAFVAAS 421

Query: 414 SGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYIT 473
                IF + + +  +  I  W SI ++++ F  A  AQ +      Y++    +G++  
Sbjct: 422 DAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHAQGLSLGQIGYKSQTGYWGSWFA 481

Query: 474 LFFCVLIAFIKNFTVFI------GEFDYKSFITGYIGLPLYVIFYFGYKIIYKT--KLVK 525
           +   VL+  I  F V I      G  + ++F   Y+  P+ +  YFGYK+ +K     + 
Sbjct: 482 IVISVLV-LIAQFWVAIAPIGEEGRLNAETFFQNYLAFPILLGAYFGYKVYHKDWRLCIP 540

Query: 526 AEEADLYSFKEAIDR 540
           A E DL S +   D 
Sbjct: 541 ASEVDLSSHRNISDE 555

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  254 bits (650), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 159/501 (31%), Positives = 255/501 (50%), Gaps = 15/501 (2%)

Query: 46  DGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMAC 105
           +   L K+L  RH+  +A+                    PAS++I +  V   +F V+  
Sbjct: 84  NNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVIVSTCLFTVINS 143

Query: 106 LGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRE 164
           LGE+A   P+  GF  Y TR+ +P+  FA+   YL ++ ++ P +L A ++ I+YW D+ 
Sbjct: 144 LGELAAAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAASITIRYWNDK- 202

Query: 165 TVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHD 224
            +N   W+ IF   I + N + V+ FGE EF LS  KI+ + G  +   ++  GGGP+  
Sbjct: 203 -INSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVLTCGGGPHGG 261

Query: 225 RLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRN 284
            +G +YW NPGAF  +S     +  +F    +VFV A F+Y GIE+T + AAE+ NP+  
Sbjct: 262 YIGGKYWHNPGAFVGHS-----AGSQFKGLCSVFVTAAFSYSGIEMTAVSAAESRNPKET 316

Query: 285 IPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRA 344
           IP+A K T + I + Y+  + L+G  V YNDPRLL            P V+AI+N G++ 
Sbjct: 317 IPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAAS-PLVIAIENGGIKG 375

Query: 345 LPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXX 404
           LP + N  +LI + S  NS +Y  +R + S+A  G  PK  +K ++ G P NA       
Sbjct: 376 LPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLNAILLTLFF 435

Query: 405 XXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAP 464
              +++  S    ++F +   +  +  I  W++I ++ I F  A  AQ    +   + + 
Sbjct: 436 GLLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSLDEMPFLSQ 495

Query: 465 FQPYGAY--ITLFFCVLIA--FIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYK 520
              +GA+  + + F VL+A  +   F V       KSF  GY+ LP+ +  Y G+K+  +
Sbjct: 496 SGTWGAWYGVIVLFLVLVASFWTSLFPVGSSTASAKSFFEGYLSLPILIACYVGHKLWKR 555

Query: 521 T--KLVKAEEADLYSFKEAID 539
               LV   E DL S +  +D
Sbjct: 556 DWRLLVPLMEMDLDSGRRVLD 576

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  255 bits (651), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 171/540 (31%), Positives = 276/540 (51%), Gaps = 30/540 (5%)

Query: 8   KDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXX 67
           KDS    ED+ +L+ N T          ++ +I+        L+  LK R  +MIAI   
Sbjct: 73  KDSFKKAEDV-ELDPNLT----------EAERIAQATAK-APLQHTLKGRQQTMIAIGGA 120

Query: 68  XXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYC 126
                            PA ++I +     +++ ++  LGE+A   P+  GFT+YATR+ 
Sbjct: 121 IGSGLFVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMALGELAVVFPVAGGFTTYATRFV 180

Query: 127 DPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVG 186
           D + G+A  + Y  ++ ++ P ++ + ++ + YW        G ++ +F +VIVIIN  G
Sbjct: 181 DESFGYANNFNYALQWLVVLPLEIVSASITVNYWGTPTRYRDG-FVALFWLVIVIINMFG 239

Query: 187 VRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITG 246
           V+ FGE EF  S  K+  + G I+   +++ GGGP    +G +YW +PGAF  +     G
Sbjct: 240 VKGFGEAEFVFSIIKVTTVIGFIILGIVLVCGGGPKGGFVGAKYWHDPGAFVGH-----G 294

Query: 247 SKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFL 306
           S  +F    +VFV A F++ G EL GI AAEA NPR++IP A K  ++RI+LFY+ T+ +
Sbjct: 295 SGAQFKGVCSVFVTAAFSFAGSELIGITAAEAANPRKSIPGAAKQVVWRIVLFYMGTLTM 354

Query: 307 LGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLY 366
           +G+ V YND RL+            PFV+AI   G++ LP + NV +LI V S  NS ++
Sbjct: 355 IGLLVPYNDKRLIGASSVDAAAS--PFVIAIVTHGIKGLPSVINVVILIAVLSVGNSAIF 412

Query: 367 VGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNV 426
             +R++ +L+  G  PK+F   +R G P             A++  S    ++FN+ + +
Sbjct: 413 ACSRTIAALSDQGFLPKVFGYIDRSGRPLVGIAITSTFGLLAFVAASKKEGEVFNWLLAL 472

Query: 427 VSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNF 486
             +  + +W  I + +I F  A  AQ  D N   + +P    G+Y  LF  VL+ FI  F
Sbjct: 473 SGLSSLFTWGGICLCHIRFRMALKAQGRDTNELTFVSPAGVAGSYWGLFMIVLM-FIAQF 531

Query: 487 TVFI----GEFDYKSFITGYIGLPLYVIFYFGYKIIYKTK---LVKAEEADLYSFKEAID 539
            V +    G+ D + F   Y+  P+ V  YFG+K IYK      +  E+ D+ + +   D
Sbjct: 532 YVALFPPGGKPDAEVFFQSYLSFPIVVATYFGHK-IYKRNWKLFIPLEDMDIDTGRRETD 590

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  254 bits (650), Expect = 3e-76,   Method: Compositional matrix adjust.
 Identities = 158/539 (29%), Positives = 267/539 (49%), Gaps = 22/539 (4%)

Query: 14  REDIIDLEKNTTSSLNSFEQEDDS---NKISDGKEDGVRLKKELKARHISMIAIXXXXXX 70
           R D+    ++    ++SF++ DDS   N +          KK +K+RH+ M+++      
Sbjct: 54  RFDVQVKNRHLQGFIDSFKRADDSPDHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGT 113

Query: 71  XXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMA-TYIPLDG-FTSYATRYCDP 128
                         PAS++IAY  V  + +F++   GEMA TY  L G F +Y + +   
Sbjct: 114 GLLVSNGKGLSLAGPASLVIAYGLVSFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISK 173

Query: 129 ALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVR 188
             GFA  + +  ++  + P +L   A+ I+YW    +++P V++ IF V ++ I+  GV+
Sbjct: 174 PFGFATTWLFCIQWLTVLPLELITAAMTIKYW--NTSIDPDVFVIIFYVFLMFIHFFGVQ 231

Query: 189 YFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSK 248
            +GE EF  ++ KI+++ G I+F  ++  GG      +G +YW +PGAF       +   
Sbjct: 232 AYGETEFIFNACKILMIGGFIIFAIVVNCGGAGKDGYIGGKYWHDPGAFAS-----SNGA 286

Query: 249 GKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLG 308
            +F       V A F+Y G EL  +   + +NPR++ P A K  +YRI++ Y++T+ L+G
Sbjct: 287 SRFKGICYNLVNAYFSYGGNELFVLSVNDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIG 346

Query: 309 MCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVG 368
             V +N   LL            P+V+A    G++ +PHI N  +LI + S  NS LY G
Sbjct: 347 FVVPHNSSELLGASGGNGLHAS-PYVLAASIHGIKVVPHIINAVILIALISVANSSLYAG 405

Query: 369 TRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVS 428
            R L SLA  G AP+  +  +R G P  A           +   S    ++F +   +  
Sbjct: 406 PRLLSSLAQQGYAPRFLSYVDRRGRPLTALLLSALVGVIGFAATSPREEEVFTWLAAISG 465

Query: 429 IFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTV 488
           +  + +W SI+ ++I F RA   QN   ++  Y+A    +G+Y  + F +L+ F   F V
Sbjct: 466 LSELFTWTSIMFSHIRFRRAMKLQNKSLDTLGYKANTGLWGSYFGVGFNILV-FAAQFWV 524

Query: 489 FI------GEFDYKSFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADLYSFKEAID 539
            +      G+ D  SF   Y+ +P++++FYFGY   YK  T L    + DL + ++  D
Sbjct: 525 ALSPPNSGGKCDANSFFASYLAMPIWLVFYFGYMCWYKDFTVLTDLNQVDLDNHRKVYD 583

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  254 bits (649), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 156/524 (29%), Positives = 260/524 (49%), Gaps = 21/524 (4%)

Query: 5   EVTKDSKLIR---EDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISM 61
           + T+++KLI    +     E +TT +    E   D     +      +LKK +K+RH+ M
Sbjct: 43  QTTRNNKLIHRFVDSFKRAEGSTTHTKQINENTSDLEGDVNSFTSDSKLKKSMKSRHVVM 102

Query: 62  IAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL--DGFT 119
           + +                    PA+++I Y  V  + +F++   GEMA   P     F 
Sbjct: 103 MTLGTGIGTGLLVANAKGLHYGGPAALVIGYFLVSFVTYFMIQAAGEMAVTYPTLPANFN 162

Query: 120 SYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVI 179
           +Y++ +     GFA  + Y F++  + P +L   A+ I++W D  T+NP ++I IF V +
Sbjct: 163 AYSSIFISKPFGFATVWVYCFQWLTVLPLELITAAMTIKFWND--TINPDIFILIFFVFL 220

Query: 180 VIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKP 239
           + I+  GV+ +GE EF  +  KI+++ G I+   +I  GG  N   +G +YW+NPGAF  
Sbjct: 221 LFIHFFGVKGYGETEFIFNCCKILMIAGFIILSVVINCGGAGNDGYIGGKYWRNPGAFAG 280

Query: 240 YSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILF 299
            +     S G+F +   + V A F++ G+EL  +   E  NPR+  P A K ++YRI++ 
Sbjct: 281 DT-----SAGRFKNVCYILVTAYFSFGGMELFALSVQEQANPRKTTPVAAKRSIYRILVI 335

Query: 300 YIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFS 359
           Y++T+ L+G  V YND +L+            P+V+A    GV+ +PHI N  +LI V S
Sbjct: 336 YLLTMILIGFNVPYNDDQLMGAGGSATHAS--PYVLAASIHGVKVVPHIINAVILISVIS 393

Query: 360 ACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQI 419
             NS LY G R + SLA  G  PK     +R G P  A           ++  SS    +
Sbjct: 394 VANSSLYAGPRLMCSLAQQGYGPKFLDYVDREGRPLIALIVCSVFGVIGFVAASSKEEVV 453

Query: 420 FNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVL 479
           F +   +  +  + +W SI+++++ F +A   Q    +   Y+A    +G+   +FF +L
Sbjct: 454 FAWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSAYGVFFNIL 513

Query: 480 IAFIKNFTVFI------GEFDYKSFITGYIGLPLYVIFYFGYKI 517
           + FI  F V +      G+   +SF   Y+  P+++ FY GY I
Sbjct: 514 V-FIAQFWVALAPLNNGGKCSAESFFQSYLAFPIWIAFYLGYMI 556

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  254 bits (649), Expect = 4e-76,   Method: Compositional matrix adjust.
 Identities = 158/497 (31%), Positives = 258/497 (51%), Gaps = 20/497 (4%)

Query: 50  LKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEM 109
           LK+ LK RH+ MIAI                    PA+++IA+   G +V+ V+  LGE+
Sbjct: 89  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALGEL 148

Query: 110 ATYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNP 168
           A  +P+ G + SY +R+ +P+ GFA+ Y YL    I  P +L A ++ + YW D ++   
Sbjct: 149 AVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYW-DVDSKYA 207

Query: 169 GVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDR-LG 227
             ++ +F +VIV IN  GV+ +GE EF  S  K+  + G I+   +++ GGGP+ +  +G
Sbjct: 208 DAFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYIG 267

Query: 228 FRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPR 287
            RYW NPG F        G KG    F A+FV + F++ G E+  + AAE ENPR+++PR
Sbjct: 268 ARYWYNPGGFA------HGFKG----FAAIFVTSAFSFAGSEMFALAAAETENPRKDLPR 317

Query: 288 AIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPH 347
           A K   +RI LFY++++ L+G  V Y D  L             PFV+AI  +G++ LP 
Sbjct: 318 AAKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASAS--PFVIAIARAGIKGLPS 375

Query: 348 IFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXX 407
           + NV +LI V S  N  +Y  +R++ SLA  G  P+ F   +R G P             
Sbjct: 376 VVNVVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLL 435

Query: 408 AYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQP 467
           ++++ SS   ++F++ + +  +     W SI + ++ F RA   Q    +  +Y+A    
Sbjct: 436 SFLSASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQTGI 495

Query: 468 YGAY--ITLFFCVLI-AFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYK--TK 522
           +G+   I L F VL   F        G  +   F + Y+ LP+ + FY  +K+  +  T 
Sbjct: 496 WGSLYGIGLIFIVLCFQFWVALFPIGGSPNANHFFSAYLSLPVVIFFYTCHKLYTRSWTF 555

Query: 523 LVKAEEADLYSFKEAID 539
           L+K+ + D+ + +  +D
Sbjct: 556 LIKSSDIDIDTGRREMD 572

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  254 bits (649), Expect = 5e-76,   Method: Compositional matrix adjust.
 Identities = 159/521 (30%), Positives = 261/521 (50%), Gaps = 27/521 (5%)

Query: 28  LNSFEQED------DSNKISDGKEDGV---RLKKELKARHISMIAIXXXXXXXXXXXXXX 78
           ++SF++ D      D N +  G    +    LKK +K+RH+ M+ +              
Sbjct: 70  MDSFKRADGQRAGFDDNDLESGTRSFISESHLKKSMKSRHVVMMTLGTGIGTGLLVANAS 129

Query: 79  XXXXXXPASILIAYSFVGILVFFVMACLGEMA-TYIPLDG-FTSYATRYCDPALGFAVGY 136
                 PA +++AY  V  + +F++   GEMA TY  L G F SY + +     GFA  +
Sbjct: 130 GLHASGPAPLVLAYGLVSFVTYFMIQAAGEMAVTYPTLPGNFNSYMSLFVSKPFGFATVW 189

Query: 137 CYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFW 196
            +L ++  + P +L   +L I+YW D+  +N  V++ IF V ++ I+  GV+ +GE EF 
Sbjct: 190 LFLLQWLTVLPLELITSSLTIKYWNDK--INSDVFVVIFYVFLLFIHFFGVQAYGETEFI 247

Query: 197 LSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVA 256
            +S KI+++ G I+F  ++  GG  +   +G +YW +PGAF  ++     + G+F     
Sbjct: 248 FNSCKILMIAGFIIFSIVVNCGGAGHDGYIGGKYWHDPGAFTSHT-----NIGRFKGICF 302

Query: 257 VFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDP 316
           + V A F+Y G EL  +   E ENPR++ P+A K ++YRI++ Y++T+ L+G  V +++ 
Sbjct: 303 ILVTAYFSYGGTELYVLSVNEQENPRKSTPQAAKQSIYRIVVIYLLTMILIGFNVPHDND 362

Query: 317 RLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLA 376
           +L+            P+V+A    GVR +PH  N  +LI V S  NS LY   R L SLA
Sbjct: 363 QLMGSHGSATHAS--PYVLAASIHGVRIVPHFINAVILISVISVANSSLYASPRLLCSLA 420

Query: 377 IDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWI 436
             G APK     +R G P  A           +   S+   Q+F +   +  +  + +W 
Sbjct: 421 QQGYAPKFLTYIDRQGRPLTALATCSLFGVIGFAAASNQEEQVFTWLAAIAGLSELFTWS 480

Query: 437 SILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYK 496
            I+++++ F +A   Q  D N   Y+A    +G+   +FF +L+ F   F V +     K
Sbjct: 481 GIMLSHVRFRQAMKVQGRDLNELGYKAVSGVWGSVYGVFFNILV-FFAQFWVALAPPGSK 539

Query: 497 ----SFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADL 531
               SF   Y+  P++  FYFGY +  K  T L+  E  DL
Sbjct: 540 PTALSFFESYLAFPIFFTFYFGYMLWNKDFTFLIPLESIDL 580

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  254 bits (648), Expect = 6e-76,   Method: Compositional matrix adjust.
 Identities = 156/496 (31%), Positives = 260/496 (52%), Gaps = 14/496 (2%)

Query: 50  LKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEM 109
           LK  LK+RH+ MIAI                    PAS++I +S  G +++ ++  + EM
Sbjct: 89  LKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVAEM 148

Query: 110 ATYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNP 168
           A   P+ G FT+YATR+ D + GFA  + Y+ ++ ++ P ++ + ++ + YW        
Sbjct: 149 AVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTKYRD 208

Query: 169 GVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGF 228
           G ++ +F +VIVIIN  GV+ +GE EF  S+ K++ + G I+   +++ GGGP    +G 
Sbjct: 209 G-FVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYVGA 267

Query: 229 RYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRA 288
           +YW +PGAF   +     +  +F  F +VFV A F++ G EL GI  +EAENPR+ +P A
Sbjct: 268 KYWHDPGAFVGAT-----AGAQFQGFCSVFVTAAFSFSGSELIGIAGSEAENPRKAVPPA 322

Query: 289 IKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHI 348
            K   +RI+LFYI+++  +G+ V  ND RL+            PFV+AI   G+R LP +
Sbjct: 323 AKQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAAS--PFVIAITVHGIRGLPSV 380

Query: 349 FNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXA 408
            NV +LI V S  NS +Y  +R+L +LA  G  PK+ +  +R G P             A
Sbjct: 381 INVVILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFFGLVA 440

Query: 409 YMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPY 468
           ++  S     +FN+ + +  +    +W +I + +I F  A  AQN   +   + +P   +
Sbjct: 441 FVAQSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVSPLGVF 500

Query: 469 GAYITLFFCVLIAFIKNFTVFIGEFDYKS---FITGYIGLPLYVIFYFGYKIIYKTK--L 523
           G+Y  LF  VL+   + +       D  S   F + Y+ LP+ ++ Y  +K+  K     
Sbjct: 501 GSYWGLFLIVLMLAAQFYVAIFPVGDTPSATNFFSAYLSLPVVLVMYIAHKLWTKNWKIF 560

Query: 524 VKAEEADLYSFKEAID 539
           +   + DL + ++ +D
Sbjct: 561 IPLGQLDLDTGRKQLD 576

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  254 bits (648), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 163/538 (30%), Positives = 262/538 (48%), Gaps = 26/538 (4%)

Query: 14  REDIIDLEKNTTSSLN-SFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXX 72
            E   DLE    S+L+ S  ++    K  D   D   L+K ++ RH+ M+++        
Sbjct: 85  EETAEDLENELVSTLSPSKSKQLHGQKNGD---DDAHLQKSIRPRHVLMMSLGTGIGTGL 141

Query: 73  XXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMA-TYIPLDG-FTSYATRYCDPAL 130
                       P +++I Y  +G  ++ ++   GEMA  Y  L G F +Y +   D  +
Sbjct: 142 LVGNGSALSKAGPGALVIGYGIMGSCLYCIIQACGEMAVCYSGLPGNFNAYPSFLVDEGM 201

Query: 131 GFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYF 190
            F V + Y  ++  + P +L   ++ I YW  +  VN  V++ IF V+I +INT G + +
Sbjct: 202 AFGVAWVYCLQWLCVMPLELVTASMTIDYWTTK--VNSDVFVVIFFVLITLINTFGAKGY 259

Query: 191 GEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKG- 249
            E EF+ +S K+++M G  +   +I  GG  N   +G +YW NPGAF+       G K  
Sbjct: 260 AEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDGYIGAKYWHNPGAFR-------GDKSI 312

Query: 250 -KFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLG 308
            +F   ++ F  A FA+   E   I A+E  NPRR IP A K  +YRI+  ++ +I L+G
Sbjct: 313 DRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVG 372

Query: 309 MCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVG 368
             V Y+   LL            P+V+A+ + GVR +PH  N  +L+ V S  NS  Y  
Sbjct: 373 FLVPYDSTELLGSGGSASSQAS-PYVIAVASHGVRVVPHFINAVILLSVLSVANSAYYSS 431

Query: 369 TRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVS 428
            R LYSLA  G APK F   +R G P  A          A+ + S     +F + +++  
Sbjct: 432 CRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIFGVIAFCSCSDKEEDVFAWLLSIAG 491

Query: 429 IFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTV 488
           +  + +W +I +++I F RA   Q    +   +++    +G+       +L A I  F V
Sbjct: 492 LSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQVGVWGSGYAAIMMIL-ALIAEFWV 550

Query: 489 F---IGE--FDYKSFITGYIGLPLYVIFYFGYKIIYKT-KL-VKAEEADLYSFKEAID 539
               IGE   D ++F   Y+ +P+ ++ YFGYKI  K  KL ++A++ DL S +   D
Sbjct: 551 SIAPIGEDHLDAQNFFENYLAMPILIVLYFGYKIYKKDWKLFIRAKDIDLISHRTIFD 608

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  253 bits (645), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 158/518 (30%), Positives = 260/518 (50%), Gaps = 26/518 (5%)

Query: 29  NSFEQEDDSNKISD-GKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPAS 87
           +SF+++  S++ S+   ++   L+K +K+RH+ MI++                    PA 
Sbjct: 68  DSFKRQLPSDQNSELESQEKNNLRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAG 127

Query: 88  ILIAYSFVGILVFFVMACLGEMA-TYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFII 145
           +++ Y    I+++ ++   GE+   Y  L G +T Y++   DP+LGFAV   Y  ++  +
Sbjct: 128 LVLGYGIASIMLYCIIQAAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTV 187

Query: 146 TPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVM 205
            P QL   A+ ++YW +   VN  +++ +  + ++IIN  G R + E EF  +  KI+++
Sbjct: 188 LPLQLVTAAMTVKYWTN---VNADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMV 244

Query: 206 FGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAY 265
            G ++   +I  GG  +   +G  YW NPG F        G KG       VF YA F+Y
Sbjct: 245 AGFVILAIVINCGGAGDRRYIGTEYWHNPGPFA------HGFKG----VCTVFCYAAFSY 294

Query: 266 LGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXX 325
            GIE+  + AAE ENP  +IP A K  +YRI+L Y++T  L+G  V YN   LL      
Sbjct: 295 GGIEVLLLSAAEQENPTESIPNACKKVVYRILLIYMLTTILIGFLVPYNSDELLGSGSSS 354

Query: 326 XXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLF 385
                 PFV+A+ + GV+ +PH  N  +LI V S  NS LY G R L SLA  G  PK  
Sbjct: 355 GSHAS-PFVIAVSSHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCL 413

Query: 386 AKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFF 445
           A  +R G P              ++  S+   Q+F + + + S+  +  W+S+ +++I F
Sbjct: 414 AYVDRNGRPLLCFLVSLAFGCIGFVATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRF 473

Query: 446 YRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI------GEFDYKSFI 499
             A   Q    +   Y+A    +G++I +   V    +  F V I      G+ D K F 
Sbjct: 474 RDAMAKQGRSMDEVGYKAQTGYWGSWIAVLIAVFF-LVCQFWVAIAPVSEHGKLDVKVFF 532

Query: 500 TGYIGLPLYVIFYFGYKIIYKTK--LVKAEEADLYSFK 535
             Y+ +P+ ++ YFG+K+ +K+    + AE+ DL S +
Sbjct: 533 QNYLAMPIVLLAYFGHKMYFKSWRFWIPAEKIDLDSHR 570

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  253 bits (647), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 161/542 (29%), Positives = 271/542 (50%), Gaps = 18/542 (3%)

Query: 5   EVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAI 64
            V +D     +DI D++  +  S +      D ++ +    D   + K+L  RH+  +A+
Sbjct: 99  NVDEDKLPFSDDIRDVKDRSDFSSSFVSSARDKDEETLLATD---MNKDLSVRHLLTLAV 155

Query: 65  XXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYAT 123
                               PAS++I +  V   +F V+  LGE+A   P+  GF+ Y  
Sbjct: 156 GGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTALFTVINSLGELAAAFPVVGGFSVYMD 215

Query: 124 RYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIIN 183
           ++ DP+  FAV   YL ++ ++ P +L A ++ I+YW    ++N   W++IF V I + N
Sbjct: 216 KFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIRYW--NSSINSDAWVSIFYVAIGLAN 273

Query: 184 TVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSES 243
            + V+ FGE EF LS  KI+ + G  +   ++  GGGP+H+ +G +YW +PGAF      
Sbjct: 274 MLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCGGGPSHEYIGGKYWHDPGAFVG---- 329

Query: 244 ITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVT 303
            T S  KF    +VFV A F++ GIE+T + AAE+ NPR  IP+A K T + I   Y+  
Sbjct: 330 -TTSGSKFKGLCSVFVTAAFSFSGIEMTAVSAAESRNPRETIPKAAKRTFWLITGSYVSI 388

Query: 304 IFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNS 363
           + L+G  V YNDPRL+            P V+AI+N  +  LP + N  +LI + S  NS
Sbjct: 389 LTLVGCLVPYNDPRLM-NGSSSVDAASSPLVIAIENGHIHGLPSLMNAIILIAILSVANS 447

Query: 364 DLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYF 423
            +Y  +R + S++     PK+FAK +R G P  A          +++  S   A++F + 
Sbjct: 448 SVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAICFVLFFGLLSFVAASDKQAEVFTWL 507

Query: 424 VNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAY--ITLFFCVLIA 481
             +  +  I  W+ I + +I F +    Q +  +   + +    +G+   I + F VL+A
Sbjct: 508 SALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDELPFLSQTGIWGSIYGIVILFLVLVA 567

Query: 482 --FIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKL--VKAEEADLYSFKEA 537
             +   F V   + +  SF  GY+  P+ +  Y  +K+ +K     + A + DL+S ++ 
Sbjct: 568 SFWTSLFPVGSSKANATSFFEGYLSFPILLGCYIAHKVYFKNWRWYIPASKMDLHSGRKQ 627

Query: 538 ID 539
           +D
Sbjct: 628 VD 629

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  252 bits (643), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 153/524 (29%), Positives = 261/524 (49%), Gaps = 21/524 (4%)

Query: 5   EVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKED---GVRLKKELKARHISM 61
           + +K  KLI       ++   S   + +  ++++ + DG E      +LKK +K+RH+ M
Sbjct: 43  QPSKSEKLIHRLANSFKRAEGSITKTRQINENTSDLEDGIESITSDSKLKKSMKSRHVVM 102

Query: 62  IAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL--DGFT 119
           +++                    PA+++I Y  V  + +F++   GEMA   P     F 
Sbjct: 103 MSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFVTYFMIQAAGEMAVTYPTLPANFN 162

Query: 120 SYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVI 179
           +Y++ +     GFA  + Y F++  + P +L   ++ IQYW D+  +NP V+I IF + +
Sbjct: 163 AYSSIFISKPFGFATVWLYCFQWLTVLPLELITASMTIQYWNDK--LNPDVYILIFYIFL 220

Query: 180 VIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKP 239
           + I+  GV+ +GE EF  +  KI+++ G I+   +I  GG  +   +G  YW NPGAF  
Sbjct: 221 LFIHVFGVKAYGETEFIFNCCKILMIAGFIILSVVINCGGAGDDGYIGGAYWHNPGAFAG 280

Query: 240 YSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILF 299
            +     S  +F +   + V   F++ G+EL  +   E  NPR++ P A K ++YRI++ 
Sbjct: 281 DT-----SIARFKNVCYILVTGYFSFGGMELFALSVQEQSNPRKSTPVAAKRSIYRIVII 335

Query: 300 YIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFS 359
           Y++T+ L+G  V YND +L+            P+V+A    GV+ +PHI N  +LI V S
Sbjct: 336 YLLTMILIGFNVPYNDDQLMGAGGSATHAS--PYVLAASIHGVKIVPHIINAVILISVVS 393

Query: 360 ACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQI 419
             NS LY G R + SL+  G APK     +R G P  A          A++  SS    +
Sbjct: 394 VANSSLYAGPRLICSLSQQGYAPKFLDYVDREGRPLRALIVCCIFGVIAFVAASSKEEIV 453

Query: 420 FNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVL 479
           F +   +  +  + +W SI+++++ F +A   Q    +   Y+A    +G+    FF +L
Sbjct: 454 FTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGIWGSVYGFFFNIL 513

Query: 480 IAFIKNFTVFI------GEFDYKSFITGYIGLPLYVIFYFGYKI 517
           + FI  F V +      G    +SF   Y+  P+++ F+FGY I
Sbjct: 514 V-FIAQFWVALAPLGNDGRCSVESFFESYLAAPIWLTFFFGYMI 556

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  251 bits (641), Expect = 4e-75,   Method: Compositional matrix adjust.
 Identities = 169/542 (31%), Positives = 277/542 (51%), Gaps = 31/542 (5%)

Query: 4   YEVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIA 63
           +E  +DS   R D  DL+ N T          D+ K++    +   LK+ LK+RH+ MIA
Sbjct: 42  WERFRDS-FKRADTQDLDPNLT----------DAEKMAILTANA-PLKRTLKSRHLQMIA 89

Query: 64  IXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYA 122
           I                    PA ILI ++  G +++ ++  +GE+A   P+  GFT+YA
Sbjct: 90  IGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAMGELAVTFPIAGGFTTYA 149

Query: 123 TRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVII 182
           +R+ D + GFA    Y+ ++ ++ P ++ A ++ + YW   +    G ++ +F VVIV I
Sbjct: 150 SRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDKYRDG-FVALFYVVIVAI 208

Query: 183 NTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSE 242
           N  GV+ +GE EF  S  K++ + G I+   I++ GGGP    +G R W NPGAF     
Sbjct: 209 NFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYIGGRLWHNPGAFA---- 264

Query: 243 SITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIV 302
              G KG      +VFV A F++ G EL G+ AAE  NPR+++P A K   +RI LFYI+
Sbjct: 265 --NGFKG----VCSVFVTAAFSFAGSELVGLAAAETANPRKSLPSAAKQVFWRITLFYIL 318

Query: 303 TIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACN 362
            + ++G+ V Y   RL+            PFV++IQN+G++ LP + NV +LI V S  N
Sbjct: 319 ALLMVGLLVPYTSDRLIGQSSVDAAAS--PFVISIQNAGIKGLPSVINVVILIAVLSVGN 376

Query: 363 SDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNY 422
           S ++  +RS+ +LA  G  PK+F   +R G P             +++  S    ++F++
Sbjct: 377 SAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLSFIAASPKEGEVFDW 436

Query: 423 FVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAF 482
            + +  +  + +W  I++ +I   RA  AQN      ++ AP   +G+       +LI  
Sbjct: 437 LLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPTGVWGSVYGFVLIILILM 496

Query: 483 IKNFTVF--IGEFDYKS-FITGYIGLPLYVIFYFGYKIIYKT-KL-VKAEEADLYSFKEA 537
            + +     IG+    S F   Y+  P+ + FY G+KI  K  KL ++A+  D+ + +  
Sbjct: 497 AQFWIALFPIGDKPSASAFFEAYLSFPILIAFYIGHKIWKKNWKLFIRAKNIDIDTGRRE 556

Query: 538 ID 539
            D
Sbjct: 557 TD 558

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  250 bits (638), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 162/525 (30%), Positives = 256/525 (48%), Gaps = 31/525 (5%)

Query: 28  LNSFEQEDDSNKISDGK-EDGV--RLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXX 84
           ++SF +  D + +     EDG   ++KK +K RH+ MI +                    
Sbjct: 40  IDSFRRGRDVDLMCKADAEDGTTAKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAG 99

Query: 85  PASILIAYSFVGILVFFVMACLGEMA-TYIPLDG-FTSYATRYCDPALGFAVGYCYLFKY 142
           PA +++ Y     +++ ++   GE+   Y  + G +T+Y++   DPA+GF+V + Y  ++
Sbjct: 100 PAGLILGYVVSSAMLYLIVEAAGELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQW 159

Query: 143 FIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKI 202
             + P QL   A++IQYW D   +NP +++ I   VIV IN  G + + E EF+ +  K+
Sbjct: 160 MTVFPLQLVTAAMIIQYWTD---INPDIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKV 216

Query: 203 MVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYAL 262
           +++ G ++   +I  GG      +G +YW  P  F      + G KG       VF YA 
Sbjct: 217 LMIIGFVILGVVINCGGAGTSGYIGDKYWHEPRPF------MNGFKG----LCFVFCYAA 266

Query: 263 FAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXX 322
           FAY GIE+  + A+E ENPR++I  A K  +YRI+L Y++T  ++   V  + P L    
Sbjct: 267 FAYGGIEVMVLSASEQENPRKSISSACKKVIYRIVLIYLLTTVIVCFLVPADHPSL---- 322

Query: 323 XXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAP 382
                    P V+A+   GV+ +PHI N  +LI V S  NS LY   R L SLA  G AP
Sbjct: 323 -ASEGSRASPLVIAVSFHGVKIVPHIINAVILIAVVSVGNSSLYSAPRLLLSLAEQGYAP 381

Query: 383 KLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITY 442
           K+F   +R G P  A          A++  S     +F + + +  +  +  W+SI I++
Sbjct: 382 KIFTYIDRQGRPLPAFFVAMVFGLLAFLAASPAQDDVFGWLLAISGLSQMFIWMSICISH 441

Query: 443 IFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGE-----FDYKS 497
           I F  A  AQ        Y+A    +G++I +    LI  I  F V I        D +S
Sbjct: 442 IRFRDAMKAQGRSMGEVGYKARTGYWGSWIAVVTAFLI-LIAQFWVAISPVETKGVDARS 500

Query: 498 FITGYIGLPLYVIFYFGYKIIYKTK--LVKAEEADLYSFKEAIDR 540
           F   Y+  P+ ++ YFGYKI +K     + A E DL S ++  D 
Sbjct: 501 FFQSYLAFPILLLAYFGYKIYHKDWRICIPASEVDLISHRQVFDE 545

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  250 bits (639), Expect = 8e-75,   Method: Compositional matrix adjust.
 Identities = 164/547 (29%), Positives = 268/547 (48%), Gaps = 31/547 (5%)

Query: 5   EVTKDSKLIREDIIDLEKNT--TSSLNSFEQEDDSNKISDGKEDGVR--------LKKEL 54
           E+T+ S  +      L++ T  T  ++SF + +D +  SD  EDG +        +KK +
Sbjct: 24  EITEKSTPVFPLDSTLKRRTHFTKFVDSFRRAEDKHADSD-LEDGSKSITSDDDHMKKAM 82

Query: 55  KARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIP 114
           K+RH+ M+ +                    PA +++ Y  V  + +F++   GEMA   P
Sbjct: 83  KSRHVIMMTLGTGIGTGLLVANGKGLALAGPAPLVLGYGLVSFVTYFMIQAAGEMAVTYP 142

Query: 115 L--DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWI 172
                F +YA+ +     GFA  + +  ++  + P +L   ++ I+YW D  T+NP V+I
Sbjct: 143 TMPASFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWND--TINPDVFI 200

Query: 173 TIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWK 232
            IF V ++ I+  GV+ +GE EF  +S KI+++ G I+   +I  GG      +G +YW 
Sbjct: 201 VIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSIVINCGGAGRDGYIGNKYWI 260

Query: 233 NPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLT 292
           NPGAF   S +      +F     + V   F+Y G EL  +   E +NPR++ P A K +
Sbjct: 261 NPGAFASESPA-----ARFKGVAYILVTGYFSYGGTELFSLSVNEQKNPRKSTPAAAKQS 315

Query: 293 MYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVC 352
           +YRI++ Y++T+ L+G  V ++  +L+            P+V+A    GV+ +PH  N  
Sbjct: 316 IYRILIIYLLTMILIGFNVPHDSDQLMGAGGSATHAS--PYVLAASLHGVKVVPHFINAV 373

Query: 353 VLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNV 412
           +LI V S  NS LY   R + SLA  G APK F   +R G P  A           ++  
Sbjct: 374 ILISVVSVANSALYASPRLMRSLAEQGYAPKWFNYVDREGRPLRALCICGLFGVIGFVAC 433

Query: 413 SSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYI 472
           S    Q F +   +  +  + +W SI I++I F  A   Q        YRA    +G+  
Sbjct: 434 SPQEEQAFTWLAAIAGLSELFTWSSIFISHIRFRMAMKVQGKSLEELGYRATTGIWGSVY 493

Query: 473 TLFFCVLIAFIKNFTVFI------GEFDYKSFITGYIGLPLYVIFYFGYKIIYK--TKLV 524
           ++FF +L+ FI  F V +      G++D + F   Y+  PL+++FYFGY I  +  T L 
Sbjct: 494 SVFFNMLV-FIAQFWVALSPPKSNGKYDAEGFFESYLAAPLWLVFYFGYMIYSRDFTFLT 552

Query: 525 KAEEADL 531
             ++ DL
Sbjct: 553 PLDKIDL 559

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  250 bits (639), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 166/566 (29%), Positives = 283/566 (50%), Gaps = 44/566 (7%)

Query: 6   VTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVR---------------- 49
           +T DS+ + ++ I +  N   S  S ++    +K  D K+   R                
Sbjct: 20  ITIDSEFLTQEPITIPSN--GSAVSIDETGSGSKWQDFKDSFKRVKPIEVDPNLSEAEKV 77

Query: 50  --------LKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFF 101
                   LK  LK RH+ MIAI                    PAS+LI +   G +++ 
Sbjct: 78  AIITAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYA 137

Query: 102 VMACLGEMATYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYW 160
           ++  LGE+A   P+ G FT+YATR+ D + G+A  + Y+ ++ ++ P ++ + ++ + +W
Sbjct: 138 MVMALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFW 197

Query: 161 IDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGG 220
                   G ++ +F + IVIIN  GV+ +GE EF  S  K++ + G I+   I+  GGG
Sbjct: 198 GTDPKYRDG-FVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGG 256

Query: 221 PNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAEN 280
           P    +G +YW +PGAF   +        KF    +VFV A F++ G EL G+ A+E+  
Sbjct: 257 PTGGYIGGKYWHDPGAFAGDTPG-----AKFKGVCSVFVTAAFSFAGSELVGLAASESVE 311

Query: 281 PRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNS 340
           PR+++P+A K   +RI LFYI+++ ++G+ V YND  L+            PFV+AI+  
Sbjct: 312 PRKSVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAAS--PFVIAIKTH 369

Query: 341 GVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXX 400
           G++ LP + NV +LI V S  NS +Y  +R++ +LA     P++F+  +R G P      
Sbjct: 370 GIKGLPSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAV 429

Query: 401 XXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFA 460
                  A++  S    ++FN+ + +  +  + +W  I I +I F +A  AQ    +  +
Sbjct: 430 TSAFGLIAFVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELS 489

Query: 461 YRAPFQPYGAYITLFFCVLIAFIKNFTVFI----GEFDYKSFITGYIGLPLYVIFYFGYK 516
           +++P   +G+Y  LF  V+I FI  F V +         + F   Y+  PL ++ Y G+K
Sbjct: 490 FKSPTGVWGSYWGLFM-VIIMFIAQFYVAVFPVGDSPSAEGFFEAYLSFPLVMVMYIGHK 548

Query: 517 IIYKTK---LVKAEEADLYSFKEAID 539
            IYK      + AE+ D+ + +  +D
Sbjct: 549 -IYKRNWKLFIPAEKMDIDTGRREVD 573

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  251 bits (640), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 148/502 (29%), Positives = 253/502 (50%), Gaps = 22/502 (4%)

Query: 49  RLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGE 108
           +LKK ++ RH+ M+++                    PA ++I Y+ +   ++ ++  +GE
Sbjct: 98  KLKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGYAIMASCIYCIIQAVGE 157

Query: 109 MA-TYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETV 166
           MA  Y+ L  GF +Y     DPAL F++ + Y  ++F + P +L   ++ IQYW  +  V
Sbjct: 158 MAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLELVTASMTIQYWTTK--V 215

Query: 167 NPGVWITIFLVVIVIINTVG-VRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDR 225
           N  +++ IF ++++ IN  G  R + E EF  +S KI++M G  +   +I+ GG  N   
Sbjct: 216 NADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFILGIVIICGGAGNDGF 275

Query: 226 LGFRYWKNPGAFKPYSESITGSKG--KFVSFVAVFVYALFAYLGIELTGIVAAEAENPRR 283
           +G +YW++PGAF+       GS G  +F   V+  V A F++   E   I A+E  NPR+
Sbjct: 276 IGGKYWRDPGAFR-------GSDGPNRFKGVVSTLVTAAFSFGQTEFLAITASEQSNPRK 328

Query: 284 NIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVR 343
            IP A K  +YR +L Y+ +I ++G+ V Y+   LL            P+V+A+   GVR
Sbjct: 329 AIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKAS--PYVLAVSTHGVR 386

Query: 344 ALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXX 403
            +PH  N  +LI VFS  +S  Y  +R L +LA  G APK+F   +R G P         
Sbjct: 387 VVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGRPSLGFLVGAV 446

Query: 404 XXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRA 463
               A+   SS   ++FN+ + +  +  + +W  I +++I F RA   Q    +   Y++
Sbjct: 447 IAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQGRSIDEIGYKS 506

Query: 464 PFQPYGAYITLFFCVLI----AFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIY 519
               +G+       +LI     ++    V  G  D ++F   Y+ +P++++ Y GYKI  
Sbjct: 507 QVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAFFQDYLAMPVFIVLYLGYKIWK 566

Query: 520 KT--KLVKAEEADLYSFKEAID 539
           +     ++A++ DL S +   D
Sbjct: 567 RDWRLFIRAKDIDLISHRHIHD 588

>Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}
           complement(18362..20104) [1743 nt, 581 aa]
          Length = 580

 Score =  249 bits (637), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 155/537 (28%), Positives = 270/537 (50%), Gaps = 14/537 (2%)

Query: 13  IREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXX 72
           + ED +D   ++ +S N+ + E++    +       +  ++L  RH+ +IAI        
Sbjct: 31  LSEDWLDRSDSSLTS-NTTQIEEEEVDSTTNLIYSTKTHRKLLNRHVQLIAISGVIGTAL 89

Query: 73  XXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRYCDPALG 131
                       PA +LIA++   I +  +     EM +++P+   F   A++  D +L 
Sbjct: 90  FVAIGKALYHGGPAFLLIAFALWCIPILCITVSTAEMVSFLPVASPFLRLASKCADESLA 149

Query: 132 FAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFG 191
               + + F   +  P ++ +   +I YW  R+  N  + + + +V+ + I+   V+Y+G
Sbjct: 150 VTASWNFWFLECVQIPFEIVSVNTIIHYW--RDDYNAAIPLVVQVVLYLFISIATVKYYG 207

Query: 192 EFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPY----SESITGS 247
           E EFWL+SFKI++  G+  F  + MLGG P HDR GFRYW     FK Y    + + T S
Sbjct: 208 EMEFWLASFKIILAIGLFFFTLVTMLGGNPKHDRYGFRYWGEE-PFKKYYPDNNTNGTDS 266

Query: 248 KGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLL 307
            G F  F+   + A F   G E   ++A E + PR+ +P+A K   +R+ + ++ T   L
Sbjct: 267 LGYFQGFLTCLIQAAFTIAGGEYISMLAGEIKLPRKVLPKAFKQVFWRLTIIFLGTCLCL 326

Query: 308 GMCVAYNDPRLLXXXXXXXXXX-XXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLY 366
           G+  + NDP L              PFV+A+ N  +R LP I N  ++   FSA N+  Y
Sbjct: 327 GIVCSPNDPSLTAAINEARPGAGSSPFVIAMNNLRIRVLPDIVNAALITSAFSAGNAYTY 386

Query: 367 VGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNV 426
             +R+LY +A+DG APK+F + N++GVP  A          + + ++S SA + N+ VN+
Sbjct: 387 CSSRTLYGMALDGYAPKIFTRCNKYGVPIYAVGVSLLWALISLLQLNSNSAIVLNWLVNL 446

Query: 427 VSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNF 486
           ++   +++++ + + Y+FF RA  AQ        +R+  QPY A   L     + FI+ +
Sbjct: 447 ITASQLINFVFLCVIYLFFRRAYNAQKDKLPPLPFRSWGQPYTAIFGLVCAFSMIFIQGY 506

Query: 487 TVFIGE-FDYKSFITGYIGLPLYVIFYFGYKIIY---KTKLVKAEEADLYSFKEAID 539
           TVFI   ++ + F+  Y+ + + V  Y GYK I+   K K +   + D  +  + I+
Sbjct: 507 TVFIHSLWNTRDFLFCYLMVFINVAIYLGYKFIWKRGKDKFIDPHKVDFITDLKEIE 563

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  250 bits (639), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 164/517 (31%), Positives = 258/517 (49%), Gaps = 19/517 (3%)

Query: 32  EQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIA 91
           E  D    + D   +  +L K L  RH+  +A+                    P SILIA
Sbjct: 91  EMTDVERAVCDAARNSSQLSKNLSIRHLLTLAVGGAIGTGLFVNSGASLNTGGPGSILIA 150

Query: 92  YSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQL 150
           ++ +   +F ++  LGE+A+  P+  GF  Y TR+ +P+ GFAV   YL ++ ++ P +L
Sbjct: 151 WTLISTCLFTIVNSLGELASAFPVVGGFNVYITRFVEPSFGFAVNISYLAQWAVLLPLEL 210

Query: 151 TAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVIL 210
            A ++ I+YW ++  +N   W+ IF V I + N + V+ FGE EF LS  KI+ +FG  +
Sbjct: 211 AAASITIKYWNNK--INSDAWVAIFYVCIALANMLDVKSFGETEFVLSMVKILAIFGFAI 268

Query: 211 FLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKG-KFVSFVAVFVYALFAYLGIE 269
              +++ GGGP    +G +YW +PGAF      +  + G +F    +VFV A F+Y G E
Sbjct: 269 LGTVLICGGGPVGGFIGAKYWHDPGAF------VGDTPGAQFKGLCSVFVTAAFSYSGTE 322

Query: 270 LTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXX 329
           L G+ AAE+ NPR  IPRA K + + I   Y++ + + G  V  NDPRLL          
Sbjct: 323 LVGVSAAESINPRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSNDPRLLNGMSSVDVAA 382

Query: 330 XXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTN 389
             P V+AI+N G+R +P + N  +LI + S  NS +Y  +R + S+A  G  PK+F   +
Sbjct: 383 S-PLVIAIENGGIRGVPSLMNAIILIAIISVANSSVYACSRCMVSMAQVGNLPKVFNYID 441

Query: 390 RWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRAC 449
           R G P  A          +++  S     IF +   +  +  +  W +I I++I F RA 
Sbjct: 442 RKGRPLVAILATLVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCWFAINISHIRFRRAM 501

Query: 450 IAQNVDRNSFAYRAPF----QPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGL 505
            AQ    +   Y +        YGA + LF  VL  +   F         +SF  GY+  
Sbjct: 502 CAQQRSLDELPYLSLTGVLGSWYGAAVLLFVLVLSFWTSLFPPGSSGPSAESFFEGYLSF 561

Query: 506 PLYVIFYFGYKIIYKTK---LVKAEEADLYSFKEAID 539
           P+++I Y  +K +YK      + A + D+ S + A+D
Sbjct: 562 PIFLICYISHK-LYKRDWRLFIPAGQIDVDSGRRALD 597

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  248 bits (634), Expect = 4e-74,   Method: Compositional matrix adjust.
 Identities = 167/536 (31%), Positives = 281/536 (52%), Gaps = 33/536 (6%)

Query: 14  REDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXX 73
           R ++++L+ N T          ++ KI+    +   LK+ LK RH+ MIAI         
Sbjct: 52  RMEVVELDPNLT----------EAEKIAIATANS-PLKRHLKNRHLQMIAIGGAIGTGLF 100

Query: 74  XXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRYCDPALGF 132
                      PA ILI ++  G +++ ++  +GE+A   P+ G FT+YATR+ D + G+
Sbjct: 101 VGSGKALRTAGPAGILIGWALTGTMIYCMVMAMGELAVTFPVSGGFTTYATRFIDESFGY 160

Query: 133 AVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGE 192
           A  + Y+ ++ ++ P ++ A ++ + YW        G ++ +F VVIV IN  GV+ +GE
Sbjct: 161 ANNFNYMLQWLVVLPLEIVAASITVNYWGTDPKYRDG-FVALFYVVIVSINMFGVKGYGE 219

Query: 193 FEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGK-F 251
            EF  S  K++ + G I+   I++ GGGP    +G   W NPGAF      +  + GK F
Sbjct: 220 AEFVFSFIKVITVIGFIILGIILVCGGGPVGGYIGGANWHNPGAF------VGNTAGKRF 273

Query: 252 VSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCV 311
               +VFV A F++ G EL G+ +AE  NPR+++PRA K   +RI LFYI+++ L+G+ V
Sbjct: 274 KGVCSVFVTAAFSFAGSELVGLASAETANPRKSLPRAAKQVFWRITLFYIISLCLIGLLV 333

Query: 312 AYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRS 371
            YND RL+            PFV+AI+N G++ LP + NV +LI V S  NS ++  +R+
Sbjct: 334 PYNDTRLIGASSVDAAAS--PFVLAIKNHGIKGLPSVVNVVILIAVLSVGNSAVFGCSRT 391

Query: 372 LYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFG 431
           L +LA  G  PK+F   +R G P             +++  S    ++F++ + +  +  
Sbjct: 392 LTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGLLSFIAASPKEGEVFDWLLALSGLSS 451

Query: 432 ILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIG 491
           + +W++I I ++ F RA  AQ    +  ++     P G + +++  VLI  I     +I 
Sbjct: 452 LFTWMAICICHLRFRRALSAQGRSTDELSF---VSPAGVWGSIYGTVLIMLILAAQFWIA 508

Query: 492 EF------DYKSFITGYIGLPLYVIFYFGYKIIYKT-KL-VKAEEADLYSFKEAID 539
            F      D K F   Y+ LP+ ++ Y G+K   +  KL ++AE  D+ + +  +D
Sbjct: 509 LFPIGSPPDAKDFFESYLSLPVVLVMYIGHKCYKRNWKLFIRAENIDIDTGRREVD 564

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  248 bits (634), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 163/532 (30%), Positives = 263/532 (49%), Gaps = 24/532 (4%)

Query: 18  IDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXX 77
           +D  K    + N  + ED +N I         LKK +K+RH+ M+++             
Sbjct: 49  VDSFKRAEVNHNGIDLEDGTNSIQSDDN----LKKAMKSRHVIMMSLGTGIGTGLLVANA 104

Query: 78  XXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL--DGFTSYATRYCDPALGFAVG 135
                  PAS++I Y  V  + +FV+   GEMA   P    GF +YA+ +     GFA  
Sbjct: 105 KGLYLAGPASLVIGYFMVSFITYFVIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATV 164

Query: 136 YCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEF 195
           + +  ++  + P +L   ++ I+YW D+  +N  V++ I  V ++ I+  GVR +GE EF
Sbjct: 165 WLFCIQWLTVLPLELITASMTIKYWNDK--INADVFVVILYVFLLFIHFFGVRAYGEAEF 222

Query: 196 WLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFV 255
             +S KI+++ G ++   ++  GG      +G +YW++PGAF   +     S+ K V+FV
Sbjct: 223 IFNSCKILMIGGFVILSIVVNCGGAGVDGYIGGKYWRDPGAF---ASDNAASRFKGVAFV 279

Query: 256 AVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYND 315
            V  Y  F+Y G+EL  +   E ENPRR+ P A K ++YRI++ Y++T+ L+G  V +N 
Sbjct: 280 LVTAY--FSYGGVELFALSVNEQENPRRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNS 337

Query: 316 PRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSL 375
            +L+            P+V+A+   GV+ +PHI N  +LI V S  NS LY   R L SL
Sbjct: 338 DQLMGAGGSATHAS--PYVLAVSIHGVKVVPHIINAVILISVTSVANSALYASPRLLRSL 395

Query: 376 AIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSW 435
           A  G APK F   +R G P  A          A+   S     IF +   +  +  + +W
Sbjct: 396 AEQGYAPKYFNYVDREGRPLRALILCSIFGVIAFCACSDQEEVIFTWLAAIAGLSELFTW 455

Query: 436 ISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI----- 490
            SIL++++ F  A  AQ    N   Y +    +G+    FF VL+ FI  F V +     
Sbjct: 456 SSILLSHVRFRLAMKAQGKSLNELGYISITGIWGSLYGCFFNVLV-FIAQFWVALSPPGS 514

Query: 491 -GEFDYKSFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADLYSFKEAID 539
            G +  ++F   Y+  P+++ FY GY +  +  T L   ++ DL + +   D
Sbjct: 515 KGVYSAEAFFESYLAFPVWLFFYLGYMLYSRDFTFLTDLKKIDLDNHRRLYD 566

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  249 bits (637), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 152/537 (28%), Positives = 262/537 (48%), Gaps = 21/537 (3%)

Query: 14  REDIIDLEKNTTSSLN-SFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXX 72
           +E    LE + T +   + E  +D  + ++       LK  +K RH+ MI++        
Sbjct: 86  KEQPSTLEHDLTKTFEGTLEPSEDGTQPAEVAGKSEELKHSIKPRHVIMISLGTGIGTGM 145

Query: 73  XXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIP--LDGFTSYATRYCDPAL 130
                       PA ++I Y+ +G  ++ ++   GEMA      + GF SY +   +PAL
Sbjct: 146 LVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQATGEMAVLYSKLIGGFNSYPSFLIEPAL 205

Query: 131 GFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVG-VRY 189
           GF+V + Y  ++  + P +L   ++ I+YW  +  V+P V++ IF V+I++IN +G    
Sbjct: 206 GFSVAWVYCIQWLCVCPLELVTASMTIKYWTTK--VDPDVFVVIFYVLIILINVLGGAAG 263

Query: 190 FGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKG 249
           + E EF+ +S KI+++ G  +   I++ GG  +   +G RYW +PGAF+        +  
Sbjct: 264 YAEAEFFFNSCKILMLLGFFILGIILICGGAGDDGYIGGRYWHDPGAFRGEH-----AID 318

Query: 250 KFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGM 309
           +F   V+  V A FA+   E+ G+ A+E  NPR+ IP A K  +YRI+  Y+ ++ ++G 
Sbjct: 319 RFKGVVSTLVNAAFAFGLSEMIGVTASEQSNPRKAIPSAAKKMIYRIVCIYLGSVVIVGF 378

Query: 310 CVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGT 369
            V +N  +LL            P+V+A+   GVR +PH  N  +L+ V S  NS  Y  +
Sbjct: 379 LVPWNSDQLLGSSGGGVKAS--PYVLAVSTHGVRVVPHFINAVILLSVLSVANSAFYSSS 436

Query: 370 RSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSI 429
           R L  LA  G APK+F   +R G P             ++   S    Q+F + + +  +
Sbjct: 437 RLLLGLAEQGYAPKIFKYVDREGRPTMGMCVAALVNVISFCATSPKEDQVFVWLLAISGL 496

Query: 430 FGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVF 489
             + +W +I +++I F RA   Q        +++    +G++      +LI  I  F V 
Sbjct: 497 SQLFTWSAICLSHIRFRRAMAVQGRSLGEIGFKSQCGVWGSWYAFIMMMLI-LIAQFWVA 555

Query: 490 I-----GEFDYKSFITGYIGLPLYVIFYFGYKIIYKT--KLVKAEEADLYSFKEAID 539
           I     G  D ++F   Y+  P+ +  YFGYKI  K     ++A++ DL   ++  D
Sbjct: 556 IAPIGEGRLDVQAFFENYLAAPILIALYFGYKIYTKDWRLFIRAKDIDLDINRDVFD 612

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  250 bits (638), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 157/529 (29%), Positives = 255/529 (48%), Gaps = 32/529 (6%)

Query: 24  TTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXX 83
           T S +    QE D N+          LKK +K RHI M+++                   
Sbjct: 125 TESGIKQPSQEQDQNQ--------ENLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNA 176

Query: 84  XPASILIAYSFVGILVFFVMACLGEMATYIP--LDGFTSYATRYCDPALGFAVGYCYLFK 141
            PA ++I Y+ +G  ++ ++   GE+A      + GF +Y +   DPALGF+V + Y  +
Sbjct: 177 GPAGLVIGYAIMGSCIYCIIQACGELAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQ 236

Query: 142 YFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFK 201
           +  + P +L   ++ I+YW  +  V+P V++ IF V+I++IN  G + + E +F+ +  K
Sbjct: 237 WLCVCPLELVTASMTIKYWTVK--VDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCK 294

Query: 202 IMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKG--KFVSFVAVFV 259
           I+++ G  +   II  GG      +G RYW NPGAF+       G+ G  +F   VA FV
Sbjct: 295 ILMIIGFFILAIIIDCGGAGTDGYIGSRYWHNPGAFR-------GNTGIQRFKGVVATFV 347

Query: 260 YALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLL 319
            A FA+   E   + A+E  NPR+ IP A K  +YRI+  ++ ++ L+G  V Y   +LL
Sbjct: 348 TAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLL 407

Query: 320 XXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDG 379
                       P+V+A+ + GVR +PH  N  +L+ V S  N   Y  +R L SLA  G
Sbjct: 408 GASGSATKAS--PYVIAVASHGVRVVPHFINAVILLSVLSVANGAFYSSSRILMSLAKQG 465

Query: 380 KAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISIL 439
            APK F   +R G P  A          A+   S     +F + + +  +  + +WI+I 
Sbjct: 466 NAPKCFDYIDREGRPAVAMLVSSIFGIIAFCASSPKEEDVFTWLLAISGLSQLFTWITIC 525

Query: 440 ITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI------GEF 493
           +++I F RA   Q        Y++    +G+   +   VL A I  F V I      G+ 
Sbjct: 526 LSHIRFRRAMKVQGRSLGEVGYKSQVGIWGSMYAIVMMVL-ALIAQFWVAISPIGGGGKL 584

Query: 494 DYKSFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADLYSFKEAIDR 540
             +SF   Y+ +P+ +  Y  YK+  K  T  + A++ DL + ++  D 
Sbjct: 585 SAQSFFENYLAMPILIALYVFYKVWKKDWTLFIPADKIDLVTDRQIFDE 633

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  248 bits (634), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 165/525 (31%), Positives = 259/525 (49%), Gaps = 23/525 (4%)

Query: 26  SSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXP 85
           S+      ED      D       LK+ +K RH+ MI++                    P
Sbjct: 63  STHERVSGEDFERLAPDDSSKHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGP 122

Query: 86  ASILIAYSFVGILVFFVMACLGEMAT-YIPLDG-FTSYATRYCDPALGFAVGYCYLFKYF 143
           AS+LI Y+ V  +++ V+    E+A  Y  L G F +Y     D A  F+V + Y  ++ 
Sbjct: 123 ASLLIGYAIVSTMLYCVIQSASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWL 182

Query: 144 IITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIM 203
            I P +L   ++ I+YW D  ++NP  ++ IF VV+++IN +G   + E EF+ ++ K++
Sbjct: 183 CILPLELVTASMTIKYWND--SINPDAFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKVL 240

Query: 204 VMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKG--KFVSFVAVFVYA 261
           ++ G  +   I+  GG  N   LG  YW +PGAF+       G+ G  +F   VAV V A
Sbjct: 241 MLIGFFILGIIVNCGGAGNDGYLGSVYWHDPGAFR-------GNNGINRFKGLVAVLVNA 293

Query: 262 LFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXX 321
            FAY G E + + AAE +NP+++I  A K  +YRII  Y++T  LLG  V YN P LL  
Sbjct: 294 AFAYGGAEFSVLTAAEQQNPQKSIRSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGS 353

Query: 322 XXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKA 381
                     PFV+AI + GV+ +PHI N  +L+ V S  NS LY  +R L SL+  G A
Sbjct: 354 GSAATHAS--PFVIAIASHGVKVVPHIINAVILLSVLSVANSALYSSSRILLSLSEQGFA 411

Query: 382 PKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILIT 441
           PKLF   +R G P              ++  S     +F + + +  +  + +W SI ++
Sbjct: 412 PKLFNYVDRRGRPVRCLLVSCVFGLLCFVAASPKEETVFTWLLAISGLSELFTWFSISLS 471

Query: 442 YIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIG-----EFDYK 496
           ++ F R+ I Q    +   Y++    +GAY  +   +LI  I  F V I      + D  
Sbjct: 472 HVRFRRSMIVQGRSLDELGYQSWTGVWGAYYAMIMILLI-LIGQFWVAISPVGSNKLDAN 530

Query: 497 SFITGYIGLPLYVIFYFGYKIIYKT--KLVKAEEADLYSFKEAID 539
           +F   Y+ +P+ +  Y GYK+ Y+    ++ A E DL S ++  D
Sbjct: 531 NFFENYLAMPILIGLYLGYKLWYRDWRVIIPANEVDLVSHRKIFD 575

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  248 bits (634), Expect = 6e-74,   Method: Compositional matrix adjust.
 Identities = 158/519 (30%), Positives = 264/519 (50%), Gaps = 16/519 (3%)

Query: 29  NSFEQEDDSNKISDGKEDG-VRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPAS 87
           +S  +++  + +     DG  ++ K+L  RH+  +A+                    PAS
Sbjct: 74  HSLTRDEAGSGVMKEDVDGHPQMNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPAS 133

Query: 88  ILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIIT 146
           ++I +  +   +F V+  LGE+A   P+  GF  Y TR+ DP+ GFAV   YL ++ ++ 
Sbjct: 134 LVIDWVIISTCLFTVVNSLGELAAAFPVVGGFNVYITRFIDPSFGFAVNINYLAQWLVLL 193

Query: 147 PNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMF 206
           P +L A ++ I+YW D+  +N   W+ IF   I   N + V+ FGE EF LS  KI+ + 
Sbjct: 194 PLELVAASITIRYWNDK--INSDAWVAIFYAAIAFANMLDVKSFGETEFILSMIKILAIV 251

Query: 207 GVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYL 266
           G  +   ++  GGGP    +G +YW +PGAF   +     S  KF    +VFV A F+Y 
Sbjct: 252 GFTILGIVLSCGGGPKGGYIGGKYWHDPGAFVGET-----SGTKFKGLCSVFVTAAFSYS 306

Query: 267 GIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXX 326
           G+ELT + AAE+ NPR  IP+A K T + I L Y+  + L+G  V YN+P+LL       
Sbjct: 307 GMELTAVSAAESLNPRETIPKAAKRTFWLITLSYVTILTLIGCLVPYNNPKLLNGSSSVD 366

Query: 327 XXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFA 386
                P V+AI+N G+R LP + N  +LI + S  NS +Y  +R + S+A     P+   
Sbjct: 367 AASS-PLVIAIENGGIRGLPSLMNAIILIAIVSVANSAVYACSRCMVSMARIRNLPRFLG 425

Query: 387 KTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFY 446
           + +R G P NA          +++  S    ++F +   +  +  I +W++I +++I F 
Sbjct: 426 RVDRKGRPLNATLLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFR 485

Query: 447 RACIAQNVDRNSFAYRAPFQPYGAY---ITLFFCVLIAFIKNFTVFIGE-FDYKSFITGY 502
           +A   Q +  +   Y +     G++   I LF  ++ +F  +     G+  D  SF  GY
Sbjct: 486 QAMAHQGISLDELPYISMTGVSGSWYGVIVLFLVLVASFWTSLFPLGGKGADATSFFEGY 545

Query: 503 IGLPLYVIFYFGYKIIYKTK--LVKAEEADLYSFKEAID 539
           +  P+ ++ Y G+K+  + K  L+   + DL S ++ +D
Sbjct: 546 LSFPILIVCYVGHKLYIRKKRLLIDVADMDLVSDRKVVD 584

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  248 bits (634), Expect = 7e-74,   Method: Compositional matrix adjust.
 Identities = 157/536 (29%), Positives = 267/536 (49%), Gaps = 32/536 (5%)

Query: 4   YEVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDS-------NKISDGKEDGV-------R 49
           ++++ + K+  E      +      +SF++ + S       N+ +   EDG+       +
Sbjct: 31  FQLSSNEKIYSEQKPKRNRLIHRFTDSFKRAEGSTTKIKPINENTSDLEDGIQSFTSDSK 90

Query: 50  LKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEM 109
           LKK +K+RH+ M+++                    PA+++I Y  V  + +F++   GEM
Sbjct: 91  LKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFITYFMIQAAGEM 150

Query: 110 ATYIPL--DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVN 167
           A   P     F +Y++ +     GFA  + Y F++  + P +L   ++ IQ+W D+  +N
Sbjct: 151 AVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLPLELITASMTIQFWNDK--IN 208

Query: 168 PGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLG 227
           P ++I IF V ++ ++  GV+ +GE EF  +  KI+++ G I+   +I  GG  N   +G
Sbjct: 209 PDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCKILMIAGFIVLSVVINCGGAGNDGYIG 268

Query: 228 FRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPR 287
             YW  PGAF   +     S  +F +   + V A F++ G+EL  +   E  NPR++ P 
Sbjct: 269 GAYWHKPGAFAGDT-----SIARFKNVCYILVTAYFSFGGMELFVLSVQEQTNPRKSTPV 323

Query: 288 AIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPH 347
           A K ++YRI++ Y++T+ L+G  V YND +LL            P+V+A    GVR +PH
Sbjct: 324 AAKRSIYRIVVIYLLTMILIGFNVPYNDDQLLGAGGSATHAS--PYVLAASIHGVRIVPH 381

Query: 348 IFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXX 407
           I N  +LI V S  NS LY G R + SLA  G APK     +R G P  A          
Sbjct: 382 IINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCVIGVI 441

Query: 408 AYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQP 467
           A++  SS    +F +   +  +  + +W SI+++++ F +A   Q    N   Y+A    
Sbjct: 442 AFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLNELGYKATTGI 501

Query: 468 YGAYITLFFCVLIAFIKNFTVFI------GEFDYKSFITGYIGLPLYVIFYFGYKI 517
           +G+    FF +L+ FI  F V +      G+ + ++F   Y+  P+++IFY GY I
Sbjct: 502 WGSIYGSFFNILV-FIAQFWVALAPLGNGGKCNAEAFFESYLAAPIWLIFYIGYMI 556

>Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON}
           YBR132C (REAL)
          Length = 598

 Score =  248 bits (633), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 145/498 (29%), Positives = 253/498 (50%), Gaps = 11/498 (2%)

Query: 32  EQEDDSNKISDGKED----GVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPAS 87
           E ED  + I +            +++L+ RH+ +IAI                    PAS
Sbjct: 64  EHEDGESFIDEDSRTHLLFSTETRRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPAS 123

Query: 88  ILIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIIT 146
           +L+A++   + +  +     EM  + P+   F   AT+  D +      + + F   +  
Sbjct: 124 LLLAFALWCVPILCITVSTAEMVCFFPVSSPFLRLATKCVDDSFAVMASWNFWFLECVQI 183

Query: 147 PNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMF 206
           P ++ +   +I YW  R+  + G+ + + +V+ ++I+   V+Y+GE EFWL+SFKI++  
Sbjct: 184 PFEIVSVNTIIHYW--RDDYSAGIPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILAL 241

Query: 207 GVILFLFIIMLGGGPNHDRLGFR-YWKNP-GAFKPYSESITGSKGKFVSFVAVFVYALFA 264
           G+ +F FI MLGG P HDR GFR Y ++P   + P  + +  S G F  F+A  + A F 
Sbjct: 242 GLFIFTFITMLGGNPKHDRYGFRNYGESPFKKYFPDGKDVGKSSGYFQGFLACLIQASFT 301

Query: 265 YLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXX 324
             G E   ++A E + PR+ +P+A K    R+   ++ +   +G+  + NDP L      
Sbjct: 302 IAGGEYISMLAGEVKRPRKVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINE 361

Query: 325 XXXXX-XXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPK 383
                   P+V+A+ N  +R LP I N+ ++   FSA N+  Y  +R+ Y +A+DG APK
Sbjct: 362 ARPGAGSSPYVIAMNNLKIRILPDIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPK 421

Query: 384 LFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYI 443
           LF + NR GVP  +          + + ++S SA + N+ +N+++   +++++ + ITY+
Sbjct: 422 LFTRCNRHGVPIYSVAISLVWALVSLLQLNSNSAVVLNWLINLITASQLINFVVLCITYL 481

Query: 444 FFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGE-FDYKSFITGY 502
           FF RA   Q        +R+  QPY A I L  C  +  I+ +TVF  + +  + F+  Y
Sbjct: 482 FFRRAYHVQQDSLPKLPFRSWGQPYTAIIGLVSCSAMILIQGYTVFFPKLWSTQDFLFSY 541

Query: 503 IGLPLYVIFYFGYKIIYK 520
           + + + +  Y GYK I+K
Sbjct: 542 LMVFINIGIYVGYKFIWK 559

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  248 bits (632), Expect = 8e-74,   Method: Compositional matrix adjust.
 Identities = 159/542 (29%), Positives = 272/542 (50%), Gaps = 32/542 (5%)

Query: 14  REDIIDLEKNTTSSLNSFEQEDDSNKISDGKE-----DGVRLKKELKARHISMIAIXXXX 68
           +E+   +EK     L    +E D   ++D ++        +L K+L  RH+  +A+    
Sbjct: 27  KEETWSVEKQ----LKPLAEEKDYADMNDVEKAIYNTKDSKLNKDLSIRHLLTLAVGGAI 82

Query: 69  XXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCD 127
                           PAS++IA++ +   +F ++  LGE++   P+  GF  Y TR+ +
Sbjct: 83  GTGLFVNSGDSLSTGGPASLVIAWTIISTCLFTIVNSLGELSATFPVVGGFNVYVTRFVE 142

Query: 128 PALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGV 187
           P+ GFAV + YL ++ I+ P +L A ++ I+YW   +++NP  W++IF V I   N + V
Sbjct: 143 PSFGFAVNFNYLAQWAILLPLELCAASITIRYW--NKSINPDAWVSIFYVAIAFANMLDV 200

Query: 188 RYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGS 247
           + FGE EF LS  KI+ + G  +   +++ GGGP+   +G +YW +PGAF   + +    
Sbjct: 201 KSFGETEFVLSMVKILAIIGFTILGIVLICGGGPSGGFIGGKYWNDPGAFVGDTPA---- 256

Query: 248 KGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLL 307
             +F    AVF+ A F+Y G+EL G+ AAE+ NPR  +P+A K T + I + Y+V + L+
Sbjct: 257 -QRFKGLSAVFITAAFSYSGLELVGVSAAESRNPRVTLPKAAKRTFWLITMSYLVILTLI 315

Query: 308 GMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYV 367
           G  V  NDP LL            P V+AIQN G++ LP + N  +LI + S  NS +Y 
Sbjct: 316 GCLVPSNDP-LLLNGTSSVDAAASPLVIAIQNGGIKGLPSLMNAIILIALLSVANSAVYA 374

Query: 368 GTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVV 427
            +R + S+A  G  P+  A  ++ G P  A          +++  S+   ++F +   + 
Sbjct: 375 CSRCIISMAEIGNLPRSLAHVDKKGRPLYAIAITLLVGLLSFIAASNKRDEVFTWLSALS 434

Query: 428 SIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFT 487
            +  +  W +I + ++ F  A   QN       Y +    +G++   + C++I  +   +
Sbjct: 435 GLSTLFCWFAINLAHLRFRHAMKHQNRSLEELPYVSMTGEWGSW---YGCIVIGLVLIAS 491

Query: 488 VFIGEF-------DYKSFITGYIGLPLYVIFYFGYKIIYKTKL---VKAEEADLYSFKEA 537
            +   F       D  SF   Y+ LP+++  Y G+K I+K  L   +K  E D+ S +  
Sbjct: 492 FWTSLFPAGGNGADATSFFESYLSLPIFIACYLGHK-IWKRNLRLYIKLSEVDVDSGRTD 550

Query: 538 ID 539
            D
Sbjct: 551 TD 552

>YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}
           AGP2High affinity polyamine permease, preferentially
           uses spermidine over putrescine; expression is
           down-regulated by osmotic stress; plasma membrane
           carnitine transporter, also functions as a low-affinity
           amino acid permease
          Length = 596

 Score =  248 bits (632), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 145/498 (29%), Positives = 253/498 (50%), Gaps = 11/498 (2%)

Query: 32  EQEDDSNKISDGKEDGV----RLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPAS 87
           E ED  + I D     +      +++L+ RH+ +IAI                    PAS
Sbjct: 62  EHEDRGSSIDDDSRTYLLYFTETRRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPAS 121

Query: 88  ILIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIIT 146
           +L+A++   + +  +     EM  + P+   F   AT+  D +L     + + F   +  
Sbjct: 122 LLLAFALWCVPILCITVSTAEMVCFFPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQI 181

Query: 147 PNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMF 206
           P ++ +   +I YW  R+  + G+ + + +V+ ++I+   V+Y+GE EFWL+SFKI++  
Sbjct: 182 PFEIVSVNTIIHYW--RDDYSAGIPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILAL 239

Query: 207 GVILFLFIIMLGGGPNHDRLGFR-YWKNP-GAFKPYSESITGSKGKFVSFVAVFVYALFA 264
           G+  F FI MLGG P HDR GFR Y ++P   + P    +  S G F  F+A  + A F 
Sbjct: 240 GLFTFTFITMLGGNPEHDRYGFRNYGESPFKKYFPDGNDVGKSSGYFQGFLACLIQASFT 299

Query: 265 YLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXX 324
             G E   ++A E + PR+ +P+A K    R+   ++ +   +G+  + NDP L      
Sbjct: 300 IAGGEYISMLAGEVKRPRKVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINE 359

Query: 325 XXXXX-XXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPK 383
                   P+V+A+ N  +R LP I N+ ++   FSA N+  Y  +R+ Y +A+DG APK
Sbjct: 360 ARPGAGSSPYVIAMNNLKIRILPDIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPK 419

Query: 384 LFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYI 443
           +F + NR GVP  +          + + ++S SA + N+ +N+++   +++++ + I Y+
Sbjct: 420 IFTRCNRHGVPIYSVAISLVWALVSLLQLNSNSAVVLNWLINLITASQLINFVVLCIVYL 479

Query: 444 FFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGE-FDYKSFITGY 502
           FF RA   Q        +R+  QPY A I L  C  +  I+ +TVF  + ++ + F+  Y
Sbjct: 480 FFRRAYHVQQDSLPKLPFRSWGQPYTAIIGLVSCSAMILIQGYTVFFPKLWNTQDFLFSY 539

Query: 503 IGLPLYVIFYFGYKIIYK 520
           + + + +  Y GYK I+K
Sbjct: 540 LMVFINIGIYVGYKFIWK 557

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  248 bits (632), Expect = 9e-74,   Method: Compositional matrix adjust.
 Identities = 158/533 (29%), Positives = 271/533 (50%), Gaps = 27/533 (5%)

Query: 14  REDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXX 73
           R ++ DL+ N T +        +   I+  +     L++ LK RH+ MIAI         
Sbjct: 55  RVELGDLDPNLTQA--------EKVAIATARSP---LQRHLKNRHLQMIAIGGAIGTGLF 103

Query: 74  XXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGF 132
                      PA++LI +  +G++++ V+  +GE+A   P+  GFT+Y  R+ D + GF
Sbjct: 104 VGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAMGELAVTFPVAGGFTTYIPRFVDDSFGF 163

Query: 133 AVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGE 192
           A+ Y Y+ ++ ++ P ++ A ++ + YW        G ++ +F VVIVIIN  GV+ +GE
Sbjct: 164 AINYIYMLQWLVVLPLEIVAASITVNYWGTPAKYRDG-FVALFYVVIVIINMFGVKGYGE 222

Query: 193 FEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFV 252
            EF  S  K+  + G I+   +++ GGGP    +G +YW NPGAF         +  +F 
Sbjct: 223 AEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYVGGKYWHNPGAFNG-----DNAGQRFK 277

Query: 253 SFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVA 312
           +  +VFV A F++ G EL G+ AAE ENPR+ +PRA K   +RI LFYI+++ L+G+ V 
Sbjct: 278 AVCSVFVTAAFSFAGTELVGLAAAETENPRKALPRAAKQVFWRITLFYIISLCLIGLLVP 337

Query: 313 YNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSL 372
           Y    L+            PFV+AI+  G+  LP + NV +LI V S  NS +Y  +R+L
Sbjct: 338 YTSENLIGSSSVDAAAS--PFVLAIKTHGISGLPSVINVVILISVLSVGNSSVYACSRTL 395

Query: 373 YSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGI 432
            +LA  G  P++F+  +R G P              ++  S     +FN+ + +  +  +
Sbjct: 396 SALADQGFLPQIFSYIDRKGRPLVGILATCTFGLLCFIAQSKKEGDVFNWLMALSGLSSL 455

Query: 433 LSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI-- 490
            +W  I I ++ F RA  AQ    +  A+ +    +G+Y  +    L+ FI  F + +  
Sbjct: 456 FTWGFICICHLRFRRALAAQGRSTDELAFTSYVGVWGSYFGVILICLV-FIAQFWIAVWP 514

Query: 491 --GEFDYKSFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADLYSFKEAID 539
             G  +   F   Y+ + + + FY  +K+  +  T   +A++ D+ + +  +D
Sbjct: 515 MGGTPNASDFFQAYLSVVVVLFFYLAHKLYTRNWTFAKRAKDIDIDTGRRELD 567

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  248 bits (633), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 166/555 (29%), Positives = 265/555 (47%), Gaps = 20/555 (3%)

Query: 21  EKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXX 80
           E N  S ++S  + +     S   +    LKK +K RH+ M+ +                
Sbjct: 64  EDNKHSEVDSDVERNGDAAYSVNTD--THLKKAMKTRHVIMMTLGTGIGTGLLVANAKGL 121

Query: 81  XXXXPASILIAYSFVGILVFFVMACLGEMATYIP-LDG-FTSYATRYCDPALGFAVGYCY 138
               PA+++I Y  V ++ + ++   GEMA   P L G F +YA+ +     GFA  + +
Sbjct: 122 HFGGPAALVIGYGLVSMVTYIMIQAAGEMAVAYPTLPGNFNTYASIFVSKPFGFATVWLF 181

Query: 139 LFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLS 198
             ++  + P +L   +L+I+YW   E VN  V++ IF V ++ I+ +GV+ +GE EF  +
Sbjct: 182 CIQWLTVLPLELITASLIIKYWT--EKVNADVFVVIFYVFLLFIHFIGVKAYGETEFVFN 239

Query: 199 SFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVF 258
             KI+++ G I+F  ++  GG  +   +G +YW +PGAF     + T +  +F     V 
Sbjct: 240 LCKILMIAGFIIFSIVVNCGGAGHDGYIGGKYWHSPGAF-----AGTNAAERFKGVCYVL 294

Query: 259 VYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRL 318
           V   F+Y G EL  +   E ENPR++ P A K ++YRI++ Y++T+ L+G  V +ND +L
Sbjct: 295 VSGYFSYGGTELYVLSVNEQENPRKSTPIAAKQSIYRILVIYLLTMILIGFTVPFNDDQL 354

Query: 319 LXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAID 378
           +            P+V+A    GVR +PHI N  +LI V S  NS LY   R L SLA  
Sbjct: 355 MGAGGSATHAS--PYVLAASIHGVRVVPHIINAVILIAVISVANSSLYAAPRLLCSLAEQ 412

Query: 379 GKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISI 438
           G APK     +R G P  A          A+   S    Q+F +   +  +  + +W SI
Sbjct: 413 GYAPKFMTYVDREGRPLYALLACAVFGVIAFSACSDQEEQVFTWLAAIAGLSELFTWSSI 472

Query: 439 LITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIG----EFD 494
           +++++ F +A   Q  D N   Y A    +G+   + F +L+ FI  F V +        
Sbjct: 473 MLSHVRFRQAMKLQGRDLNEVGYIANTGYWGSVYGVVFNILV-FIAQFWVALAPPKSPIT 531

Query: 495 YKSFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADLYSFKEAIDRXXXXXXXXXXXX 552
            +SF   Y+  P+++ FYFGY I  K  T L   ++ DL   +   D             
Sbjct: 532 AQSFFESYLAFPIWIAFYFGYMIWNKDYTFLNPLDKIDLDHHRRIYDPEVLKQEDMENKE 591

Query: 553 XXRLKNSKKSLKWFY 567
             R  N    LKWF+
Sbjct: 592 RVRNGNIWTKLKWFW 606

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  249 bits (636), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 158/544 (29%), Positives = 261/544 (47%), Gaps = 26/544 (4%)

Query: 7   TKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXX 66
           TKDS       +D E N  SS  + +    S +  + K++   LKK +K RH  M+++  
Sbjct: 108 TKDSS----SQLDNELNRKSSYITVDGIKQSPQEQEQKQE--NLKKSIKPRHTVMMSLGT 161

Query: 67  XXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIP--LDGFTSYATR 124
                             P  ++I Y+ +G  V+ ++   GE+A      + GF +Y   
Sbjct: 162 GIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLF 221

Query: 125 YCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINT 184
             DPALGF+V + +  ++  + P +L   ++ I+YW    +VNP V++ IF V+IV+IN 
Sbjct: 222 LVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWT--TSVNPDVFVVIFYVLIVVINV 279

Query: 185 VGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESI 244
            G + + E +F+ +  KI+++ G  +   II  GG      +G +YW++PGAF+  +   
Sbjct: 280 FGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGYIGSKYWRDPGAFRGDT--- 336

Query: 245 TGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTI 304
                +F   VA FV A FA+   E   + A+E  NPR+ IP A K  +YRI+  ++ ++
Sbjct: 337 --PIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASL 394

Query: 305 FLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSD 364
            L+G  V Y   +LL            P+V+A+ + GVR +PH  N  +L+ V S  N  
Sbjct: 395 TLVGFLVPYTSDQLLGAAGSATKAS--PYVIAVSSHGVRVVPHFINAVILLSVLSVANGA 452

Query: 365 LYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFV 424
            Y  +R L SLA  G APK F   +R G P  A          A+   S     +F + +
Sbjct: 453 FYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVIAFCASSKKEEDVFTWLL 512

Query: 425 NVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIK 484
            +  +  + +WI+I +++I F RA   Q        Y++    +G+   +   VL A I 
Sbjct: 513 AISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLMMVL-ALIA 571

Query: 485 NFTVFI------GEFDYKSFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADLYSFKE 536
            F V I      G+   +SF   Y+ +P+++  Y  YK+  K  +  + A++ DL S + 
Sbjct: 572 QFWVAIAPIGGGGKLSAQSFFENYLAMPIWIALYIFYKVWKKDWSLFIPADKVDLVSHRN 631

Query: 537 AIDR 540
             D 
Sbjct: 632 IFDE 635

>Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON}
           YBR132C (REAL)
          Length = 597

 Score =  247 bits (631), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 145/498 (29%), Positives = 252/498 (50%), Gaps = 11/498 (2%)

Query: 32  EQEDDSNKISDGKED----GVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPAS 87
           E ED  + I +            +++L+ RH+ +IAI                    PAS
Sbjct: 63  EHEDRGSSIDEDSRTHLLFSTETRRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPAS 122

Query: 88  ILIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIIT 146
           +L+A++   + +  +     EM  + P+   F   AT+  D +L     + + F   +  
Sbjct: 123 LLLAFALWCVPILCITVSTAEMVCFFPVSSPFLRLATKCVDDSLAVMASWNFWFLECVQI 182

Query: 147 PNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMF 206
           P ++ +   +I YW  R+  + G+ + + +V+ ++I+   V+Y+GE EFWL+SFKI++  
Sbjct: 183 PFEIVSVNTIIHYW--RDDYSAGIPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILAL 240

Query: 207 GVILFLFIIMLGGGPNHDRLGFR-YWKNP-GAFKPYSESITGSKGKFVSFVAVFVYALFA 264
           G+ +F FI MLGG P HDR GFR Y ++P   + P    +  S G F  F+A  + A F 
Sbjct: 241 GLFIFTFITMLGGNPRHDRYGFRNYGESPFKKYFPDGNDVGKSSGYFQGFLACLIQASFT 300

Query: 265 YLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXX 324
             G E   ++A E + PR+ +P+A K    R+   ++ +   +G+  + NDP L      
Sbjct: 301 IAGGEYISMLAGEVKRPRKVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINE 360

Query: 325 XXXXX-XXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPK 383
                   P+V+A+ N  +R LP I N+ ++   FSA N+  Y  +R+ Y +A+DG APK
Sbjct: 361 ARPGAGSSPYVIAMNNLKIRILPDIVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPK 420

Query: 384 LFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYI 443
           LF + NR GVP  +          + + ++S SA + N+ +N+++   +++++ + I Y+
Sbjct: 421 LFTRCNRHGVPIYSVGISLIWALVSLLQLNSNSAVVLNWLINLITASQLINFVVLCIIYL 480

Query: 444 FFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGE-FDYKSFITGY 502
           FF RA   Q        +R+  QPY A I L  C  +  I+ +TVF  + +  + F+  Y
Sbjct: 481 FFRRAYRVQQDSLPRLPFRSWGQPYTAIIGLVSCSAMILIQGYTVFFPKLWSTQDFLFSY 540

Query: 503 IGLPLYVIFYFGYKIIYK 520
           + + + +  Y GYK I+K
Sbjct: 541 LMVFINIGIYVGYKFIWK 558

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  247 bits (630), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 157/527 (29%), Positives = 259/527 (49%), Gaps = 26/527 (4%)

Query: 20  LEKNTTSSLNSFEQEDDSNKISD-GKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXX 78
           L+      L+SF+++   ++ S+   ++   L K +K+RH+ MI++              
Sbjct: 59  LQNECKKILSSFKRQLPPSQNSELESQEKNNLTKSIKSRHLVMISLGTGIGTGLLVGNGQ 118

Query: 79  XXXXXXPASILIAYSFVGILVFFVMACLGEMA-TYIPLDG-FTSYATRYCDPALGFAVGY 136
                 PA +++ Y    I+++ ++   GE+   Y  L G +T Y +   DP+LGFAV  
Sbjct: 119 VLGTAGPAGLVLGYGVASIMLYCIIQAAGELGLCYAGLTGNYTRYPSILVDPSLGFAVSV 178

Query: 137 CYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFW 196
            Y  ++  + P QL   A+ ++YW    +VN  +++ +  + ++IIN  G R + E EF 
Sbjct: 179 VYTIQWLTVLPLQLVTAAMTVKYWT---SVNSDIFVAVVFIFVIIINLFGSRGYAEAEFI 235

Query: 197 LSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVA 256
            +  KI+++ G ++   II  GG  +   +G  YW NPG F        G KG       
Sbjct: 236 FNICKILMVIGFVILAIIINCGGAGDRKYIGTEYWHNPGPFA------HGFKG----VCT 285

Query: 257 VFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDP 316
           VF YA F+Y GIE+  + AAE ENP ++IP A K  +YRI+L Y++T  L+   V YN  
Sbjct: 286 VFCYAAFSYGGIEVLLLSAAEQENPTKSIPNACKKVVYRILLIYMLTTILVCFLVPYNSD 345

Query: 317 RLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLA 376
            LL            PFV+A+ + GV+ +PH  N  +LI V S  NS LY G R L SLA
Sbjct: 346 ELLGSDDSSGSHAS-PFVIAVASHGVKVVPHFINAVILISVISVANSSLYSGPRLLLSLA 404

Query: 377 IDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWI 436
             G  PK  A  +R G P              ++  S    ++F + + + S+  +  W+
Sbjct: 405 EQGVLPKCLAYVDRRGRPLLCFLVSLAFGCIGFVATSDAEEEVFTWLLAISSLSQLFIWM 464

Query: 437 SILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI------ 490
           S+ +++I F  A   Q    N   Y+A    +G+++ +   V    +  F V I      
Sbjct: 465 SMSLSHIRFRDAMAKQGRSMNEVGYKAQTGYWGSWLAVLIAVFF-LVCQFWVAIAPVNDH 523

Query: 491 GEFDYKSFITGYIGLPLYVIFYFGYKIIYKTK--LVKAEEADLYSFK 535
           G+ + K F   Y+ +P+ ++ YFG+KI +K+    + A++ DL S +
Sbjct: 524 GKLNVKVFFQNYLAMPIVLVAYFGHKIYFKSWSFWIPADKIDLNSHR 570

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  246 bits (628), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 164/548 (29%), Positives = 272/548 (49%), Gaps = 34/548 (6%)

Query: 7   TKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKIS-DGKEDGVRLKKELKARHISMIAIX 65
           TK SK   +DI +   +     N F++  DS K   DG      LK+ LKARH+ MIAI 
Sbjct: 42  TKQSK-DDDDIAEGHSSYQPPRNIFQRCIDSFKPPLDGSFHTHNLKRTLKARHLIMIAIG 100

Query: 66  XXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYATR 124
                              P +++I +S  G  +   +  LGE+    P+ G F +Y+TR
Sbjct: 101 GSIGTGLFIGSGQALASGGPLALIIGWSIAGTQIVGTIHGLGEITVRFPVVGAFANYSTR 160

Query: 125 YCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINT 184
           + DP++ F +   Y+ ++F + P ++ A A+ IQYW   ++++P VW+ IF  VIV IN 
Sbjct: 161 FLDPSISFVISTIYVIQWFFVLPLEIIASAMTIQYW--NQSIDPVVWVAIFYCVIVSINL 218

Query: 185 VGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESI 244
            G R FGE EF  SS K++ + G I+   +++ GGGP+HD +G RYW +PG         
Sbjct: 219 FGARGFGEAEFLFSSIKVITIIGFIILCIVLICGGGPDHDFVGARYWHDPGCL------- 271

Query: 245 TGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTI 304
             S G F   ++V V A ++  G E+  + + E  NPR  +P AIK T +RI+ F+++++
Sbjct: 272 --SHG-FPGVLSVLVVASYSLGGTEMVCLASGET-NPRE-LPSAIKQTFWRILFFFLISL 326

Query: 305 FLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSD 364
            L+G  V Y +P LL            PFV+AI+   ++ALP I N  +LI + S  NS 
Sbjct: 327 TLIGFLVPYTNPNLL----GGSSVNNSPFVIAIKLHHIKALPSIVNAVILISIMSVGNSC 382

Query: 365 LYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFV 424
           ++  +R+L S+A  G  PK F   +R G P             A++  SS   ++F++ +
Sbjct: 383 IFASSRTLCSMAHQGLIPKFFGYIDRAGRPLTGILTNSLFGLLAFLVKSSSMGEVFDWLM 442

Query: 425 NVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIK 484
            +  +   + W+SI I++I F  A  AQ    +   + +    +G+  +     LI   +
Sbjct: 443 AIAGLATCIVWLSINISHIRFRLAMKAQGKSLDELEFVSAVGMWGSAYSALINSLILIAQ 502

Query: 485 NFTVF--IGEFD-----YKSFITGYIGLPLYVIFYFGYKIIYKTK------LVKAEEADL 531
            +     IG +       K+F   Y+   +    +  +K+ Y+ K      ++  ++ DL
Sbjct: 503 FYCALWPIGGWKDSSERAKTFFQSYLCALIMAFLFVCHKVFYRYKTGKWWAIMDLDKIDL 562

Query: 532 YSFKEAID 539
            + ++ ID
Sbjct: 563 ETDRKNID 570

>Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON}
           YBR132C (REAL)
          Length = 590

 Score =  246 bits (628), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 141/506 (27%), Positives = 258/506 (50%), Gaps = 12/506 (2%)

Query: 32  EQEDDSNKISDGKED---GVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASI 88
            ++ +++   D + +       +++L+ RH+ +IAI                    PAS+
Sbjct: 57  HEDGETSTDEDSRTNLLFSTETRRKLENRHVQLIAISGVIGTALFVAIGKALYRGGPASL 116

Query: 89  LIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITP 147
           L+A++   + +  +     EM  + P+   F   AT+  D +L     + + F   +  P
Sbjct: 117 LLAFALWCVPILCITVSTAEMVCFFPVSSPFLRLATKCVDESLAVMASWNFWFLECVQIP 176

Query: 148 NQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFG 207
            ++ +   +I YW  R+  + G+ + + +V+ ++I+   V+Y+GE EFWL+SFKI++  G
Sbjct: 177 FEIVSVNTIIHYW--RDDYSAGIPLAVQVVLYLLISICAVKYYGEMEFWLASFKIILALG 234

Query: 208 VILFLFIIMLGGGPNHDRLGFRYWKNPGAFK---PYSESITGSKGKFVSFVAVFVYALFA 264
           + +F F+ MLGG P HDR GFRY+     FK   P  + +  S G F  F+A  + A F 
Sbjct: 235 LFIFTFVTMLGGNPKHDRYGFRYYGE-SPFKQYFPDGKDVGKSSGYFQGFLACLIQASFT 293

Query: 265 YLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXX 324
             G E   ++A E + PR+ +P+A K    R+   ++ +   +G+  + NDP L      
Sbjct: 294 IAGGEYISMLAGEVKRPRKVLPKAFKQVFVRLTFLFLGSCLCVGIVCSPNDPDLTAAINE 353

Query: 325 XXXXX-XXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPK 383
                   P+V+A+ N  +R LP + N+ ++   FSA N+  Y  +R+ Y +A+DG APK
Sbjct: 354 ARPGAGSSPYVIAMNNMKIRILPDVVNIALITAAFSAGNAYTYCSSRTFYGMALDGYAPK 413

Query: 384 LFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYI 443
           +F K N+ GVP  A          + + ++S SA + N+ +N+++   +++++ + I Y+
Sbjct: 414 IFTKCNKHGVPIYAVGISLIWALVSLLQLNSNSAVVLNWLINLITASQLINFVVLCIIYL 473

Query: 444 FFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGE-FDYKSFITGY 502
           FF R    Q        +R+  QPY A I L  C+ +  I+ +TVF  + ++ + F+  Y
Sbjct: 474 FFRRTYSIQQDSLPKLPFRSWGQPYTAIIGLVSCLAMIMIQGYTVFFPKLWNSQDFLFSY 533

Query: 503 IGLPLYVIFYFGYKIIYKTKLVKAEE 528
           + + + +  Y GYK I+K    K ++
Sbjct: 534 LMVFIDIGIYVGYKFIWKRGKDKVKD 559

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  246 bits (629), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 154/503 (30%), Positives = 255/503 (50%), Gaps = 24/503 (4%)

Query: 49  RLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGE 108
           +LKK ++ RH+ MI +                    PA ++I Y+ +   ++ VM  +GE
Sbjct: 98  KLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMSTCIYCVMQAVGE 157

Query: 109 MA-TYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETV 166
           MA  Y+ L  GF++Y     DP L FAV + Y  ++F + P +L   ++ IQYW  +  V
Sbjct: 158 MAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTASMTIQYWTTK--V 215

Query: 167 NPGVWITIFLVVIVIINTVG-VRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDR 225
           N  +++ IF ++++ IN  G  R + E EF+ +  KI++M G  +   I++ GG  N   
Sbjct: 216 NADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIILICGGAGNSGF 275

Query: 226 LGFRYWKNPGAFKPYSESITGSKG--KFVSFVAVFVYALFAYLGIELTGIVAAEAENPRR 283
           +G RYW +PGAF+       G  G  +F   V+  V A FA+ G E   I A+E  NPR+
Sbjct: 276 IGARYWHSPGAFR-------GDNGINRFKGIVSTLVTAAFAFGGTEFLAITASEQANPRK 328

Query: 284 NIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVR 343
            IP A K  +YR ++ Y+ +I ++G  V YN   LL            P+V+A+ + G+R
Sbjct: 329 AIPSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELL--GSSGPATKASPYVIAVASHGIR 386

Query: 344 ALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXX 403
            +PH  N  +LI VFS  +S  Y  +R L +LA  G APK+F   ++ G P         
Sbjct: 387 VVPHFINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLGFVVGAI 446

Query: 404 XXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRA 463
               ++   SS  A +FN+ +++  +  + +W  I +++I F RA   Q    +   +++
Sbjct: 447 IAIISFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLDEIGFKS 506

Query: 464 PFQPYGAYITLFFCVLIAFIKNFTVFI---GE--FDYKSFITGYIGLPLYVIFYFGYKII 518
               +G+ +  F  +++  I  F V I   GE   D  SF   Y+ +P++++ YFGYKI 
Sbjct: 507 QAGVWGS-VYAFVMMILVLIGQFWVGIVPVGEDSADAVSFFQAYLAMPVFIVLYFGYKIW 565

Query: 519 YKT--KLVKAEEADLYSFKEAID 539
            +     ++A+  DL + +   D
Sbjct: 566 NRDWRLFIRAKNIDLIAHRHIYD 588

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  246 bits (627), Expect = 4e-73,   Method: Compositional matrix adjust.
 Identities = 160/549 (29%), Positives = 268/549 (48%), Gaps = 28/549 (5%)

Query: 9   DSKLIR--EDIIDLEKNTTSSLNSFEQEDDSNKISDGKED------GVRLKKELKARHIS 60
            SKLI   +D +D  K    + N +E E   N+I++ K D        +L+K ++ RH+ 
Sbjct: 33  HSKLIENLKDFVDSFKKIDDNNNQYEIEK--NEINNIKSDQFNDKLNNQLQKTIQPRHVI 90

Query: 61  MIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMA-TYIPL-DGF 118
           MI++                    PA +LI Y  +   ++ ++   GEMA  Y+ L  GF
Sbjct: 91  MISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQACGEMAVNYLTLIGGF 150

Query: 119 TSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVV 178
            +Y +   D A  FAV + Y  ++  + P +L   ++ I+YW   E V+P V++TIF ++
Sbjct: 151 NNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYW--NEKVDPDVFVTIFYLL 208

Query: 179 IVIINTVG-VRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAF 237
           I+ IN  G  R + E EF+ +  KI+++ G  +   I++ GG      +G  YW NPGAF
Sbjct: 209 IIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAGTSGYIGVSYWNNPGAF 268

Query: 238 KPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRII 297
           + ++        +F   V+  V A F++   E   I A+E  NPR+ IP A K  +YR +
Sbjct: 269 RGHTPGT-----RFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAIPSAAKKVIYRAL 323

Query: 298 LFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFV 357
             Y+ +I ++G  V YN P LL            P+V+A+ + G+R  PH  N  +LI V
Sbjct: 324 FIYVGSIIIVGFLVPYNSPELLGSKSSQTKAS--PYVIAVASHGIRIAPHFINAVILISV 381

Query: 358 FSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSA 417
            S  NS  Y  +R L +LA  G APK+F   +R G P             A+   S    
Sbjct: 382 LSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATIAFCASSPKET 441

Query: 418 QIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGA--YITLF 475
           ++F++ + +  +  + +W +I +++I F RA   Q    N   Y++    +G+    T+ 
Sbjct: 442 EVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGVWGSIYAATVM 501

Query: 476 FCVLIA--FIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADL 531
           F +LI   ++  + +     +  +F   Y+ +P+ ++FYFGYK   K     ++A++ DL
Sbjct: 502 FLILIGQFWVALWPLNSNGANITNFFKEYLAMPILLLFYFGYKTWKKDWNLFIRAKDIDL 561

Query: 532 YSFKEAIDR 540
            S +   D 
Sbjct: 562 ISHRHIYDE 570

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  246 bits (629), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 162/519 (31%), Positives = 253/519 (48%), Gaps = 31/519 (5%)

Query: 28  LNSFEQEDDSNKISDGK--EDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXP 85
           ++SF+++   N   DG+  E   +L K +K RHI MI++                    P
Sbjct: 85  VDSFKRQKVRN---DGEFAETETQLNKTMKPRHIVMISLGTGIGTGLLVGNGQVLSKSGP 141

Query: 86  ASILIAYSFVGILVFFVMACLGEMA-TYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYF 143
           A ++I Y    I+++ V+   GE+   Y  L G +T+Y T   DPA+GFAV   Y  ++ 
Sbjct: 142 AGLVIGYGVASIMIYCVVQAAGELGLVYSRLTGNYTTYPTYLIDPAVGFAVSMLYTLQWL 201

Query: 144 IITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIM 203
            + P QL   A+ I+YW     VNP +++   LV+++ IN  G + + E EF+ +  K++
Sbjct: 202 TVLPLQLVTAAMTIRYWT--TNVNPDIFVAAILVLVIAINMFGAKGYAEAEFFCNCCKLL 259

Query: 204 VMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALF 263
           +M G ++   +I  GG  + + +G +YW+ PGAF        G KG      AVF YA F
Sbjct: 260 MMAGFVILGIVINCGGAGDKEYIGVKYWQTPGAFA------NGFKG----VAAVFCYAAF 309

Query: 264 AYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXX 323
           +Y GIE+  + A E  NPR+ IP A +  +YR++  Y++T  ++   V YN P LL    
Sbjct: 310 SYGGIEVLVLTANEQANPRKAIPDACRKVVYRVLFLYMLTTIIVCFLVPYNSPALLGSNN 369

Query: 324 XXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPK 383
                   PFV+A+ + GV+ +PHI N  +LI V S  NS LY G R L SL+  G APK
Sbjct: 370 DGSGSDASPFVIAVASHGVQVVPHIINAAILISVISVANSSLYSGPRLLLSLSQQGYAPK 429

Query: 384 LFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYI 443
            F   +R G P             A++       ++F + + V  +  I  W+SI I+++
Sbjct: 430 CFNYIDRRGRPIICVLVSVAMGLIAFLAAIPAREEVFTWLLAVSGLSQIFIWMSITISHL 489

Query: 444 FFYRACIAQNVD---RNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI------GEFD 494
            F  A  +Q      R+   Y A     G+ + L   + I  +  F V I      G+ D
Sbjct: 490 RFRDAIRSQLGGLRARDVVEYTAQTGYVGSLVALAISIFI-LVCQFWVAIAPLGHNGQLD 548

Query: 495 YKSFITGYIGLPLYVIFYFGYKIIYKT--KLVKAEEADL 531
            + F   Y+  P+ +  Y  YKI ++     + A E DL
Sbjct: 549 VQIFFENYLAAPVLLGGYLAYKIWHRDWRLCIPANEIDL 587

>Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON}
           (44303..46144) [1842 nt, 614 aa]
          Length = 613

 Score =  246 bits (627), Expect = 6e-73,   Method: Compositional matrix adjust.
 Identities = 164/518 (31%), Positives = 258/518 (49%), Gaps = 23/518 (4%)

Query: 28  LNSFEQEDDSNKISDGKEDG-----VRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXX 82
           ++S+++ +   +  DG EDG     + LKK++K RH+ M+++                  
Sbjct: 68  IDSYKRAEHPREHIDGFEDGESKDGIHLKKQMKTRHVVMMSLGTGIGTGLLIANAKGLHF 127

Query: 83  XXPASILIAYSFVGILVFFVMACLGEMATYIP-LDG-FTSYATRYCDPALGFAVGYCYLF 140
             PA ++I Y  V  + +F++   GE+A   P L G F SY         GFA  +    
Sbjct: 128 AGPAPLVIGYGMVSFVTYFMIQAAGELAVAYPTLPGNFNSYFGILISKPFGFATVWLAAV 187

Query: 141 KYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSF 200
           ++  + P +  A +L I+YW DR  ++  V++ IF V ++ I+ VGVR +GE EF  +  
Sbjct: 188 QWLTVLPLEFIAASLTIKYWNDR--ISGDVFVVIFYVFLLFIHFVGVRAYGETEFIFNLC 245

Query: 201 KIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVY 260
           K++++ G I+   +I  GG  N   +G +YW +PGAF   +    GS+ K V ++ V  Y
Sbjct: 246 KVLMIIGFIILSIVINAGGAGNDGYIGGKYWNDPGAF---AGETAGSRFKGVCYILVTGY 302

Query: 261 ALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLX 320
             F+Y G EL  +   E ENPR++ P+A K ++YRI++ Y++T+ L+G  V YNDPRL+ 
Sbjct: 303 --FSYGGTELFVLSVNEQENPRKSTPQAAKHSIYRIVIIYLLTMILIGFNVPYNDPRLM- 359

Query: 321 XXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGK 380
                      P+V+A    GV+ +PH  N  VLI + S  NS LY   R + SLA  G 
Sbjct: 360 GADDASGSHASPYVLAASIHGVKIVPHFINAVVLIALISVGNSALYAAPRMMVSLAEQGF 419

Query: 381 APKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILI 440
           APK+ A  +R G P  +           +   SS   Q+F +   +  +  + +W +  I
Sbjct: 420 APKIMAYVDREGRPLVSLGICALFGLIGFAASSSKEEQVFTWLAAIAGLSELFTWSAFFI 479

Query: 441 TYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYK---- 496
           ++I F  A   Q  D     + A    YG++  LFF +L+ F   F V +     K    
Sbjct: 480 SHIRFRWAMKLQGKDIKEVGFLASTGLYGSFYGLFFNILV-FAAQFWVALSPIGSKKVGA 538

Query: 497 -SFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADL 531
            SF   Y+  P+++ FYFGY +  K  T L   E  DL
Sbjct: 539 ESFFESYLAFPIWLFFYFGYMVWAKDFTFLNPLESIDL 576

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  245 bits (625), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 159/535 (29%), Positives = 266/535 (49%), Gaps = 32/535 (5%)

Query: 18  IDLEKNTTSSL-----NSFEQEDDS--NKISDGKE---DGVRLKKELKARHISMIAIXXX 67
           +D  + + S L     +SF++  DS  N + DG +   D   LKK +K+RH+ M+ +   
Sbjct: 33  LDATEESRSGLVHRFVDSFKRAQDSTENDLEDGTKPLGDASHLKKAMKSRHVIMMCVGTG 92

Query: 68  XXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIP-LDG-FTSYATRY 125
                            P S++I Y  V  + +F++   GEMA   P L G F SY + +
Sbjct: 93  IGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNSYTSMF 152

Query: 126 CDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTV 185
                GFA  + +  ++  + P +L   +L I+YW D+  +N  V+I IF V ++ I+  
Sbjct: 153 ISKPFGFATVWLFFIQWLTVFPLELITASLTIKYWNDK--INADVFIVIFYVFLLFIHFF 210

Query: 186 GVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESIT 245
           GV+ +GE EF  +S K++++ G I+   +I  GG      +G +YW++PG+F        
Sbjct: 211 GVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKDGYIGAKYWRDPGSFAE-----G 265

Query: 246 GSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIF 305
            S  KF     + V A F+Y G EL  +   E ENPR++ P+A K ++YRI++ Y++T+ 
Sbjct: 266 DSVEKFKGICYILVTAYFSYGGAELFSLSVNEQENPRKSTPQAAKQSIYRILIIYLLTMI 325

Query: 306 LLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDL 365
           L+G  V +N+ +L+            P+V+A    GV+ +PH  N  +LI V S  NS L
Sbjct: 326 LIGFNVPHNNDQLMGSGGSATHAS--PYVLAASIHGVKVVPHFINAVILISVISVANSAL 383

Query: 366 YVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVN 425
           Y   R + SLA  G APK     +R G P  A           +++ SS   ++F +   
Sbjct: 384 YASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAVFGVIGFVSASSKEEEVFTWLAA 443

Query: 426 VVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKN 485
           +  +  + +W  I+++++ F +             +RA    +G+   + F +L+ FI  
Sbjct: 444 IAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFRAVTGIWGSMYGISFNMLV-FIAQ 502

Query: 486 FTVFI------GEFDYKSFITGYIGLPLYVIFYFGYKIIYK---TKLVKAEEADL 531
           F V +      G+ D +SF   Y+  P+++ FYFGY ++YK   T LV  ++ DL
Sbjct: 503 FWVALAPPSLHGKVDAESFFQSYLAAPIWLFFYFGY-MLYKRDFTFLVPLDKIDL 556

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  244 bits (624), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 157/538 (29%), Positives = 270/538 (50%), Gaps = 17/538 (3%)

Query: 9   DSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXX 68
           DS   R D    +  + S   + E  D +++  + ++   R  K+L  RH+  +A+    
Sbjct: 33  DSADDRADSKQKDLMSGSETKALENLDSTSQ--EVEDQDARYNKDLSVRHLLTLAVGGAI 90

Query: 69  XXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYATRYCD 127
                           P S++I +  +   +F ++  LGE+++  P+  GF  Y +R+ +
Sbjct: 91  GTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVVGGFNVYISRFVE 150

Query: 128 PALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGV 187
           P+ GFAV   YL ++ ++ P +L A +L I+YW    T+N   W+ IF  +I++ N + V
Sbjct: 151 PSFGFAVNLNYLAQWAVLLPLELVAASLTIRYW--NHTINSDAWVAIFYTIILLANLLDV 208

Query: 188 RYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGS 247
           + FGE EF LS  KI+ + G  +   ++  GGGP    +G +YW NPGAF  ++     +
Sbjct: 209 KSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPKGGYIGGKYWSNPGAFVGHT-----A 263

Query: 248 KGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLL 307
             +F    +VFV A F+Y G EL  + AAE+ NPR  +P+A K T + I + YIV + L+
Sbjct: 264 GDRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLITVCYIVVLTLV 323

Query: 308 GMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYV 367
           G  V+ +DPRLL            P V+AI+N G++ LP + N  +LI V S  NS +Y 
Sbjct: 324 GCLVSSDDPRLL-NGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIAVLSVANSAVYA 382

Query: 368 GTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVV 427
            +R + S+A  G  PK+F   +R G P  A          +++  S    ++F +   + 
Sbjct: 383 CSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLLSFIAASDKQEEVFTWLSALS 442

Query: 428 SIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAY---ITLFFCVLIAFIK 484
            +  +  W +I +++I F R    +    +   + +    +G+Y   I +F  +++ F  
Sbjct: 443 GLSTLFCWFAINVSHIRFRRTMKERGRTLDELPFVSMTGVWGSYYGCIVIFIVLVVCFWT 502

Query: 485 NFTVFIGE-FDYKSFITGYIGLPLYVIFYFGYKIIYKT--KLVKAEEADLYSFKEAID 539
           +     GE  + +SF   Y+  P+ +  YFG+K+  ++   L   +E DL S + A+D
Sbjct: 503 SLFPGGGEGANAESFFETYLSFPILLACYFGHKLYTRSWRLLTPTKEIDLDSGRRAVD 560

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  244 bits (624), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 146/501 (29%), Positives = 261/501 (52%), Gaps = 28/501 (5%)

Query: 50  LKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEM 109
           LK+ LK RH+ MIAI                    PA++++A+   G +V+ V+  +GE+
Sbjct: 84  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAIGEL 143

Query: 110 ATYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYW-IDRETVN 167
              +P+ G + SY +R+ DP+ GFA+ Y YL    +  P ++ A ++ + YW +D +  +
Sbjct: 144 CVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYAD 203

Query: 168 PGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDR-L 226
              ++ +F V +++IN +GV+ +GE EF  S  K++ + G I+   +++ GGG N+   +
Sbjct: 204 G--FVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYI 261

Query: 227 GFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIP 286
           G +YW NPG F        G KG    F A+FV + F++ G E+  + AAE++NPRR++P
Sbjct: 262 GTKYWHNPGGFA------HGFKG----FAAIFVTSAFSFSGSEMFALGAAESKNPRRDLP 311

Query: 287 RAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALP 346
           +A K   +RI LFY++++ L+G  V Y +  L             PFV+AI+ +G+  LP
Sbjct: 312 KAAKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASAS--PFVIAIKEAGISGLP 369

Query: 347 HIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXX 406
            + NV +L+ V S  N+ ++  +R+  SLA  G  PK FA  +R G P            
Sbjct: 370 SVINVVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGL 429

Query: 407 XAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQ 466
            ++++ S     +F + + V  +    +W SI + ++ F +   AQ    +  A++A   
Sbjct: 430 LSFLSSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQTG 489

Query: 467 PYGAYITLFFCVLIAFIKNFTVFIGEFDYKS------FITGYIGLPLYVIFYFGYKIIYK 520
            +G   +++   LI+ +  F  ++  F          F   Y+ LP+ ++FY G+K+  +
Sbjct: 490 IWG---SIYGITLISVVLCFQFWVALFPLSKSPSAYHFFEQYLSLPVVIVFYMGHKVYSR 546

Query: 521 T--KLVKAEEADLYSFKEAID 539
               ++ A+E DL + +  +D
Sbjct: 547 NWRLVIPAKELDLDTGRREVD 567

>ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} similar
           to uniprot|Q03770 Saccharomyces cerevisiae YDR160W SSY1
           Component of the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p) which senses external amino
           acid concentration and transmits intracellular signals
           that result in regulation of expression of amino acid
           permease genes
          Length = 836

 Score =  249 bits (637), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 164/558 (29%), Positives = 270/558 (48%), Gaps = 61/558 (10%)

Query: 43  GKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFV 102
           G  D   ++++L+ RHI MI I                    P   L+ +S  G +V   
Sbjct: 255 GTGDSHHIQRKLRVRHIQMIGIGACLGVGIFLTSGKAFSIAGPFGTLLGFSLSGSIVLAT 314

Query: 103 MACLGEMATYIPLD-GFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWI 161
           +    E++T IPL  GF+  A+R+ + A GFA+G+ Y F   I  P Q+ A    ++Y+ 
Sbjct: 315 LLSFTELSTLIPLSSGFSGLASRFVEDAFGFALGWTYWFSCMITMPTQVVACTFYLKYF- 373

Query: 162 DRETVNPGV---WITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLG 218
           D   +N G    + T+F++  V++N + VR  GE  +     KI++   +IL + I+  G
Sbjct: 374 DSLNLNKGAIAGFATLFMLYAVLVNLLDVRLMGEIVYITGLIKIIISIIMILAMVILNSG 433

Query: 219 GGPNHDRLGFRYWKNP--------GAFKPY----------SESITGSKGKFVSFVAVFVY 260
            G  +DR+GFR+W +         G F+P           ++ I GS G+F++  +  + 
Sbjct: 434 TGTKYDRVGFRFWDSSKSSSNLTYGLFRPTFDLNDIGDGSTKGIEGSGGRFLALASTMLI 493

Query: 261 ALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLX 320
           + FAY G+E+  + + EA NPR+ IP A K T   +++ Y+ TIF + + +   DPRL  
Sbjct: 494 STFAYTGVEMAFVASGEAINPRKTIPSATKRTFCIVLVIYVFTIFSVSINIYCGDPRLQP 553

Query: 321 ---------------------------------XXXXXXXXXXXPFVVAIQNSGVRALPH 347
                                                       P+V+A+QN G+     
Sbjct: 554 YFTGSYSARYQAVQRGVGSQWQLSHKCHTNIPYSTKDPVDHNSSPWVLALQNFGLCTFAA 613

Query: 348 IFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXX 407
           +FN  ++ F   A  S L+  +R+LYS+A+  KAP +F + N+ GVPY +          
Sbjct: 614 VFNGILIFFTSGAEISSLFSSSRTLYSMAVQRKAPTIFQRCNKRGVPYVSVIFSGMFGVV 673

Query: 408 AYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQ----NVDRNSFAYRA 463
            Y+ V SG+ + FN   N+ S    + W+ + ++++ FY A   +    + D  S+ YR+
Sbjct: 674 GYLAVDSGAVENFNVLSNMSSASTSIIWMGLNVSFLRFYYALKTRRDIISRDEKSYPYRS 733

Query: 464 PFQPYGAYITLFFCVLIAFIKNFTVFIGEF-DYKSFITGYIGLPLYVIFYFGYKIIYKTK 522
           PFQPY A+  LF C L      FT FI  F + KSF + Y GL L+V+ Y GYK+I  +K
Sbjct: 734 PFQPYLAFYGLFGCCLFIIFMGFTNFIHHFWNVKSFFSAYGGLILFVVCYLGYKMIGTSK 793

Query: 523 LVKAEEADLYSFKEAIDR 540
           + + ++ D+ + +  +DR
Sbjct: 794 IQRLDQLDMDTGRREMDR 811

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  245 bits (626), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 156/532 (29%), Positives = 262/532 (49%), Gaps = 24/532 (4%)

Query: 20  LEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXX 79
           L+ +  +  +  E +  +    D  +D   LKK +K RH+ MI++               
Sbjct: 81  LDHDVLAGDSDIEGKPRTEPEKD--DDARELKKTIKPRHVVMISLGTGIGTGMLVGNGTS 138

Query: 80  XXXXXPASILIAYSFVGILVFFVMACLGEMAT-YIPL-DGFTSYATRYCDPALGFAVGYC 137
                PA ++I Y+ +G  ++ ++   GE+A  Y  L  GF +Y +   DPA GFAV + 
Sbjct: 139 LANSGPAGLVIGYAIMGSCIYCIIQATGELAVLYTKLTGGFNAYPSMLIDPAFGFAVAWV 198

Query: 138 YLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVG-VRYFGEFEFW 196
           Y  ++  + P +L   ++ I+YW  +  V+P V++ IF  +I+ IN +G    + E EF+
Sbjct: 199 YCIQWLCVCPLELVTASMTIKYWTTK--VDPDVFVVIFYCLILCINVLGGAAGYAEAEFF 256

Query: 197 LSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSK--GKFVSF 254
            +SFKI+++ G  +   +++ GG  N   +G R W NPG+F+       G K   +F   
Sbjct: 257 FNSFKILMLTGFFILGIVVICGGAGNDGYIGTRLWHNPGSFR-------GDKPVDRFKGV 309

Query: 255 VAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYN 314
           V+  V A FA+   E  G+ A+E  NPR+ IP A K  +YRII  Y+ ++ ++G  V Y+
Sbjct: 310 VSTLVNAAFAFGMSEFLGVTASEQSNPRKAIPSAAKKMLYRIICIYLGSVTIVGFLVPYD 369

Query: 315 DPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYS 374
             +LL            P+V+AI   GVR +PH  N  +L+ V S  NS  Y  +R L S
Sbjct: 370 SDQLLGSSGAATKAS--PYVLAISLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRQLLS 427

Query: 375 LAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILS 434
           L+  G AP      +R G P  A          A+   S    Q+F + + +  +  + +
Sbjct: 428 LSQLGYAPSFLNYVDRNGRPLKAYCVSALVGVIAFCATSPKEDQVFVWLLAISGLSQLFT 487

Query: 435 WISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI---- 490
           W SI ++++ F RA   Q        +++    YG+  +    VLI   + +T  +    
Sbjct: 488 WFSICLSHLRFRRAMRVQGRSMGEVGFKSQVGIYGSLYSCVMMVLILIAQFWTALVPVGE 547

Query: 491 GEFDYKSFITGYIGLPLYVIFYFGYKIIYKT--KLVKAEEADLYSFKEAIDR 540
           G+ D ++F   Y+ +P++++ YFG+KI  K     ++AE+ DL S +E  D 
Sbjct: 548 GKPDVQAFFENYLAMPIFIVLYFGFKIWKKDWRLFIRAEDIDLVSHREIFDE 599

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  243 bits (619), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 165/565 (29%), Positives = 279/565 (49%), Gaps = 39/565 (6%)

Query: 5   EVTKDSKLIREDIIDLE---------------------KNTTSSLNSFEQEDDSNKISD- 42
           E+  DS+ +RE+ +++                      K++   L+     DD + I   
Sbjct: 13  ELQIDSEFLREEPLEISNFEESSSSQGPQPSGSRWRKFKDSFKPLDEAVVTDDMSDIEKI 72

Query: 43  -GKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFF 101
             +     LK  LK RH+ MIAI                    PA ILI +   G +++ 
Sbjct: 73  AHRTAHAPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYC 132

Query: 102 VMACLGEMATYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYW 160
           ++  +GE++   P+ G FT+YATR+ D + GFA  + Y+ ++  + P ++ A ++ + YW
Sbjct: 133 MVMAMGELSVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLCVLPLEIVAASITVNYW 192

Query: 161 IDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGG 220
                   G ++ +F VVIVIIN  GV+ +GE EF  S  K++ + G I+   ++  GGG
Sbjct: 193 GTDPKYRDG-FVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIGFIIMGIVLNCGGG 251

Query: 221 PNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAEN 280
           P    +G +Y+ +PGAF   +     +  +F    +VFV A F++ G EL GI AAE+  
Sbjct: 252 PEGGYIGGKYFHDPGAFVGDT-----AGARFQGVCSVFVTAAFSFAGSELIGIAAAESAE 306

Query: 281 PRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNS 340
           PR+++P+A K   +RI LFY++++ ++G+ V Y D RL+            PFV+AI + 
Sbjct: 307 PRKSVPKAAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVDAAAS--PFVIAITSH 364

Query: 341 GVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXX 400
           G+R LP + NV +LI V S  NS +Y  +R+L +LA     PK+F   +R G P      
Sbjct: 365 GIRGLPSVVNVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYIDRSGRPLFGIAF 424

Query: 401 XXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFA 460
                  A++  S    ++F + + +  +  + +W  I   +I F  A  AQ    +   
Sbjct: 425 TSAFGLVAFVAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAALTAQGRSTDELP 484

Query: 461 YRAPFQPYGAYITLFFCVLIAFIKNFTVFI----GEFDYKSFITGYIGLPLYVIFYFGYK 516
           ++AP   YG+   LF  VL+ F+  F V +    G+   + F   Y+  P+ + FYFG+K
Sbjct: 485 FKAPAGIYGSMWGLFMIVLM-FMAQFYVALFPPGGKPSAEVFFQSYLSFPVVLAFYFGHK 543

Query: 517 IIYKT--KLVKAEEADLYSFKEAID 539
           +  +    L+   + D+ + +  +D
Sbjct: 544 LYARNWKLLIPLSKLDIDTGRREMD 568

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  244 bits (622), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 159/532 (29%), Positives = 259/532 (48%), Gaps = 33/532 (6%)

Query: 21  EKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXX 80
           EK TTS L S         + +   +   LK+ +K RH+ +I++                
Sbjct: 96  EKQTTSDLES--------GLGEVPGENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVL 147

Query: 81  XXXXPASILIAYSFVGILVFFVMACLGEMA---TYIPLDGFTSYATRYCDPALGFAVGYC 137
               P  ++I YS +G  ++ ++   GE+A   + +P + F  Y T   D A GFAV + 
Sbjct: 148 RDAGPGGLVIGYSIMGSCLYCIIQACGELAVCYSSLPSN-FNIYPTFLVDKAFGFAVAWV 206

Query: 138 YLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWL 197
           Y  ++  + P +L   ++ I+YW    +VNP ++++IF V+I++INT G R + E EF+ 
Sbjct: 207 YCLQWLCVCPLELVTASMTIKYWTT--SVNPDIFVSIFFVLIIVINTFGARGYAEAEFFF 264

Query: 198 SSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSK--GKFVSFV 255
           +S K+++M G  +   II  GG      +G +YW +PGAF        G++    F   +
Sbjct: 265 NSCKVLMMAGFFILGIIITCGGAGTSGYIGAKYWHSPGAF-------NGNRPIDHFKGVM 317

Query: 256 AVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYND 315
           A F  A FA+   E   + AAE  NPR+ IP+A K+ +YRI+  ++ +I L+G  V YN 
Sbjct: 318 ATFTTAAFAFGASEFISLTAAEQSNPRKAIPKAAKMMIYRILFVFLSSITLIGFLVPYNS 377

Query: 316 PRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSL 375
           P LL            P+VVA+ + GVR +PH  N  +L+ V S  NS  Y  +R L SL
Sbjct: 378 PYLLGSGSDATKAS--PYVVAVASHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLNSL 435

Query: 376 AIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSW 435
           A  G APK+F   ++ G P  A          A+   S    Q+F + + +  +  + +W
Sbjct: 436 AQQGYAPKMFTYIDKRGRPLVAMVCSTLFMTIAFCAASPKEEQVFTWLLAISGLSQLFTW 495

Query: 436 ISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGE--- 492
           ++I I+++ F RA   Q        +++    YG+       +L A I  F V +     
Sbjct: 496 VAICISHLRFRRALKVQGHSLGEIGFKSQVGIYGSLYAATMLIL-ALIAQFWVALAPIGG 554

Query: 493 --FDYKSFITGYIGLPLYVIFYFGYKIIYKTK--LVKAEEADLYSFKEAIDR 540
              D ++F   Y+ +P+ ++ YFGYKI  +     + A   DL S ++  D 
Sbjct: 555 NGLDARNFFQNYLAMPILLVLYFGYKIRKRDWKFWIPAHRIDLVSHRKVFDE 606

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  243 bits (621), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 169/545 (31%), Positives = 256/545 (46%), Gaps = 61/545 (11%)

Query: 23  NTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXX 82
           +  + + + E E +   + D       LK+ +K RH+ MI++                  
Sbjct: 89  DKINEMTTAEPEAEMASVED------NLKQTIKPRHVIMISLGTGIGTGLLVGNGSALVK 142

Query: 83  XXPASILIAYSFVGILVFFVMACLGEMAT-YIPLDG-FTSYATRYCDPA----------- 129
             PA ++  Y+ +G  V+ ++   GEMA  Y  L+G F +Y T   +P            
Sbjct: 143 AGPAGLVTGYAIMGTCVYCIIQSAGEMAVVYSKLNGGFNAYPTMLVEPGFWVCCRLGVLF 202

Query: 130 -----LGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINT 184
                L F +GYC+                   +YW  R  V+P V++ IF V+I++IN 
Sbjct: 203 TMVDCLSFGIGYCFD----------------DYKYWTTR--VDPDVFVVIFYVLIIVINV 244

Query: 185 VGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESI 244
            G R + E EF+ +  K+++M G  +   II +GG  N   LG  YW+NPGAF+      
Sbjct: 245 FGARGYAEAEFFFNCCKVLMMAGFFILGIIINVGGAGNDGYLGNIYWRNPGAFR------ 298

Query: 245 TGSKG--KFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIV 302
            G KG   F   VA  V A FA+ G E   + AAE  NPR+ IP A K  +YRI+L Y+ 
Sbjct: 299 -GDKGIDHFKGVVATLVTAAFAFGGTEFIALTAAEQSNPRKAIPSAAKKVLYRIVLVYLT 357

Query: 303 TIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACN 362
           +I L+G  V +  P LL            P+V+A+ + GVR +PH  N  +L+ V S  N
Sbjct: 358 SIILIGFLVPFTSPELLGSGSAATAAS--PYVIAVASHGVRVVPHFINAVILLSVLSVGN 415

Query: 363 SDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNY 422
           S  Y  +R L SL+  G APK F   +R G P  A          A+   S    ++F +
Sbjct: 416 SAFYSSSRLLLSLSKQGYAPKWFDYVDREGRPSRAMIVSALFGVIAFCATSPKETEVFTW 475

Query: 423 FVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAF 482
            + +  +  I +WISI +++I F  A  AQ        ++A    +G+Y ++F  +L   
Sbjct: 476 LLAISGLSQIFTWISICLSHIRFRAAMKAQGRSMGEVGFKAQTGIWGSYYSIFLMIL-TL 534

Query: 483 IKNFTVFI-----GEFDYKSFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADLYSFK 535
           I  F V I      E   ++F   Y+ +P+ + FYFGYKI  K  T  +KAE+ DL S +
Sbjct: 535 IGQFWVAIAPIGTAELSARNFFENYLAMPILIGFYFGYKIWKKDWTLYIKAEDIDLISHR 594

Query: 536 EAIDR 540
           +  D 
Sbjct: 595 QIFDE 599

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  243 bits (619), Expect = 8e-72,   Method: Compositional matrix adjust.
 Identities = 162/540 (30%), Positives = 264/540 (48%), Gaps = 24/540 (4%)

Query: 5   EVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKED---GVRLKKELKARHISM 61
           EV + S+  R  ++    ++     S   EDD N + DG         LKK +K+RH+ M
Sbjct: 39  EVKEHSEESRSGLVHRFVDSFRRAESQRLEDD-NDLEDGTRSMRSNNHLKKSMKSRHVVM 97

Query: 62  IAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMA-TYIPLDG-FT 119
           +++                    P S++I Y  V  + +F++   GEM  TY  L G F 
Sbjct: 98  MSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFVTYFMVQAAGEMGVTYPTLPGNFN 157

Query: 120 SYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVI 179
           +Y + +   + GFA  + +  ++  + P +L   ++ I+YW D  T+N  V+I IF V +
Sbjct: 158 AYNSIFVSKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWND--TINADVFIAIFYVFL 215

Query: 180 VIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKP 239
           + I+  GV+ +GE EF  +S KI+++ G I+   II  GG      +G  YW+NPG+F  
Sbjct: 216 LFIHFFGVKAYGETEFIFNSCKILMIAGFIILSVIINCGGAGVDGYIGGEYWRNPGSFAD 275

Query: 240 YSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILF 299
            S     S  +F     + V A F++ GIEL  +   E  NPR++ P A K ++YRI++ 
Sbjct: 276 GS-----SATRFKGICFILVTAYFSFGGIELFVLSINEQANPRKSTPVAAKRSIYRILII 330

Query: 300 YIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFS 359
           Y++T+ L+G  V +++ +L+            P+V+A    GV+ +PHI N  +LI V S
Sbjct: 331 YLLTMILIGFNVPHDNDQLMGSGSSATHAS--PYVLAASIHGVKVIPHIINAVILISVIS 388

Query: 360 ACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQI 419
             NS LY   R + SLA  G APK     +R G P  A           ++  SS   Q 
Sbjct: 389 VANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSFVGLVGFVACSSQEEQA 448

Query: 420 FNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVL 479
           F +   +  +  I +W  I++++I F +A   Q    +   Y++    +G+Y  + F +L
Sbjct: 449 FTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKSNTGIWGSYYGVIFNIL 508

Query: 480 IAFIKNFTVFI------GEFDYKSFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADL 531
           + F+  F V +      G+ D +SF   Y+  PL++  Y GY I  K  T L   ++ DL
Sbjct: 509 V-FMAQFWVALSPPGSDGKCDVESFFQSYLAAPLWIFMYLGYMIYNKDFTLLNPLDKIDL 567

>SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]
           {ON} similar to uniprot|Q03770 Saccharomyces cerevisiae
           YDR160W SSY1 Component of the SPS plasma membrane amino
           acid sensor system (Ssy1p-Ptr3p-Ssy5p) which senses
           external amino acid concentration and transmits
           intracellular signals that result in regulation of
           expression of amino acid permease genes
          Length = 850

 Score =  248 bits (632), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 162/555 (29%), Positives = 274/555 (49%), Gaps = 57/555 (10%)

Query: 43  GKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFV 102
           G  D   ++++L  RH+ MIAI                    P   L+ +     +V   
Sbjct: 271 GHNDVYHVQRKLHVRHLQMIAIGASLGVGLFLTSGKAFTVAGPFGTLLGFLLCASIVLAT 330

Query: 103 MACLGEMATYIPLD-GFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYW- 160
           M    E++T IP+  GF+  A+R+ + A GFA+G+ Y F + I  PNQ+ A   ++ Y+ 
Sbjct: 331 MLSFTEISTLIPISSGFSGLASRFVEDAFGFALGWSYWFSFVIALPNQIVASTFMLSYYE 390

Query: 161 -IDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGG 219
            ++  + +   ++T+FL+  + IN + VR  GE  +  + FKI++   +++ +  +  G 
Sbjct: 391 HLNVPSGSTAGFVTLFLLFAIFINLLDVRILGEILYGSTFFKILITVMMMIAMIALNAGA 450

Query: 220 GPN-HDRLGFRYW---KNP-----GAFKPY----------SESITGSKGKFVSFVAVFVY 260
           G + H R+GFRYW   K+P     G F+P            + I GSKG+F++ + V + 
Sbjct: 451 GAHRHSRVGFRYWDSSKSPEGLTYGLFRPTFDLGDKGSGSLDGIGGSKGRFLAVLVVMLI 510

Query: 261 ALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLX 320
           + FA+ G+EL  + + EA NPR+ +P A K T   II+ Y+ +IFL+G+ +   DPRLL 
Sbjct: 511 SSFAFSGVELAFVASGEAVNPRKTLPSATKRTFIIIIILYLFSIFLVGLNIYSGDPRLLR 570

Query: 321 ------------------------------XXXXXXXXXXXPFVVAIQNSGVRALPHIFN 350
                                                    P+V+A+Q+ G+     + N
Sbjct: 571 YYASPGKDVTIDDYGTKWQIETSCNKNLVVNLDGAINGSQSPWVLALQSFGLCTFSSVLN 630

Query: 351 VCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYM 410
             ++ F  SA  S LY  +R+LYS++I GKAP+LF + ++ G+PY +          +Y+
Sbjct: 631 GILIFFGPSAGCSSLYASSRTLYSMSIQGKAPELFRRCSKKGIPYVSVLFCGAFGVTSYL 690

Query: 411 NVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQ----NVDRNSFAYRAPFQ 466
           +VS  S + F    N+ S    + W+ + I+++ FY A   +    + D  SF YR+PFQ
Sbjct: 691 SVSKESVENFQALANISSASICIIWMGLNISFLRFYYALKKRPDIISRDDPSFPYRSPFQ 750

Query: 467 PYGAYITLFFCVLIAFIKNFTVFI-GEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVK 525
           PY A+  L    ++     FT F+ G ++ K F + Y GL  + + Y GYK    +K+ +
Sbjct: 751 PYLAFYGLLGSTILVLFMGFTTFLPGLWNTKVFFSAYGGLMFFTVCYLGYKTFGTSKIQR 810

Query: 526 AEEADLYSFKEAIDR 540
            ++ D+ S +  IDR
Sbjct: 811 LDQLDMDSGRREIDR 825

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  243 bits (620), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 165/558 (29%), Positives = 267/558 (47%), Gaps = 45/558 (8%)

Query: 2   SVYEVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISM 61
           SV+   KDS   R D I    NT    N+  + + S  +    E G  LK+++K RH+ M
Sbjct: 61  SVWHRFKDS-FKRADHI----NTNIHGNAELELNPSQSLL--PEKGASLKRDIKPRHVVM 113

Query: 62  IAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIP-LDG-FT 119
           +++                    PA + I Y+ +G  ++ ++   GE+A   P L G F 
Sbjct: 114 MSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQAAGELAVAYPTLTGNFN 173

Query: 120 SYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVI 179
           +Y +   DPA+ FA    Y  ++  + P ++ + A+ I+YW    ++NP VW  IF V+I
Sbjct: 174 NYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYW--NTSINPNVWCVIFYVMI 231

Query: 180 VIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKP 239
           + IN  G   + E +F+ ++ KI++  G  +   II  GG  +   +G +YW +PGAF  
Sbjct: 232 IGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSVYIGGKYWNDPGAFN- 290

Query: 240 YSESITGSKG--KFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRII 297
                 G  G  +F + V+  V A FA+   E   + A+E  NPR+ IP A K  +YRII
Sbjct: 291 ------GDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKAIPSAAKQVLYRII 344

Query: 298 LFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFV 357
             Y+ +I L+G  V YN P L+            P+V+A+ + GV+ +P   N  +LI V
Sbjct: 345 AIYLASIILVGFLVPYNSPELMGSGSSSVHSS--PYVIAVASHGVKVVPSFINAVILISV 402

Query: 358 FSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSA 417
            S  N   Y  +R L  L+  G APK F   +R G P  A           +++ SS   
Sbjct: 403 LSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCICFVSASSAEE 462

Query: 418 QIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFC 477
            +F + + V  +  + +W +I I+++ F +A   QN       +R+    +G+Y  +F  
Sbjct: 463 SVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQVGVWGSYYGIFMM 522

Query: 478 VLIAFIKNFTVFIGEF-------------DYKSFITGYIGLPLYVIFYFGYKIIYKT-KL 523
           +L        VFIG+F             D ++F   Y+ +P+++  YFG+KI  K  +L
Sbjct: 523 IL--------VFIGQFWVALFPVGGTDGADAENFFANYLAMPVFLALYFGFKIWKKDWRL 574

Query: 524 -VKAEEADLYSFKEAIDR 540
            + A E DL S ++  D 
Sbjct: 575 YIPASEIDLISHRKIFDE 592

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  241 bits (615), Expect = 9e-72,   Method: Compositional matrix adjust.
 Identities = 154/511 (30%), Positives = 247/511 (48%), Gaps = 40/511 (7%)

Query: 14  REDI---------IDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAI 64
           RED+         ++L++  T SLN F+                 +K+ LK RHIS++A+
Sbjct: 10  REDLDKLEPKIAEVELQRLETDSLNEFDPHSG-------------VKRALKNRHISLLAL 56

Query: 65  XXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYAT 123
                               P ++L+ +  +G++ F +M  +GE+ T  P  G F + A 
Sbjct: 57  GGIIGPGCLIGAGNALNKGGPLALLLGFGIIGLVCFSIMESIGELVTLYPSGGGFITLAR 116

Query: 124 RYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIIN 183
           R+    L    GY Y+  +F +  N+    + ++Q+W  +  +    +  IF    ++  
Sbjct: 117 RFHSEGLSAVSGYAYIVVFFAVLANEYNTISSILQFWGPQVPIYG--YTLIFWFFFLVFQ 174

Query: 184 TVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSES 243
            +GV  FGE E+WL+ FKI+ +    +F  + M GG P    +GF+YWKNPGA       
Sbjct: 175 LIGVGAFGECEYWLAWFKILGLVAFYIFSIVYMSGGIPGKPPIGFQYWKNPGAL------ 228

Query: 244 ITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVT 303
              S G F     VFV+    Y G E   + A E+ NPR+ +P A++ T +RI++ Y+  
Sbjct: 229 ---SHG-FRGIAVVFVFCSTFYSGTESVALAATESRNPRKAVPLAVRQTFWRILIVYLGI 284

Query: 304 IFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNS 363
            F  G+ V YNDP L             P  +A+  +G     H+ N  +L+   SA NS
Sbjct: 285 SFFYGVTVPYNDPTL----GAQTKSLKSPISIALSRAGWAGGVHLVNAFILMTCISAINS 340

Query: 364 DLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYF 423
            LY+G+R+L  LA +G AP++ A T++ GVP  A          + MNVS G++  +NY 
Sbjct: 341 SLYIGSRTLSHLAHEGLAPRILAWTDKRGVPVPALIVFNALGLISLMNVSVGASNAYNYI 400

Query: 424 VNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFI 483
           VN+  +   + W +I IT++ F +A +AQ    +   YRA F P+    +L   + +A I
Sbjct: 401 VNLSGVGVFIVWSAISITHLRFRKAWVAQGRSLSELPYRALFYPWTTIFSLAANIFLALI 460

Query: 484 KNFTVFIGEFDYKSFITGYIGLPLYVIFYFG 514
           + +T  +  F  K F+  YI LP   + Y G
Sbjct: 461 QGWTSLV-PFVAKDFVDAYILLPAAGLLYVG 490

>Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON}
           (28709..30499) [1791 nt, 597 aa]
          Length = 596

 Score =  242 bits (618), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 160/544 (29%), Positives = 265/544 (48%), Gaps = 22/544 (4%)

Query: 7   TKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXX 66
           +K     R  I   ++   S L++   ED  + I+  + D  + KK L +RH+ M+++  
Sbjct: 35  SKTRGYFRNFIDSYKRADPSQLHNARSEDVEDGIASIRSD-TQFKKSLSSRHVIMMSLGT 93

Query: 67  XXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIP-LDG-FTSYATR 124
                             P S++I Y  V  + +F++   GEMA   P L G F +Y + 
Sbjct: 94  GIGTGLLVANAKGLYYGGPGSLIIGYVLVSFVTYFMIQAAGEMAVAYPTLPGNFNAYQSI 153

Query: 125 YCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINT 184
           +   + GFA  + +  ++  + P +L   +L I+YW D+  +N  +++ IF V +V I+ 
Sbjct: 154 FISKSWGFATVWLFCIQWLTVLPLELITSSLTIKYWNDK--INADIFVMIFYVFLVAIHL 211

Query: 185 VG-VRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSES 243
           VG +R +GE EF  +S KI+++ G I+   +I  GG  N   +G +YW  PG+F      
Sbjct: 212 VGGIRAYGETEFLFNSCKILMVIGFIILSIVINAGGAGNDGYIGGKYWHEPGSFAE---- 267

Query: 244 ITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVT 303
              +  +F     V V   F+Y G EL  +   E   PR+  P A K ++YRI++ Y++T
Sbjct: 268 -GDATSRFKGICLVLVSGYFSYGGTELYVLSVNEQAEPRKATPAAAKKSIYRILIIYLLT 326

Query: 304 IFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNS 363
           + L+G  V +N+ +L+            P+V+A    GV+ +PH  N  +LI V S  NS
Sbjct: 327 MILIGFNVPHNNDQLMGAGGSATHAS--PYVLAATIHGVKIVPHFINAVILISVISVANS 384

Query: 364 DLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYF 423
            L+ G R L SLA  G APK+ +  +R G P  A          A+++ +S   ++F + 
Sbjct: 385 SLFAGPRLLSSLATQGYAPKILSYVDREGRPLVALGISFLIGLIAFVSCTSHEEEVFTWL 444

Query: 424 VNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFI 483
             +  +  I +W  I+ +++ F  A   Q  D N   Y+A    +G+    FF VL+  I
Sbjct: 445 AAIAGLSEIFTWSGIMFSHVRFRAAMKVQGKDINELGYKANTGVWGSAYGAFFGVLV-LI 503

Query: 484 KNFTVFI------GEFDYKSFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADLYSFK 535
             F V +      G+ D ++F   Y+  P++V  YFGY I  K  T L   ++ DL S++
Sbjct: 504 AQFWVALAPIGNGGKCDAEAFFESYLAFPIWVACYFGYMIYNKDFTLLSPLDKIDLDSYR 563

Query: 536 EAID 539
              D
Sbjct: 564 RIYD 567

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  243 bits (621), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 163/543 (30%), Positives = 271/543 (49%), Gaps = 23/543 (4%)

Query: 5   EVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAI 64
           E T+++K +  ++      T S L++  +E D    S  KE+   L+K ++ RH+ M ++
Sbjct: 88  EGTEETKHMETEL----TTTLSPLSAAIKEHDVAITS--KEEDAHLRKSIQPRHVLMSSL 141

Query: 65  XXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMA-TYIPLDG-FTSYA 122
                               PA ++I Y+ +G  ++ ++   GEMA +Y  L G F +Y 
Sbjct: 142 ATGVGTGLLVGNGSALHKAGPAGLVIGYAIMGTCLYCIIQACGEMAVSYSNLPGNFNAYP 201

Query: 123 TRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVII 182
           T   D   GFAV + Y  ++  + P +L   ++ I YW  +  VN  +++ IF V+I++I
Sbjct: 202 TFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK--VNNDIFVVIFYVLIILI 259

Query: 183 NTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSE 242
           N  G + + E +F+ ++ K++++ G  +   II  GG      +G +YW +PGAF+    
Sbjct: 260 NVFGAKGYAEADFFFNTCKVLMITGFFILAIIINAGGAGTSGYIGAKYWHDPGAFRG--- 316

Query: 243 SITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIV 302
               S  +F   +A F  A FA+   E   I A+E  NPRR IP A K+ +YRI+  ++ 
Sbjct: 317 --DRSIDRFKDVMATFTTAAFAFGASEFIAIGASEQSNPRRAIPSAAKIMIYRILFIFLS 374

Query: 303 TIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACN 362
           +I L+G  V Y+   L+            P+V+AI + GVR +PH  N  +L+ V S  N
Sbjct: 375 SIALVGFLVPYDSSELMGSGSGGTKAS--PYVLAISSHGVRVVPHFINAVILLAVLSVSN 432

Query: 363 SDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNY 422
           S  Y   R L+SL+  G AP+ F   +R G P  A          A+   SS   ++F +
Sbjct: 433 SAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGIIAFCACSSKEEEVFTW 492

Query: 423 FVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAY--ITLFFCVLI 480
            + +  +  I +W++I +++I F RA   Q    +   +R+    +G+    T+ F  LI
Sbjct: 493 LLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGVWGSVYAATMLFLALI 552

Query: 481 AFIKNFTVFIGE--FDYKSFITGYIGLPLYVIFYFGYKIIYKT-KL-VKAEEADLYSFKE 536
           A        IGE   D KSF   Y+ +P+ ++FYFGYKI  +  KL ++A+  DL + + 
Sbjct: 553 AEFWVSIAPIGEDHLDAKSFFENYLAMPILIVFYFGYKIYNRDWKLFIRAKNIDLITHRN 612

Query: 537 AID 539
             D
Sbjct: 613 IFD 615

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  241 bits (614), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 162/539 (30%), Positives = 266/539 (49%), Gaps = 28/539 (5%)

Query: 19  DLEKNTTS-----SLNSFEQEDDSNKISD--GKEDGVRLKKELKARHISMIAIXXXXXXX 71
           DLE   T+     +L+ +++  DS  + +  GK     LKK +K RH+ MI++       
Sbjct: 87  DLENELTTCVSPATLSDYKKSGDSGSVDELEGKTKEEHLKKSIKPRHVVMISLGTGIGTG 146

Query: 72  XXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMA-TYIPL-DGFTSYATRYCDPA 129
                        PA + I Y+ +G  ++ ++   GEMA TY  L  GF +Y +    P 
Sbjct: 147 LLVGNAKALNDAGPAGLAIGYAIMGSCIYCIIQAAGEMAVTYSNLVGGFNAYPSFLVSPK 206

Query: 130 LGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRY 189
           LGFAV + Y  ++  + P +L   ++ I+YW  +  VNP V++ IF  +I++IN  G R 
Sbjct: 207 LGFAVAWVYWLQWACVCPLELVTASMTIKYWTTK--VNPDVFVVIFYFLIIVINVFGARG 264

Query: 190 FGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKG 249
           + E EF+ +  K++++ G  +   II  GG  N   +G +YW +PGAF+       G K 
Sbjct: 265 YAEAEFFFNCCKVLMITGFFILGIIINCGGAGNDGYIGGKYWHDPGAFR-------GDKA 317

Query: 250 --KFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLL 307
             +F    A  V A FA+ G E   + A+E  NPR+ IP A K  +YRII+ ++ +I ++
Sbjct: 318 IDRFKGVAATLVTAAFAFGGSEFIALTASEQSNPRKAIPAAAKKILYRIIIIFLGSIIMV 377

Query: 308 GMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYV 367
           G  V +N  +L+            P+V+AI + GVR +PH  N  +L+ V S  NS  Y 
Sbjct: 378 GFLVPWNSDQLMGSDSSKTKAS--PYVIAISSHGVRVVPHFVNAVILLSVLSVGNSAFYS 435

Query: 368 GTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVV 427
            +R L SL+  G APK F   +R G P  A          A+   SS    +F + + + 
Sbjct: 436 SSRILISLSQQGYAPKFFNYIDREGRPARAMVIGALFAVIAFCAASSKEEDVFTWLLAIS 495

Query: 428 SIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAY--ITLFFCVLIA--FI 483
            +  I +W +I +++I F RA   Q        +++    +G+Y    + F VLIA  ++
Sbjct: 496 GLSQIFTWAAICLSHIRFRRAMHVQGRSLGEIGFKSELGVWGSYYAAGMMFLVLIAQFWV 555

Query: 484 KNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADLYSFKEAIDR 540
               + + + D +SF   Y+ + + + FY GY    K  T  ++A++ DL   ++  D 
Sbjct: 556 GLAPIGMNKLDAQSFFESYLAMLMLIAFYVGYMFWKKDWTLFIRAKDIDLDHHRQIFDE 614

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  241 bits (615), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 162/543 (29%), Positives = 272/543 (50%), Gaps = 27/543 (4%)

Query: 6   VTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIX 65
           +T +  +I E+I+ L     S+L+  ++     KI +  ++   LKK +K RH+ MI++ 
Sbjct: 114 ITSNEMMIDEEILSL-----SNLDG-QRVPPPRKIENKSDE---LKKTIKPRHVLMISLG 164

Query: 66  XXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMA-TYIPL-DGFTSYAT 123
                              PA +L+ +  +G  ++ ++  +GEMA  Y  L  GF +Y +
Sbjct: 165 TGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCIIQAVGEMAVAYSDLVGGFNAYPS 224

Query: 124 RYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIIN 183
              DPA GF+V + Y  ++  + P +L   ++ I+YW  +  V+P V++ IF V+I+ IN
Sbjct: 225 FLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWTTK--VDPDVFVIIFYVLILAIN 282

Query: 184 TVG-VRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSE 242
            VG    + E EF  +S KI++M G  +   II+ GG  N   +G +YW  PGAF+    
Sbjct: 283 IVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGNDGYIGGKYWHEPGAFRGEH- 341

Query: 243 SITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIV 302
               +  +F   +A  V A FA+   E  G+ A+E  NPR+ IP A K  +YRI+  ++ 
Sbjct: 342 ----AIDRFKGVMATLVNAAFAFGMSEFIGVTASEQSNPRKAIPSAAKKMLYRIVCMFLA 397

Query: 303 TIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACN 362
           +I ++G  V Y+  +LL            P+V+A+   GV+ +PH  N  +LI V S  N
Sbjct: 398 SITIVGFLVPYDSDQLLGSSGGGVKAS--PYVLAVSTHGVKVVPHFINAVILISVLSVAN 455

Query: 363 SDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNY 422
           S  Y  +R L SLA  G APK+F   +R G P             A+   S    ++F +
Sbjct: 456 SAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASLFGVIAFCATSPKEDEVFVW 515

Query: 423 FVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAY--ITLFFCVLI 480
            + +  +  + +WI+I ++++ F RA   Q        +R+    +G+     +  C+LI
Sbjct: 516 LLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRSQVGAWGSSYAAIMMVCILI 575

Query: 481 A--FIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADLYSFKE 536
           A  ++    +  G+ D K+F   Y+ +P+ +  YFGYKI  K  T  ++A++ DL S + 
Sbjct: 576 AQFWVAIAPIGEGKLDAKNFFENYLAMPILLALYFGYKIYTKNWTIFIRAKDIDLVSHRN 635

Query: 537 AID 539
             D
Sbjct: 636 IFD 638

>TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {ON}
           Anc_3.284 YDR046C
          Length = 607

 Score =  239 bits (611), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 163/541 (30%), Positives = 262/541 (48%), Gaps = 33/541 (6%)

Query: 21  EKNTT---SSLNSFEQEDDSN--KISDGKEDGVR-------LKKELKARHISMIAIXXXX 68
            KNT+   + ++SF++ +  N  + S   EDG         +KK LKARH+ M+++    
Sbjct: 49  RKNTSYYRNFIDSFKRAEHGNLNEKSADLEDGTASIQSKSYMKKSLKARHVIMMSLGTGI 108

Query: 69  XXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMA-TYIPLDG-FTSYATRYC 126
                           PAS++I Y  V  +V+F++   GEMA TY  L G F +Y + + 
Sbjct: 109 GTGLLVANAKSLAYGGPASLIIGYVIVSFIVYFMIQAAGEMAVTYPTLPGNFNTYQSIFI 168

Query: 127 DPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVG 186
             + GFA  + +  ++  + P +L   +L IQYW D   +N  +++ IF V +++I+ +G
Sbjct: 169 SKSWGFATVWLFCIQWITVLPLELITSSLTIQYWTD---LNGDIFVVIFYVFLLLIHFIG 225

Query: 187 VRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITG 246
           V+ +GE EF  +  KI+++ G I+F  ++  GG  N   +G +YW  PG+F        G
Sbjct: 226 VKAYGETEFIFNLCKILMISGFIIFSIVVNCGGAGNDGYIGGKYWHTPGSFAE-----GG 280

Query: 247 SKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFL 306
              +F     V V   F+Y G EL  +   E   PR+  P A K ++YRI++ Y++T+ L
Sbjct: 281 PTSRFKGICYVLVAGYFSYGGTELYVLSVNEQAEPRKATPAAAKKSIYRILVIYLLTMIL 340

Query: 307 LGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLY 366
           +G  V +N  +L+            P+V+A    GV+ +PHI N  +LI V S  NS LY
Sbjct: 341 IGFNVPHNSDQLMGAGGSSTHAS--PYVLAASIHGVKVVPHIINAVILISVVSVANSSLY 398

Query: 367 VGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNV 426
              R L SLA  G APK     +R G P  A          A++  S    Q+F +   +
Sbjct: 399 ASPRLLASLAEQGYAPKALTYIDREGRPLVALLLCAVFGCIAFVASSDKEEQVFTWLAAI 458

Query: 427 VSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNF 486
             +  + +W  I+ +++ F  A   QN D +   Y+A    YG++    F VL+  I  F
Sbjct: 459 AGLSEVFTWTGIMFSHVRFRLAMKVQNKDIDEVGYKATAGIYGSWFGSIFGVLV-LIAQF 517

Query: 487 TVFI------GEFDYKSFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADLYSFKEAI 538
            V +      G    +SF   Y+ +P++V FY  Y +  K  T L    + DL + +   
Sbjct: 518 WVALSPPGSGGAVSAESFFENYLAMPIWVFFYIVYSVYNKEWTILTDLSKIDLDAHRRIY 577

Query: 539 D 539
           D
Sbjct: 578 D 578

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  239 bits (611), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 154/530 (29%), Positives = 260/530 (49%), Gaps = 31/530 (5%)

Query: 29  NSFEQEDDSNKISDGKEDGV--------RLKKELKARHISMIAIXXXXXXXXXXXXXXXX 80
           NSF++   SN  +  KEDG         +LKK +K+RH+ MI++                
Sbjct: 69  NSFKRAPGSN--NPDKEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKAL 126

Query: 81  XXXXPASILIAYSFVGILVFFVMACLGEMAT-YIPLDG-FTSYATRYCDPALGFAVGYCY 138
               PA ++I Y+ +G  ++ ++   GE+A  Y  L G F +Y +   DPALGF+V + Y
Sbjct: 127 RNGGPAGLVIGYAIMGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVY 186

Query: 139 LFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLS 198
             ++  + P +L   ++ I+YW    +VNP +++ IF V+ + IN  G R + E EF+ +
Sbjct: 187 CLQWLCVMPLELVTASITIKYWT--TSVNPDIFVAIFYVLTIAINVFGARGYAEAEFFFN 244

Query: 199 SFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSK--GKFVSFVA 256
           + K++++ G  +   I+  GG  N   +G +YW +PG+F       +G K    F   V+
Sbjct: 245 TCKVLMITGFFILGIIVNCGGAGNDGYIGGKYWNDPGSF-------SGDKPIDHFKGVVS 297

Query: 257 VFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDP 316
             V A FA+   E   + AAE  NPR++IP A K  +YRII+ ++ +I L+G  V +N  
Sbjct: 298 TLVTAAFAFGATEFIALTAAEQANPRKSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSE 357

Query: 317 RLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLA 376
            L+            P+V+AI + GV+ +PH  N  +L+ V S  NS  Y  +R L SLA
Sbjct: 358 ELMGSGGSATHAS--PYVIAIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLA 415

Query: 377 IDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWI 436
             G AP      +R G P  A          +++  S     +F + + +  +  + +W 
Sbjct: 416 EQGYAPSFLKYVDREGRPTLAMIISAVFGLISFVAASPKEETVFTWLLAISGLSQLFTWS 475

Query: 437 SILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI----GE 492
           +I +++I F RA   Q        +++    +G+Y      +LI   + +T       G+
Sbjct: 476 AICLSHIRFRRAMKVQGRSLGELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEGK 535

Query: 493 FDYKSFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADLYSFKEAIDR 540
            D ++F   Y+ +P+ +  YFGYK+  +  T  + A + DL S +   D 
Sbjct: 536 LDAEAFFENYLAMPILIALYFGYKVWKRDWTLYIPASKIDLISNRRIFDE 585

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  239 bits (609), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 160/531 (30%), Positives = 259/531 (48%), Gaps = 28/531 (5%)

Query: 29  NSFEQE-----DDSNKISDGKEDGVR----LKKELKARHISMIAIXXXXXXXXXXXXXXX 79
           NSF++      D S  +     + VR     K+ +K+RH+ M+++               
Sbjct: 52  NSFKRANSDTFDASQDLEGASINSVRSNSKFKQSMKSRHVVMMSLGTGIGTGLLVANGKS 111

Query: 80  XXXXXPASILIAYSFVGILVFFVMACLGEMATYIP-LDG-FTSYATRYCDPALGFAVGYC 137
                PA +LI YS V ++ + +M   GEMA   P L G F  Y++ +   + GFA  + 
Sbjct: 112 LHFGGPAGLLIGYSLVSVVAYIMMQAAGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWL 171

Query: 138 YLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWL 197
           Y  ++  + P +L   +L I+YW    ++NP  +I IF  VIV I+  G   +GE EF  
Sbjct: 172 YCLQWLTVLPLELITASLTIKYW--NSSINPDAFIAIFYAVIVFIHFFGAAGYGEAEFIF 229

Query: 198 SSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAV 257
           S+ K+ ++ G I+   +I  GG      +G  YW+NPGAF   S       G F     V
Sbjct: 230 STCKVSMIAGFIILSIVINCGGAGTGGYIGGEYWRNPGAFAGGSP-----IGHFKGIAYV 284

Query: 258 FVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPR 317
            V A F+Y G+EL  +   E  NPR+ +P A K  +YRI++ Y++T+ L+G  V YN   
Sbjct: 285 LVTAYFSYGGMELFALTVNEQANPRKAVPSATKKCIYRILIIYMLTMILIGFLVPYNSDE 344

Query: 318 LLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAI 377
           L+            P+V+A+ + GV+ +PHI N  +LI V S  NS +Y   R L SLA 
Sbjct: 345 LMGSSGKSATHAS-PYVIAVASHGVKVVPHIINAVILISVVSVGNSAMYSAPRLLNSLAE 403

Query: 378 DGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWIS 437
            G APK+F+  +R G P  A          +++  S    Q+F +   +  +  + +W +
Sbjct: 404 QGYAPKIFSYVDRAGRPLVALVGCSIFGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSA 463

Query: 438 ILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI------G 491
           I ++++ F  A   Q    +   Y++    +G+   +FF +++ F+  F V +      G
Sbjct: 464 ICLSHVRFRDAMKYQGYSLSELGYKSKTGYWGSIYAIFFNIIV-FVAQFWVALAPIGNGG 522

Query: 492 EFDYKSFITGYIGLPLYVIFYFGYKIIYKT--KLVKAEEADLYSFKEAIDR 540
           + D ++F   Y+  P+++  Y GYKI  K    LV  +E DL S +   D+
Sbjct: 523 KADAEAFFQSYLAFPIWISCYVGYKIYSKEWKLLVPLDEIDLNSHRHIFDK 573

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  239 bits (609), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 155/530 (29%), Positives = 258/530 (48%), Gaps = 24/530 (4%)

Query: 21  EKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXX 80
           EK++T S    E     +  S        LK+ +K RH++M++I                
Sbjct: 59  EKHSTPSNGDLEHATTHSVASSSP-----LKRSIKPRHVAMMSICTGIGTGLLVANGKSL 113

Query: 81  XXXXPASILIAYSFVGILVFFVMACLGEMATYIP-LDG-FTSYATRYCDPALGFAVGYCY 138
               PA ++I Y+ V ++ + +M   GEMA   P L G F +Y+++      GFA  + Y
Sbjct: 114 RFGGPAGLIIGYAAVSVVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLISRPFGFATVWLY 173

Query: 139 LFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLS 198
             ++  + P +L   +L I+YW D  ++N  V+I IF V I+ I+  G R +GE EF   
Sbjct: 174 CIQWLTVLPLELITASLTIKYWND--SINADVFIAIFYVFILFIHFFGSRGYGESEFIFG 231

Query: 199 SFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVF 258
             K++++ G ++   +I  GG  +   +G +YW +PGAF     ++     KF     V 
Sbjct: 232 ICKVLMIIGFVILSIVINCGGAGDRKYIGAKYWYDPGAF-----AVGSGATKFKGVAYVL 286

Query: 259 VYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRL 318
           V   F+Y G EL  +   E  NPRR I    K  +YRI+L Y++T+ L+G  V +    L
Sbjct: 287 VTGYFSYGGTELYAMTVNEQSNPRRAIQSITKQCIYRILLIYMLTMILIGFLVPHTSSEL 346

Query: 319 LXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAID 378
           +            P+V+A+   GV+ +PHI N  +LI V S  NS +Y G R L +LA  
Sbjct: 347 MGSSGKSATHAS-PYVLAVSLHGVKIVPHIINAVILIAVISVGNSAMYSGPRILNTLAEQ 405

Query: 379 GKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISI 438
           G AP+  A  +R G P  A          A++  S     +F +   +  +  + +W +I
Sbjct: 406 GYAPRFLAYVDRAGRPLVALIACSVFGLLAFVAASDCEEDVFTWLAAIAGLSELFTWSAI 465

Query: 439 LITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI------GE 492
           +++++ F +A    N   +   Y+A     G+ + L F +L+ FI  F V I      G+
Sbjct: 466 MLSHVRFRQAMRYNNRPLSELGYKANTGVLGSVLGLSFNILV-FIAQFWVSIAPFGKDGK 524

Query: 493 FDYKSFITGYIGLPLYVIFYFGYKIIYKT-KLVKA-EEADLYSFKEAIDR 540
            D  SF   Y+  PL+V+ +FGY I+++  +++K  ++ DL  ++   D+
Sbjct: 525 LDVLSFFQSYLAFPLWVVLFFGYMIVFRNWEIIKPLKDIDLDHYRSIYDQ 574

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  239 bits (609), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 148/502 (29%), Positives = 250/502 (49%), Gaps = 23/502 (4%)

Query: 50  LKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEM 109
           LK+ +K+RH+ MI++                    PA   I +  +G+ V+ V+   GE+
Sbjct: 90  LKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVIQAAGEL 149

Query: 110 AT-YIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVN 167
           A  Y  L  GF +Y +   DPALGFA  + Y  ++  + P +L   ++ I++W    +VN
Sbjct: 150 AVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWPGSRSVN 209

Query: 168 PGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLG 227
           P +++ IF V+I++IN  G R + E EF+ +S K+++M G  +   +I  G       +G
Sbjct: 210 PDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAVGTSGYIG 269

Query: 228 FRYWKNPGAFKPYSESITGSKGKFVSF---VAVFVYALFAYLGIELTGIVAAEAENPRRN 284
            +YW++PG+         G +  F  F   VA  V A F+    E   + AAE  NPR++
Sbjct: 270 GKYWRDPGSL--------GGRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQANPRKS 321

Query: 285 IPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRA 344
           IP A K  +Y+I + ++ ++ L+G  V  +   L+            P+V+A++  GV  
Sbjct: 322 IPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELM--GSNDSDLHVSPYVIAVRMHGVNV 379

Query: 345 LPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXX 404
           +P   N  +L+ V S  NS  Y  +R L+SLA    APK+F   +R G P  A       
Sbjct: 380 VPSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISILF 439

Query: 405 XXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAP 464
               ++  S    ++F + + +  +  + +W +I +++I F RA   Q    +   ++A 
Sbjct: 440 GTICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFKAQ 499

Query: 465 FQPYGAYITLFFCVLIAFIKNFTVFI-----GEFDYKSFITGYIGLPLYVIFYFGYKIIY 519
               G+Y++    VL A I  F V +      E D +SF TGY+ +P++++FYFGYKI  
Sbjct: 500 TGIIGSYVSAIMMVL-ALIGQFWVSLVPMGATEPDAESFFTGYLAMPMFLLFYFGYKIWN 558

Query: 520 KT--KLVKAEEADLYSFKEAID 539
           K     ++A++ DL S +   D
Sbjct: 559 KDWRLFIRADQIDLVSHRRIFD 580

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  239 bits (609), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 154/524 (29%), Positives = 262/524 (50%), Gaps = 22/524 (4%)

Query: 5   EVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGK---EDGVRLKKELKARHISM 61
           EV + S+  R  ++    ++     S   EDD N + DG    +   RLKK +K+RH+ M
Sbjct: 39  EVKEHSEESRNGLVHRFVDSFKRAESQHLEDD-NDLEDGTRSMKSNNRLKKSMKSRHVVM 97

Query: 62  IAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMA-TYIPLDG-FT 119
           +++                    P S++I Y  V  + +F++   GEM  TY  L G F 
Sbjct: 98  MSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFN 157

Query: 120 SYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVI 179
           +Y + +   + GFA  + +  ++  + P +L   ++ I+YW D+  +N  V+I IF V +
Sbjct: 158 AYNSIFISKSFGFATTWIFCIQWLTVLPLELITSSMTIKYWNDK--INSDVFIVIFYVFL 215

Query: 180 VIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKP 239
           + I+  GV+ +GE EF  SS KI+++ G I+   +I  GG      +G +YW++PG+F  
Sbjct: 216 LFIHFFGVKAYGETEFIFSSCKILMIAGFIILSVVINCGGAGVDGYIGGKYWRDPGSF-- 273

Query: 240 YSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILF 299
            +E    ++ K + F+ V  Y  F++ GIEL  +   E  NPR++ P A K ++YRI++ 
Sbjct: 274 -AEGNGATRFKGICFILVTAY--FSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILII 330

Query: 300 YIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFS 359
           Y++T+ L+G  V +N+ +L+            P+V+A     VR +PHI N  +LI V S
Sbjct: 331 YLLTMILIGFNVPHNNDQLMGSGSAATHAS--PYVLAASIHKVRVVPHIINAVILISVIS 388

Query: 360 ACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQI 419
             NS LY   R + SLA  G APK     +R G P  A           ++  S    Q 
Sbjct: 389 VANSALYAAPRLMCSLAQQGYAPKFLDYIDREGRPLRALFVCCLVGVIGFVACSPQEEQA 448

Query: 420 FNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVL 479
           F +   +  +  + +W  I++++I F +A   Q    +   Y+A    +G+Y  +FF +L
Sbjct: 449 FTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNIL 508

Query: 480 IAFIKNFTVFI------GEFDYKSFITGYIGLPLYVIFYFGYKI 517
           + F+  F V +      G+ + ++F   Y+  PL++  Y GY +
Sbjct: 509 V-FMAQFWVALSPIGNGGKCNAQAFFESYLAAPLWLCMYLGYML 551

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  238 bits (607), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 160/538 (29%), Positives = 264/538 (49%), Gaps = 31/538 (5%)

Query: 14  REDIIDLEKNTTSS--LNSFEQEDDSNKISDGKEDGVR-------LKKELKARHISMIAI 64
           R D +++ K+      ++SF + +      +  EDG R       LKK +K+RH+ M++I
Sbjct: 8   RSDDVEISKSNLVHRFVDSFRRAESPELEENDLEDGTRSIVTKTHLKKAMKSRHVVMMSI 67

Query: 65  XXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIP-LDG-FTSYA 122
                               PAS++I Y  V  + +F++   GEMA   P L G F SY 
Sbjct: 68  GTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYFMIQAAGEMAVAYPTLPGSFNSYT 127

Query: 123 TRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVII 182
           + +     GFA  + +  ++  + P +L   +L ++YW D+  +N  V+I IF   ++ I
Sbjct: 128 STFISKPFGFATVWLFFIQWLTVFPLELITASLTVKYWNDK--INADVFIIIFYAFLLFI 185

Query: 183 NTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSE 242
           +  GV+ +GE EF  +S K++++ G I+   +I  GG      +G +YW +PG+F     
Sbjct: 186 HFFGVKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAGTDGYIGAKYWHDPGSFAD-GP 244

Query: 243 SITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIV 302
            IT  KG  V F+ V  Y  F+Y G EL  +   E ENPR++ P A K ++YRI++ Y+ 
Sbjct: 245 PITRFKG--VCFILVSAY--FSYGGAELFSLSVNEQENPRKSTPAAAKQSIYRILIIYLA 300

Query: 303 TIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACN 362
           T+ L+G  V +N   L+            P+V+A     V+ +PH  N  +LI V S  N
Sbjct: 301 TMILIGFNVPHNSDELMGAGSAATHAS--PYVLAASLHSVKVVPHFINAVILISVISVAN 358

Query: 363 SDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNY 422
           S LY   R + SLA  G APK     +R G P              +++ SS   ++F +
Sbjct: 359 SALYAAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILCALFGVIGFVSASSKEEEVFTW 418

Query: 423 FVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAF 482
              +  +  + +W  I++++I F +A        +   ++A    +G+Y    F +L+ F
Sbjct: 419 LAAIAGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGFKAVTGIWGSYYGCAFNILV-F 477

Query: 483 IKNFTVFI------GEFDYKSFITGYIGLPLYVIFYFGYKIIYK---TKLVKAEEADL 531
           I  F V +      G+ D ++F   Y+  P++++FYFGY +IYK   T L   E+ DL
Sbjct: 478 IAQFWVALSPPGSGGKCDAEAFFQSYLAAPIWLVFYFGY-MIYKRDFTILNPLEKIDL 534

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  239 bits (609), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 148/508 (29%), Positives = 250/508 (49%), Gaps = 23/508 (4%)

Query: 44  KEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVM 103
           ++   +LK+ +  RH+ M+++                    PA ++I Y+ +G  ++ ++
Sbjct: 84  RQTETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYCII 143

Query: 104 ACLGEMA-TYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWI 161
              GE+A +Y  L G F +Y +   + A GF+V + Y  ++  + P +L   ++ I+YW 
Sbjct: 144 QAAGELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITIKYWT 203

Query: 162 DRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGP 221
              +VNP +++ IF V+I+++N  G R + E EF+ +  K++++ G  +   I+  GG  
Sbjct: 204 --TSVNPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAG 261

Query: 222 NHDRLGFRYWKNPGAF---KPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEA 278
           N   +G RYW NPGAF   KP           F   ++  V A FA+   E   + AAE 
Sbjct: 262 NDGYIGGRYWNNPGAFYGTKPIHH--------FKGIISTMVTAAFAFGATEFIALTAAEQ 313

Query: 279 ENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQ 338
            NPRR IP A K  +YRI+L ++  I L+G  V +N P L+            P+V+A+ 
Sbjct: 314 ANPRRAIPSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHAS--PYVIAVA 371

Query: 339 NSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAX 398
           + GVR +PH  N  +L+ V S  NS  Y  +R L +LA    AP      +R G P  A 
Sbjct: 372 SHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMRAM 431

Query: 399 XXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNS 458
                    +++  S     +F + + +  +  + +WISI +++I F +A I Q      
Sbjct: 432 LVSCVFGLISFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPIGE 491

Query: 459 FAYRAPFQPYGAYITLFF--CVLIA--FIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFG 514
             Y++     G+Y   F   C+LI   ++    +   + D  SF   Y+ LPL+V+ YFG
Sbjct: 492 LGYKSQTGVAGSYYATFIMGCILIGQFWVAIAPMGSAKLDANSFFENYLALPLFVVLYFG 551

Query: 515 YKIIYKT-KL-VKAEEADLYSFKEAIDR 540
           +KI  +  +L +  E+ DL S ++  D 
Sbjct: 552 FKIWKRDWRLYIPLEQIDLDSHRKTFDE 579

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  238 bits (606), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 152/523 (29%), Positives = 249/523 (47%), Gaps = 27/523 (5%)

Query: 30  SFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASIL 89
             E +D  N ++  ++    LK  +K RH++MI++                    PA ++
Sbjct: 51  DLEGKDADNGLNKTQQT---LKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPAGLV 107

Query: 90  IAYSFVGILVF-FVMACLGEMATYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITP 147
           I Y     +++  V AC      Y  L G + +Y T   D   GFAV   Y  ++  + P
Sbjct: 108 IGYVTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLP 167

Query: 148 NQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFG 207
            +L   ++ ++YW    +VNP V++ IF V ++ I+  G R + E EF  +S K+++M G
Sbjct: 168 LELVTASMTVKYWTS--SVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAG 225

Query: 208 VILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKG--KFVSFVAVFVYALFAY 265
            I+ + I +  G      +G +YW +PGAF        G +   +F    +V+V A FAY
Sbjct: 226 FII-MAISLTAGASEQGYIGGQYWHDPGAFG-------GDRAIDRFKGICSVWVQAAFAY 277

Query: 266 LGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXX 325
            G E   + AAE  NPR ++P+A K  +YR+++ +++ + L+G  V +N  +LL      
Sbjct: 278 GGSEFIALTAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGS 337

Query: 326 XXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLF 385
                 PFV+A    GVR +PHI N  +L  V S  NS +Y   R L SLA  G  PK+F
Sbjct: 338 GSRAS-PFVIAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIF 396

Query: 386 AKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFF 445
              +R G P             A++  S+    +F +   +  +  + +W +I ++++ F
Sbjct: 397 TYVDRQGRPLVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRF 456

Query: 446 YRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI------GEFDYKSFI 499
            RA   Q        YRA     G+Y  +FF V++  I  F + I      GE D + F 
Sbjct: 457 RRAMRVQGRSLGELGYRANTGALGSYYAIFFNVIV-LIAQFWIAIAPIPKHGELDVEFFF 515

Query: 500 TGYIGLPLYVIFYFGYKIIYKT--KLVKAEEADLYSFKEAIDR 540
             Y+  P+ V+FY GYK+  +    ++ + E DL S ++  D 
Sbjct: 516 QNYLAFPVLVVFYLGYKLWKRDFRLVIPSSEVDLLSHRQIFDE 558

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  238 bits (606), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 159/519 (30%), Positives = 255/519 (49%), Gaps = 30/519 (5%)

Query: 25  TSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXX 84
            S L+SF++++  +  +  + D   L K +++RH+ MI++                    
Sbjct: 62  ASFLDSFKRKEHDDSTAGDEND---LNKAIRSRHLIMISLGTGIGTGLLVGTGSVLSQSG 118

Query: 85  PASILIAYSFVGILVFFVMACLGEMA-TYIPLDG-FTSYATRYCDPALGFAVGYCYLFKY 142
           P  ++I Y    ++VF ++   GE+   Y  + G FT Y T   DPA GFA+ + Y  ++
Sbjct: 119 PLGLIIGYIVSSLMVFLIIQAAGELGIVYSNVVGNFTRYPTILVDPAFGFAISFLYTIQW 178

Query: 143 FIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKI 202
            I+ P QL   A+ IQ+W     VN  V++    VV+V+IN  G R + E EF+ +  KI
Sbjct: 179 MIVLPLQLVTAAMTIQFW--NVGVNLDVFVLASFVVVVLINLGGARGYVEAEFFCNLCKI 236

Query: 203 MVMFGVILFLFIIMLGGGPNHDR--LGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVY 260
           +++ G ++   II  GG PN     +G +YW+NPG F        G KG      +VF Y
Sbjct: 237 VMLTGFVILGIIITAGGIPNGPDGYIGGKYWRNPGLFA------NGFKG----VCSVFCY 286

Query: 261 ALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLX 320
           A F+Y G+E   + AAE +NP ++IP A K  MYRI+  Y++++ ++   V Y  P L+ 
Sbjct: 287 AAFSYGGVETLVLSAAEQKNPLKSIPSATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMG 346

Query: 321 XXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGK 380
                      PFV+AI + GV  +PH+ N  +LI V S  NS LYV  R L SLA  G 
Sbjct: 347 SSGSGSHSS--PFVIAIASHGVSVVPHLINAVILISVLSVANSALYVAPRLLLSLAQGGS 404

Query: 381 APKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILI 440
           APK     ++ G P              ++  S     +F + +++  +  I  WISI +
Sbjct: 405 APKFLNYIDKRGRPTTCTLVVVLFGMIGFVAASDKREVVFTWLLSISGLGQIFIWISICV 464

Query: 441 TYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI------GEFD 494
           ++I F  A   Q       AY+A    +G+Y+ +   + +  +  F V I      G+ D
Sbjct: 465 SHIRFRDAMRVQGHPLTEIAYKAQTGYWGSYVAIALALFV-LVCQFWVAIAPVGAHGKLD 523

Query: 495 YKSFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADL 531
             +F   Y+  P+ +  Y G+K+ YK    L+ A++ +L
Sbjct: 524 ATNFFQNYLAFPVVLCAYLGFKVYYKQWQLLIPADKIEL 562

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  238 bits (606), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 170/570 (29%), Positives = 277/570 (48%), Gaps = 50/570 (8%)

Query: 5   EVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGK----EDGVR----------- 49
           E   D  +++E    LE      LNS+  + D++++   +    +D  R           
Sbjct: 4   EKKLDYSIVQET--QLEPGEFDELNSYVSQSDTSRVGGTRWERFKDSFREAETVDLDPSL 61

Query: 50  --------------LKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFV 95
                         LK+ LK+RH+ MI I                    PA ILI ++  
Sbjct: 62  TPAEKMAILTANAPLKRTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALT 121

Query: 96  GILVFFVMACLGEMATYIPL-DGFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGA 154
           G +++ ++  +GE+A   P+  G+T+YA+R+ D + GFA    Y   + I  P ++ A +
Sbjct: 122 GTMIYCMVMAMGELAVTFPVAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAAS 181

Query: 155 LVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFI 214
           + + YW          ++ +F VVIV IN  GV+ +GE EF  S  K++ + G I+   I
Sbjct: 182 ITVNYWGTPAKYRDA-FVALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVI 240

Query: 215 IMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIV 274
           ++ GGGP    +G R W NPGAF        G KG      +VFV A F++ G EL G+ 
Sbjct: 241 LVCGGGPQGGYIGGRLWHNPGAFA------NGFKG----VCSVFVTAAFSFAGSELVGLA 290

Query: 275 AAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFV 334
           AAE  NPR++IP A K   +RI LFYI+ + ++G+ V Y   RL+            PFV
Sbjct: 291 AAETANPRKSIPSAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAAS--PFV 348

Query: 335 VAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVP 394
           ++IQN+G++ LP + NV +LI V S  N  ++  +RS+ +LA  G  PK+F   +R G P
Sbjct: 349 ISIQNAGIKGLPSVINVVILIAVLSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRP 408

Query: 395 YNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNV 454
                        +++  S    ++F++ + +  +  + +W  IL+ +I   RA  AQN 
Sbjct: 409 LVGIVVTCVFGLLSFIAASPKEGEVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNR 468

Query: 455 DRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI---GEFDYKSFITGYIGLPLYVIF 511
                ++ AP   +G+  +L   +LI   + +       G+    +F   Y+  P+Y++F
Sbjct: 469 TTAELSFTAPTDVWGSVYSLILIILILIAQFWIALFPIGGKPSAAAFFEAYLSFPIYIVF 528

Query: 512 YFGYKIIYKT-KL-VKAEEADLYSFKEAID 539
           Y G+KI  K  KL +KA + D+ S +   D
Sbjct: 529 YIGHKIWKKNWKLFIKASDIDIDSGRRETD 558

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  237 bits (605), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 159/554 (28%), Positives = 274/554 (49%), Gaps = 35/554 (6%)

Query: 2   SVYEVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKIS-DGKEDGVRLKKELKARHIS 60
           +V  V K    + E+   LE++ T+      +  DS K   DG  D   LK+ LK+RH+ 
Sbjct: 19  AVQRVLKKRSSVLEESRLLEESRTNKRGLVRRCIDSFKPPVDGSFDPDNLKRTLKSRHLI 78

Query: 61  MIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FT 119
           MIAI                    P ++LI ++  G  +   +  LGE+    P+ G F 
Sbjct: 79  MIAIGGSIGTGLFIGSGKALATGGPLAVLIGWTLAGTQMVGTIHGLGEVTVRFPVVGAFA 138

Query: 120 SYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVI 179
           +Y+TR+ DP++ F V   Y+ ++F + P ++ A A+ +++W    +V+P VW+ +F  +I
Sbjct: 139 NYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIASAITMEFWTT--SVDPVVWVAVFYTLI 196

Query: 180 VIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKP 239
           + IN  GVR+FG+ +F  S  K++ + G I+   +++LGGGP H+ +G RYW +PGA   
Sbjct: 197 ISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLVLILGGGPTHEFIGARYWHDPGALA- 255

Query: 240 YSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILF 299
                 G KG      AV V A ++  G E+T +  A  E   + IP AIK   +RII F
Sbjct: 256 -----NGFKG----VAAVMVTASYSLGGSEMTCL--ASGETDPKEIPHAIKQIFWRIIFF 304

Query: 300 YIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFS 359
           ++V++ L+G  V Y + +LL            PFV+AI+   +R LPHI N  +L+ + S
Sbjct: 305 FLVSLTLVGFLVPYTNDQLL----GGSNVNNSPFVIAIKMHNIRVLPHIINGVILVSILS 360

Query: 360 ACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQI 419
             NS ++  +R+L S+A  G  P++F   +R G P             A++  SS +  +
Sbjct: 361 VGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTGILTNSLFGLLAFLVKSSSTGTV 420

Query: 420 FNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVL 479
           F + + V  +   + W+SI +++I F  A  AQ    +   + +    +G+  +    V+
Sbjct: 421 FTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLDELEFVSAVGMWGSVYSGVMNVV 480

Query: 480 IAFIKNFTVFIGEFD--------YKSFITGYIGLPLYVIFYFGYKIIYKT------KLVK 525
           +  +  F V +   +         ++F   Y+   + +  +  +KI Y++      K++ 
Sbjct: 481 V-LVAQFYVSLWPIEGWKDPRGRTEAFFQNYLCALILLFMFVAHKIYYRSTTGQWWKILP 539

Query: 526 AEEADLYSFKEAID 539
             E DL S ++ ID
Sbjct: 540 LAEIDLESGRKNID 553

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  239 bits (610), Expect = 6e-70,   Method: Compositional matrix adjust.
 Identities = 151/534 (28%), Positives = 257/534 (48%), Gaps = 24/534 (4%)

Query: 18  IDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXX 77
           +D E N  SS  + +    + +  + K++   LKK +K RH  M+++             
Sbjct: 115 LDNELNRKSSYITVDGIKQAPQEQEQKQE--NLKKSIKPRHTVMMSLGTGIGTGLLVGNS 172

Query: 78  XXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIP--LDGFTSYATRYCDPALGFAVG 135
                  P  ++I Y+ +G  V+ ++   GE+A      + GF +Y     DPALGF+V 
Sbjct: 173 KVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPLFLVDPALGFSVA 232

Query: 136 YCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEF 195
           + +  ++  + P +L   ++ I+YW  +  V+P V++ IF V+I++IN  G + + E +F
Sbjct: 233 WLFCLQWLCVCPLELVTASMTIKYWTVK--VDPDVFVVIFYVLIIVINVFGAKGYAEADF 290

Query: 196 WLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFV 255
           + +  KI+++ G  +   II  GG      +G +YW++PGAF+  +        +F   V
Sbjct: 291 FFNCCKILMIIGFFILAIIIDCGGAGTDGYIGSKYWRDPGAFRGDT-----PIQRFKGIV 345

Query: 256 AVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYND 315
           A FV A FA+   E   + A+E  NPR+ IP A K  +YRI+  ++ ++ L+G  V Y  
Sbjct: 346 ATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASLTLVGFLVPYTS 405

Query: 316 PRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSL 375
            +LL            P+V+A+ + GVR +PH  N  +L+ V S  NS  Y  +R L SL
Sbjct: 406 DQLLGAAGSATKAS--PYVIAVSSHGVRVVPHFINAVILLSVLSVANSAFYTSSRILMSL 463

Query: 376 AIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSW 435
           A  G APK F   +R G P  A          A+   S     +F + + +  +  + +W
Sbjct: 464 AKQGNAPKCFDYIDREGRPAVAMLVSALFGVIAFCASSKKEEDVFTWLLAISGLSQLFTW 523

Query: 436 ISILITYIFFYRACIAQNVDRNSFAYRAPFQPYG-AYITLFFCVLIAFIKNFTVFI---- 490
           I+I +++I F RA   Q        Y++    +G AY  L   +++A I  F V I    
Sbjct: 524 ITICLSHIRFRRAMKVQGRSLGEVGYKSQVGVWGSAYAVLM--MMLALIAQFWVAIAPIG 581

Query: 491 --GEFDYKSFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADLYSFKEAIDR 540
             G+   +SF   Y+ +P+ +  Y  +K+     +  + A + DL S +   D 
Sbjct: 582 GGGKLSAQSFFENYLAMPILIALYIFFKVWKNDWSLFIPANKVDLVSHRNIFDE 635

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  236 bits (603), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 158/558 (28%), Positives = 268/558 (48%), Gaps = 43/558 (7%)

Query: 2   SVYEVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKIS-DGKEDGVRLKKELKARHIS 60
           SV   TK +    ED            N F++  DS K   DG  D   LK+ LKARH+ 
Sbjct: 36  SVVATTKHAHDEYEDNFPGNGFYQPPRNIFQRCIDSFKPPLDGSFDTNNLKRSLKARHLI 95

Query: 61  MIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FT 119
           MIAI                    P +++I ++  G  +   +  LGE+    P+ G F 
Sbjct: 96  MIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWAIAGSQIIGTIHGLGEITVRFPVVGAFA 155

Query: 120 SYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVI 179
           +Y+TR+ DP+L F +   Y+ ++F + P ++ + A+ +QYW   ++++P VW+ IF   I
Sbjct: 156 NYSTRFLDPSLSFVISTIYVIQWFFVLPLEIISSAMTVQYW--NQSIDPVVWVAIFYCAI 213

Query: 180 VIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKP 239
           V IN  G R FGE EF  SS K++ + G I+   +++ GGGP+HD +G +YW +PG    
Sbjct: 214 VSINLFGARGFGEAEFVFSSVKVLTICGFIILCIVLICGGGPDHDFVGAKYWHDPGCLAH 273

Query: 240 YSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILF 299
                      F   ++V V A ++  G E+  +  A  E   + +P AIK T +RI+ F
Sbjct: 274 ----------GFPGVLSVLVVASYSLGGTEM--VCLASGETDPKELPSAIKQTFWRILFF 321

Query: 300 YIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFS 359
           ++V++ L+G  V Y +  LL            PFV+AI+   ++ LP I N  +LI + S
Sbjct: 322 FLVSLTLIGFLVPYTNENLL----GGSSVNNSPFVIAIKLHQIKVLPSIVNAVILISILS 377

Query: 360 ACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQI 419
             NS ++  +R+L S+A  G  P+ F   +R G P             A++  SS  +++
Sbjct: 378 VGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTGIITNSLFGLLAFLVKSSSMSEV 437

Query: 420 FNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGA--------- 470
           F++ + +  +   + W+SI I++I F  A  AQ    +   + +    +G+         
Sbjct: 438 FDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLDELEFVSAVGIWGSAYSAVINSL 497

Query: 471 -YITLFFCVL--IAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTK----- 522
             +  F+C L  I   +N ++       K F   Y+   + ++ + G+KI Y+ K     
Sbjct: 498 ILVAQFYCALWPIGGWENSSI-----RAKKFFQSYLCALIMIVLFVGHKIFYRYKTGKWW 552

Query: 523 -LVKAEEADLYSFKEAID 539
            ++   + DL + ++ ID
Sbjct: 553 SMLPLNKIDLETDRKNID 570

>ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]
           {ON} similar to uniprot|P38090 Saccharomyces cerevisiae
           YBR132C AGP2 Plasma membrane carnitine transporter
           expression is down-regulated by osmotic stress also
           functions as a low-affinity amino acid permease
          Length = 578

 Score =  236 bits (601), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 146/547 (26%), Positives = 266/547 (48%), Gaps = 18/547 (3%)

Query: 6   VTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDG-----KEDGVRLKKELKARHIS 60
           +    K   +D++  + +   ++N+  +  +S+++ +G     +     ++++LK RH+ 
Sbjct: 1   MVNPQKSFEQDLVPKKSSWVETVNT--EASESSEVENGGVVNFERSTRHVQRKLKNRHVQ 58

Query: 61  MIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FT 119
           +I+I                     A++L+ ++   I +  +  C  EM  ++P+   F 
Sbjct: 59  LISISGVIGTALFVSIGKALYHGGAANLLLGFAIWCIPIMCITVCTAEMVCFLPVSSPFL 118

Query: 120 SYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVI 179
             A    D +LG    + + F   +  P ++ +   +I YW  R+  N  + + + LV+ 
Sbjct: 119 RLAHMCVDDSLGVMASWNFWFLECVQIPYEIVSVNTIIHYW--RDDYNAAIPLVVQLVLY 176

Query: 180 VIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKP 239
             I+   VRY+GE EFWL+SFKI++  G+  F F+ MLGG P HDR GFRY+     FK 
Sbjct: 177 GFISLCTVRYYGEAEFWLASFKIVLAIGLYFFTFVTMLGGNPRHDRYGFRYYGE-APFKK 235

Query: 240 YSESITGSK--GKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRII 297
           Y  +  GS   G F  F+A  + A F   G E   ++A E   PR+ +PRA K    R+ 
Sbjct: 236 YWPNGHGSNASGHFQGFLACVIQAAFTVAGGEYVSMLAGEVVLPRKVMPRAFKQVFIRLT 295

Query: 298 LFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXX-XXPFVVAIQNSGVRALPHIFNVCVLIF 356
           + ++ +   +G+  + NDP L              P+V+A+++  +  LP I N  ++  
Sbjct: 296 VLFLGSCLCVGILCSPNDPDLTAAINESRPGAGSSPYVIAMKHLHIHVLPDIVNAALITA 355

Query: 357 VFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGS 416
            FS+ N+  Y  +R+LY +A+DG APK+FA+    G P  A          + + +   S
Sbjct: 356 AFSSGNAYTYCSSRTLYGMALDGYAPKIFARCTPQGTPIFAMAVSMCWGFLSLLQLGDNS 415

Query: 417 AQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFF 476
           A + N+ +N+++   +++++ + +TY+FF R       +     +++ +QP+ AYI +  
Sbjct: 416 AVVLNWLINLITTSQLINFVILCVTYLFFRRVYKVNEHNLPRLPFKSWWQPWPAYIGIIC 475

Query: 477 CVLIAFIKNFTVFIGE-FDYKSFITGYIGLPLYVIFYFGYKIIY---KTKLVKAEEADLY 532
              + FI+ + VF    +  K F+  Y+ L + +  Y GYK I+   K KL    E + +
Sbjct: 476 AGSMTFIQGYAVFFSSLWSTKQFLFSYLMLFIDIGLYLGYKFIWRRGKDKLRNPTEVNFF 535

Query: 533 SFKEAID 539
                ID
Sbjct: 536 PLLAEID 542

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  238 bits (606), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 154/544 (28%), Positives = 261/544 (47%), Gaps = 26/544 (4%)

Query: 7   TKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXX 66
           TKDS       +D E N  SS  + +    S++  + K++   LKK +K RH  M+++  
Sbjct: 108 TKDSS----SRLDNELNPKSSYITVDGIKQSSQEQEPKQE--NLKKSIKPRHTVMMSLGT 161

Query: 67  XXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIP--LDGFTSYATR 124
                             P  ++I Y+ +G  V+ ++   GE+A      + GF +Y + 
Sbjct: 162 GIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQACGELAVIYSDLIGGFNTYPSF 221

Query: 125 YCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINT 184
             DPA+GF+V + +  ++  + P +L   ++ I+YW  +  VN  V++ IF V+I++IN 
Sbjct: 222 LVDPAVGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVK--VNADVFVIIFYVLILVINI 279

Query: 185 VGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESI 244
            G + + E +F+ +  KI+++ G  +   II  GG      +G RYW++PGAF+  +   
Sbjct: 280 FGAKGYAEADFFFNCCKILMITGFFILAIIIDCGGAGTDGYIGSRYWRDPGAFRGDT--- 336

Query: 245 TGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTI 304
             S  +F   VA FV A FA+   E   + A+E  NPR+ IP A K  +YRI+  ++ ++
Sbjct: 337 --SIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAIPSAAKKMIYRILFVFLASL 394

Query: 305 FLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSD 364
            L+G  V Y   +LL            P+V+A+ + GVR +PH  N  +L+ V S  NS 
Sbjct: 395 ALVGFLVPYTSDQLLGAAGSATKAS--PYVIAVSSHGVRVVPHFINAVILLSVLSVANSA 452

Query: 365 LYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFV 424
            Y  +R L SLA  G APK F   +R G P  A          A+   S     +F + +
Sbjct: 453 FYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMIVSAVFGVIAFCASSKKEEDVFTWLL 512

Query: 425 NVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIK 484
            +  +  + +WI+I +++I F +    Q        Y++    +G+   +   VL A I 
Sbjct: 513 AISGLSQLFTWITICLSHIRFRKGMKVQGRSLGEVGYKSQVGVWGSAYAVVLMVL-ALIG 571

Query: 485 NFTVFIG------EFDYKSFITGYIGLPLYVIFYFGYKIIYK--TKLVKAEEADLYSFKE 536
            F V I       +   +SF   Y+ +P+ +  Y  YK+  +  +  + A++ DL S + 
Sbjct: 572 QFWVAISPIGGDKKLSAQSFFENYLAMPILIALYIFYKVWKRDWSLFIPADKIDLVSHRN 631

Query: 537 AIDR 540
             D 
Sbjct: 632 IFDE 635

>YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}
           TAT1Amino acid transport protein for valine, leucine,
           isoleucine, and tyrosine, low-affinity tryptophan and
           histidine transporter; overexpression confers FK506 and
           FTY720 resistance
          Length = 619

 Score =  236 bits (603), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 165/539 (30%), Positives = 262/539 (48%), Gaps = 34/539 (6%)

Query: 9   DSKLIREDIIDLEKNTTSSLNSFEQE--DDSNKISDGKEDGVRLKKELKARHISMIAIXX 66
           DSK I      L++      +SF+++   D N   + +E    L K +K+RH+ MI++  
Sbjct: 54  DSKSI------LQRKCKEFFDSFKRQLPPDRNSELESQEKN-NLTKSIKSRHLVMISLGT 106

Query: 67  XXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMA-TYIPLDG-FTSYATR 124
                             PA +++ Y    I+++ ++   GE+   Y  L G +T Y + 
Sbjct: 107 GIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQAAGELGLCYAGLTGNYTRYPSI 166

Query: 125 YCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINT 184
             DP+LGFAV   Y  ++  + P QL   A+ ++YW    +VN  +++ +  V ++IIN 
Sbjct: 167 LVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWT---SVNADIFVAVVFVFVIIINL 223

Query: 185 VGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESI 244
            G R + E EF  +S KI+++ G ++   II  GG  +   +G  YW NPG F       
Sbjct: 224 FGSRGYAEAEFIFNSCKILMVIGFVILAIIINCGGAGDRRYIGAEYWHNPGPFA------ 277

Query: 245 TGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTI 304
            G KG       VF YA F+Y GIE+  + AAE ENP ++IP A K  +YRI+L Y++T 
Sbjct: 278 HGFKG----VCTVFCYAAFSYGGIEVLLLSAAEQENPTKSIPNACKKVVYRILLIYMLTT 333

Query: 305 FLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSD 364
            L+   V YN   LL            PFV+A+ + GV+ +PH  N  +LI V S  NS 
Sbjct: 334 ILVCFLVPYNSDELLGSSDSSGSHAS-PFVIAVASHGVKVVPHFINAVILISVISVANSS 392

Query: 365 LYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFV 424
           LY G R L SLA  G  PK  A  +R G P              ++  S    Q+F + +
Sbjct: 393 LYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFFVSLVFGCIGFVATSDAEEQVFTWLL 452

Query: 425 NVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIK 484
            + S+  +  W+S+ +++I F  A   Q    N   Y+A    +G+++ +   +    + 
Sbjct: 453 AISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQTGYWGSWLAVLIAIFF-LVC 511

Query: 485 NFTVFI------GEFDYKSFITGYIGLPLYVIFYFGYKIIYKTK--LVKAEEADLYSFK 535
            F V I      G+ + K F   Y+ +P+ +  YFG+KI +K+    + AE+ DL S +
Sbjct: 512 QFWVAIAPVNEHGKLNVKVFFQNYLAMPIVLFAYFGHKIYFKSWSFWIPAEKIDLDSHR 570

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  236 bits (602), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 152/527 (28%), Positives = 261/527 (49%), Gaps = 23/527 (4%)

Query: 5   EVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKED---GVRLKKELKARHISM 61
           E+ + S+  R  ++    ++     S   E+D N + DG +       LKK +K+RH+ M
Sbjct: 39  EIKEHSEESRNGLVHRFVDSFRRAESQRLEED-NDLEDGTKSMKSNNHLKKSMKSRHVVM 97

Query: 62  IAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMA-TYIPLDG-FT 119
           +++                    P S++I Y  V  + +F++   GEM  TY  L G F 
Sbjct: 98  MSLGTGIGTGLLVANAKGLSLAGPGSLVIGYVMVSFVTYFMVQAAGEMGVTYPTLPGNFN 157

Query: 120 SYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVI 179
           +Y + +   + GFA  + +  ++  + P +L   ++ ++YW D  T+N  V+I IF V +
Sbjct: 158 AYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTVKYWND--TINADVFIVIFYVFL 215

Query: 180 VIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKP 239
           + I+  GV+ +GE EF  +S KI+++ G I+   +I  GG      +G +YW++PG+F  
Sbjct: 216 LFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGYIGGKYWRDPGSFAE 275

Query: 240 YSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILF 299
            S +      +F     + V A F++ GIEL  +   E  NPR++ P A K ++YRI++ 
Sbjct: 276 GSGAT-----RFKGICYILVSAYFSFGGIELFVLSINEQSNPRKSTPVAAKRSVYRILII 330

Query: 300 YIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFS 359
           Y++T+ L+G  V +N+ +L+            P+V+A     VR +PHI N  +LI V S
Sbjct: 331 YLLTMILIGFNVPHNNDQLMGSGGSATHAS--PYVLAASIHKVRVIPHIINAVILISVIS 388

Query: 360 ACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQI 419
             NS LY   R + SLA  G APK     +R G P  A           ++  S    Q 
Sbjct: 389 VANSALYAAPRLMCSLAQQGYAPKFLNYIDREGRPLRALVVCSLVGVVGFVACSPQEEQA 448

Query: 420 FNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVL 479
           F +   +  +  + +W  I++++I F +A   Q    +   Y+A    +G+Y  +FF +L
Sbjct: 449 FTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQGRSLDEVGYKANTGIWGSYYGVFFNML 508

Query: 480 IAFIKNFTVFI------GEFDYKSFITGYIGLPLYVIFYFGYKIIYK 520
           + F+  F V +      G+ D ++F   Y+  PL++  Y GY ++YK
Sbjct: 509 V-FMAQFWVALSPIGNGGKCDAQAFFESYLAAPLWIFMYVGY-MVYK 553

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  236 bits (603), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 169/549 (30%), Positives = 271/549 (49%), Gaps = 39/549 (7%)

Query: 19  DLEKNTTSSLN--------SFEQEDDS----------NKISDGKEDGVRLKKELKARHIS 60
           DLE + T+S++        S  +EDD            K+++ + D   L+K +K RH+ 
Sbjct: 75  DLENDITTSISHASLVHAVSKAREDDEIMQSVASAEHRKVNNTESD--DLQKTIKPRHVI 132

Query: 61  MIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMAT-YIPLDG-F 118
           MI++                    PA ++I YS +G  ++ ++   GEMA  Y  L+G F
Sbjct: 133 MISLGTGIGTGLLVGNSSVLSAAGPAPLVIGYSIMGSCLYCIIQAAGEMAVVYSDLNGGF 192

Query: 119 TSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVV 178
            +Y +   DPALGF+V + Y  ++  + P +L   +L I+YW  +  V+P V++ IF V+
Sbjct: 193 NNYPSFLLDPALGFSVAWVYCLQWLCVCPLELVTASLTIKYWTTK--VDPDVFVIIFYVL 250

Query: 179 IVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFK 238
           I+ IN  G R + E EF+ +  K+++M G  +   II  GG  N   LG +YW  PGAF+
Sbjct: 251 IISINVFGARGYAEAEFFFNVCKVLMMIGFFILGIIITAGGAGNDGYLGAKYWHEPGAFR 310

Query: 239 PYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIIL 298
                   +  +F   +  FV A FA+   E   + AAE  NPR+ IP A K  +YRI+L
Sbjct: 311 G-----EHAVDRFKGVMDTFVAAAFAFGATEFIALTAAEQSNPRKAIPSAAKKVLYRIVL 365

Query: 299 FYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVF 358
            ++V+I +LG  V Y+  +LL            P+V+A+   GVR +PH  N  +L+ V 
Sbjct: 366 IFLVSIIMLGFLVPYDSDQLLGSSGSGVKAS--PYVLAVSLHGVRVVPHFINAVILLSVL 423

Query: 359 SACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQ 418
           S  NS  Y  +R L SL+  G APK F   +R G P  A          A+   S     
Sbjct: 424 SVGNSAFYSSSRLLLSLSQQGYAPKWFDYVDRQGRPARAMLMSALFGVIAFCATSPKETD 483

Query: 419 IFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCV 478
           +FN+ + +  +  + +W +I ++++ F  A   Q        + +    YG+       +
Sbjct: 484 VFNWLLAISGLSQLFTWFAICMSHVRFRYAMKVQGRSIGEVGFHSQTGVYGSLYAATMMI 543

Query: 479 LIAFIKNFTVFI-----GEFDYKSFITGYIGLPLYVIFYFGYKIIYKT-KL-VKAEEADL 531
           L A +  F V I     G+ D ++F   Y+ +P+ +  YFGYK+ Y+  KL +KA++ DL
Sbjct: 544 L-ALMAQFWVAIAPLNEGKLDAQNFFQSYLAMPILIALYFGYKLYYRDWKLYIKADKIDL 602

Query: 532 YSFKEAIDR 540
            S ++  D 
Sbjct: 603 ISHRQIFDE 611

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  236 bits (601), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 150/520 (28%), Positives = 256/520 (49%), Gaps = 25/520 (4%)

Query: 36  DSNKISDGKEDGVR-----LKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILI 90
           D N +S+ ++  +R     L + LK RH+ MIAI                    PA +LI
Sbjct: 65  DPN-LSEAEKLAIRTAAAPLSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLI 123

Query: 91  AYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQ 149
            +     ++  +   LGE+A   P+ G + +YA R+ D + GFA  + Y+ +  ++ P +
Sbjct: 124 GWGLTATMILIMCLSLGELAVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLE 183

Query: 150 LTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVI 209
           + A ++ + YW D +      ++ +F VVIV IN  GVR FGE E   S  K++ + G I
Sbjct: 184 IVAASVTVGYW-DTDPKYKLAFVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFI 242

Query: 210 LFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIE 269
           +   +++ GGGP+H+ +G +YW +PG F   + S      KF    +VFV A F++ G E
Sbjct: 243 IMGVVLISGGGPDHEVIGGKYWNDPGPFVGNAPS-----DKFKGVCSVFVTAAFSFAGSE 297

Query: 270 LTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXX 329
           L G+ AAE   PR++IP+A K   +RI LFYI+++ ++G+ V  N+  LL          
Sbjct: 298 LIGLAAAETREPRKSIPKAAKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAHS 357

Query: 330 XXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTN 389
             PFV+A+    +R LP I NV +L  V S  NS +Y  +R++ +LA  G  PK+F   +
Sbjct: 358 --PFVIAMDMHRIRVLPSIINVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYID 415

Query: 390 RWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRAC 449
           R G P  A           ++  +    +IF++ + +  +    +W++I + ++ F  A 
Sbjct: 416 RKGRPLFAICFTSLFGLLCFVAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMAL 475

Query: 450 IAQNVDRNSFAYRAPFQPYGA-YITLFFCVLIAFIKNFTVFIGEFDYKS-------FITG 501
            AQ    N  ++ +P    G+ Y     CV++       ++    D  S       F   
Sbjct: 476 KAQGRTTNELSFTSPTGFIGSCYAVGLICVVLVAQFWVALYPPSPDGTSAKPSPILFFKQ 535

Query: 502 YIGLPLYVIFYFGYKIIYKTK--LVKAEEADLYSFKEAID 539
           Y+   + ++ Y  +KI  +     +KA+E D+ + +  +D
Sbjct: 536 YLSFAVAIVMYLAHKIWSRNWKFFIKAKEMDIDTGRRELD 575

>AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YBR132C (AGP2)
          Length = 566

 Score =  234 bits (598), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 139/489 (28%), Positives = 253/489 (51%), Gaps = 12/489 (2%)

Query: 52  KELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMAT 111
           ++L+ RH+ +I I                      S+L+ ++   + +  +     EM  
Sbjct: 55  RKLENRHVQLIGISGVIGTALFVSIGKALYRGGSVSLLLGFALWCVPILCITVSTAEMVC 114

Query: 112 YIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGV 170
           Y+PL+  F   A+R  + +L    G+ + F   +  P ++ A   +I YW  R+  +  +
Sbjct: 115 YLPLNSPFLRLASRCVNDSLTVMAGWNFWFLECVQIPFEIVAVNSIIHYW--RDDYSAAI 172

Query: 171 WITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRY 230
            + + +++ ++I+   VRY+GE EFWL+SFK+++  G+  F F+ M+GG P  DR GFRY
Sbjct: 173 TLVVQVMLYLLISLFAVRYYGEIEFWLASFKVLLAVGLFCFTFVTMVGGNPKRDRYGFRY 232

Query: 231 WKNPGAFKPYS---ESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPR 287
                 FK YS   E I+ S G F  F+A  + A F   G +   ++A E + PR+ +P 
Sbjct: 233 -IGEAPFKQYSPTMEPISSSAGYFQGFLACLIQASFTIAGPDYVSMIAGETKLPRKVLPV 291

Query: 288 AIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXX-XXPFVVAIQNSGVRALP 346
           A K    R+ + ++     +G+  + NDP L              P+V+A+ + G++ LP
Sbjct: 292 AFKQVFIRLTVLFLGGCLCVGIVCSANDPDLTAAINASRPGAGSSPYVIAMNHLGIKILP 351

Query: 347 HIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXX 406
            I N  ++   FSA N+  Y  +RSLY LA+DG AP +F + NR+GVP  A         
Sbjct: 352 DIVNAALVTAAFSAGNAYTYCSSRSLYGLALDGYAPAIFKRCNRFGVPIYAVSVSVMWSV 411

Query: 407 XAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQ 466
            + + ++S SA + N+ +++++   ++++  + + Y++F RA +AQ  +    ++++ +Q
Sbjct: 412 LSLLQLNSNSAVVLNWLISLITASQLINFGVLCVVYLYFRRAYLAQQDNLPELSFKSWWQ 471

Query: 467 PYGAYITLFFCVLIAFIKNFTVFIGE-FDYKSFITGYIGLPLYVIFYFGYKIIY---KTK 522
           PY AY+ L   +LI  ++ +TVF    ++ K F+  Y+ + + +  Y GY+ I+   K  
Sbjct: 472 PYTAYVGLTCVLLIVVVQGYTVFYSALWNVKDFLFCYLMVFIDIAIYLGYRYIWRRGKDA 531

Query: 523 LVKAEEADL 531
           ++   E DL
Sbjct: 532 VIPPTEVDL 540

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  234 bits (597), Expect = 4e-69,   Method: Compositional matrix adjust.
 Identities = 169/541 (31%), Positives = 248/541 (45%), Gaps = 41/541 (7%)

Query: 1   MSVYEVTKDSKLIREDIIDL---EKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKAR 57
           M  YEV       R D +     E+  T ++ SFEQ D +  +          K+ LK R
Sbjct: 2   MKTYEVACFKDESRSDDLSKFSKEEPDTHNIKSFEQFDPNTGV----------KRALKNR 51

Query: 58  HISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-D 116
           HIS++A+                    P S+L+ +  +GI+ F VM  +GEM T  P   
Sbjct: 52  HISLLALGGIIGPGCLVGAGNALSKGGPLSLLLGFGIIGIVAFAVMESIGEMITLYPSGS 111

Query: 117 GFTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGV----WI 172
           GF++ + R+   AL    GY Y+  +F +  N+    + ++Q+W       P V    +I
Sbjct: 112 GFSTLSRRFHSDALSAVSGYAYVVVFFAVLANEYNTLSSILQFW------GPQVPLYGYI 165

Query: 173 TIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWK 232
            IF V   +   +GV  FGEFE+WL+ FKI+ +    +F  I + GG  N    GF YW 
Sbjct: 166 LIFSVAFQVFQMLGVGIFGEFEYWLAWFKIIGLIAYYIFSIIYISGGIKNRPAFGFHYWN 225

Query: 233 NPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLT 292
           NPGA         G KG       VFV+    Y G E   + A E+ NP + +P AIK T
Sbjct: 226 NPGALA------DGFKG----IAVVFVFCSSFYSGTESVALAATESRNPGKAVPIAIKQT 275

Query: 293 MYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVC 352
            +RII+ Y+      G  V YND  L             P  +AI  +G     H+ N  
Sbjct: 276 FWRIIIVYLGIAVFYGATVPYNDTSL----GAHTKALKSPIAIAITRAGWEGGVHLVNAF 331

Query: 353 VLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNV 412
           +LI   SA N  LY+G+R+L  LA +G APK    T++ GVP  A          + MNV
Sbjct: 332 ILITCVSAINGSLYIGSRTLIYLAHEGLAPKFLKWTDKRGVPIPAITLFNALGLVSLMNV 391

Query: 413 SSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYI 472
           S G++  ++Y VN+  +   + W  I +T++ F +A   Q    +   Y++   P+G   
Sbjct: 392 SVGASNAYSYIVNLSGVGVFIVWGIISLTHLRFRKAWDLQGRSASELPYKSLLFPWGPIF 451

Query: 473 TLFFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKI--IYKTKLVKAEEAD 530
           +L   + +  I+ +T F+  F  K F+  YI LP  VI Y    +  I   KLV     D
Sbjct: 452 SLAANIFLGLIQGWTTFV-PFSAKDFVDAYILLPAAVILYIVISLVKIGGFKLVDLRTVD 510

Query: 531 L 531
           L
Sbjct: 511 L 511

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  235 bits (600), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 153/530 (28%), Positives = 252/530 (47%), Gaps = 30/530 (5%)

Query: 29  NSFEQEDDSNKISDGKEDG-------VRLKKELKARHISMIAIXXXXXXXXXXXXXXXXX 81
           NSF++  +  +  D   +G        +LK+ + +RH+ MI++                 
Sbjct: 51  NSFKRAGEHGRGGDVDAEGQPVAPRETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALH 110

Query: 82  XXXPASILIAYSFVGILVFFVMACLGEMA-TYIPLDG-FTSYATRYCDPALGFAVGYCYL 139
              PA + I Y+ +G  ++ ++   GEMA +Y  L G F +Y +   DPALGF+V + Y 
Sbjct: 111 NGGPAGLAIGYAIMGSCIYCIIQAAGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYC 170

Query: 140 FKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSS 199
            ++  + P +L    + I+YW     VNP V++ IF V+ V++N  G R + E EF+ ++
Sbjct: 171 LQWLCVLPLELVTATITIKYWTT--AVNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNT 228

Query: 200 FKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAF---KPYSESITGSKGKFVSFVA 256
            K++++ G  +   I+  GG  N   LG +YW +PGA    KP           F   +A
Sbjct: 229 CKVLMITGFFILGIIVNCGGAGNDGYLGGKYWHDPGALYGTKPIHH--------FKGIIA 280

Query: 257 VFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDP 316
             V A FA+   E   + AAE  NPRR IP A K  +YR++L ++  I LLG  V YN  
Sbjct: 281 TMVTAAFAFGATEFIALTAAEQANPRRAIPSAAKKIVYRVLLIFLAPIILLGFLVPYNSD 340

Query: 317 RLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLA 376
            L+            P+V+AI + GV+ +PH  N  +L+ V S  NS  Y  +R L SL+
Sbjct: 341 ELMGSGGSATHAS--PYVIAIASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLS 398

Query: 377 IDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWI 436
               AP      +R G P  A          A++  S     +F + + +  +  + +WI
Sbjct: 399 EQHYAPSWLNYIDREGRPIRAMLVSCIFGLIAFVAASPKEETVFTWLLAISGLSQLFTWI 458

Query: 437 SILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAY--ITLFFCVLIA--FIKNFTVFIGE 492
            I +++I F +A + Q        Y++     G+Y    +  CVL    ++    V   +
Sbjct: 459 CICVSHIRFRKALVVQGKSLGELGYKSQTGVVGSYYATVIMACVLTGQFWVAIAPVGTDK 518

Query: 493 FDYKSFITGYIGLPLYVIFYFGYKIIYKT-KL-VKAEEADLYSFKEAIDR 540
            D  +F   Y+ +P+ +  YFGY++  +  KL +  E+ DL S ++  D 
Sbjct: 519 LDANNFFENYLAMPILIALYFGYRVWKRDWKLYIPLEQIDLVSHRKVFDE 568

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  235 bits (599), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 156/542 (28%), Positives = 265/542 (48%), Gaps = 20/542 (3%)

Query: 8   KDSKLIREDIIDLEKNTTSSLN---SFEQEDDSNKISDGKEDGVRLKKELKARHISMIAI 64
            D   +  +  D +K   +S N   + E  + ++  SD ++   R  K+L  RH+  +A+
Sbjct: 27  NDMSPLTSEAPDFKKADAASGNESWALENVESTSGTSDAEDS--RYNKDLSVRHLLTLAV 84

Query: 65  XXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL-DGFTSYAT 123
                               P S++I +  +   +F ++  LGE+++  P+  GF  Y +
Sbjct: 85  GGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTIVNALGELSSTFPVVGGFNVYIS 144

Query: 124 RYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIIN 183
           R+ +P+ GFAV   YL ++ ++ P +L A +L I+YW    T+N   W+ IF  +I + N
Sbjct: 145 RFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYW--NSTINSDAWVAIFYTIIFLAN 202

Query: 184 TVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSES 243
            + V+ FGE EF LS  KI+ + G  +   ++  GGGP    +G +YW NPGAF   +  
Sbjct: 203 LLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPEGGYIGGKYWSNPGAFVGNT-- 260

Query: 244 ITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVT 303
              S  +F    +VFV A F+Y G EL  + AAE+ NPR  +P+A K T + I + YIV 
Sbjct: 261 ---SSQRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLPKACKRTFWLITVCYIVV 317

Query: 304 IFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNS 363
           + L+G  V  +DPRLL            P V+AI+N G++ LP + N  +LI V S  NS
Sbjct: 318 LTLVGCLVPSDDPRLL-HGSSSVDVAASPLVIAIENGGIKGLPSLMNAIILIAVLSVANS 376

Query: 364 DLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYF 423
            +Y  +R + S+A  G  PK F+  +R G P  A          +++  S+    +F + 
Sbjct: 377 AVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFGLLSFIAASNKQETVFTWL 436

Query: 424 VNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAY---ITLFFCVLI 480
             +  +  +  W +I +++I F      +    +   + +    +G+Y   + +F  +++
Sbjct: 437 SALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPFVSMTGVWGSYYGCVIIFVVLVV 496

Query: 481 AFIKN-FTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKT--KLVKAEEADLYSFKEA 537
            F    F    G    +SF   Y+  P+ ++ Y G+K+  K+   L    E D+ S + A
Sbjct: 497 CFWTALFPSTEGVASAESFFETYLSFPILLVCYIGHKLYTKSWRLLTPTTEIDIDSGRRA 556

Query: 538 ID 539
           +D
Sbjct: 557 VD 558

>Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON}
           YBR069C (REAL)
          Length = 618

 Score =  235 bits (599), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 155/526 (29%), Positives = 256/526 (48%), Gaps = 24/526 (4%)

Query: 20  LEKNTTSSLNSFEQEDDSNKISD-GKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXX 78
           L+       +SF+++  +++ S+   ++   L + +K+RH+ MI++              
Sbjct: 59  LQNECKKFFDSFKRQLPADQNSELESQERNNLTRSIKSRHLIMISLGTGIGTGLLVGNGQ 118

Query: 79  XXXXXXPASILIAYSFVGILVFFVMACLGEMA-TYIPLDG-FTSYATRYCDPALGFAVGY 136
                 PA +++ Y    I+++ ++   GE+   Y  L G +T Y++   DP+LGFAV  
Sbjct: 119 VLGTAGPAGLVLGYGIASIMLYCIIQAAGELGLCYAGLTGNYTRYSSILVDPSLGFAVSV 178

Query: 137 CYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFW 196
            Y  ++  + P QL   A+ I+YW +   VN  +++    + ++IIN  G + + E EF 
Sbjct: 179 VYTIQWLTVLPLQLVTAAMTIKYWTN---VNADIFVAAVFIFVIIINLFGSKGYAEAEFM 235

Query: 197 LSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVA 256
            +  KI+++ G ++   +I  GG  +   +G +YW NPG F        G KG       
Sbjct: 236 FNICKILMVIGFVILAIVINCGGAGDRKFIGTKYWHNPGPFA------HGFKG----VCT 285

Query: 257 VFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDP 316
           VF YA F+Y GIE+  + AAE ENP ++IP A K  +YRI+  Y++T  L+   V YN  
Sbjct: 286 VFCYAAFSYGGIEVLLLSAAEQENPTKSIPNACKKVVYRILFIYMLTTILICFLVPYNSD 345

Query: 317 RLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLA 376
            LL            PFV+A+ + GV+ +PH  N  +LI V S  NS LY   R L SLA
Sbjct: 346 ELLGSGSSSGSHAS-PFVIAVASHGVKVVPHFINAVILISVISVANSSLYSAPRLLLSLA 404

Query: 377 IDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWI 436
             G  PK  A  +R G P              ++  S    Q+F + + + S+  +  W+
Sbjct: 405 EQGFLPKCLAYVDRNGRPLLCFLVSIIFGCIGFVATSDAEEQVFTWLLAISSLSQLFIWM 464

Query: 437 SILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAY----ITLFFCVLIAFIKNFTVF-IG 491
           S+ +++I F  A   Q    +   Y+A    +G++    I LFF V   ++    V   G
Sbjct: 465 SMSLSHIRFRDAMAKQGRSMDEVGYKAQTGYWGSWLAVLIALFFLVCQFWVAIAPVSKHG 524

Query: 492 EFDYKSFITGYIGLPLYVIFYFGYKIIYKTK--LVKAEEADLYSFK 535
           + D   F   Y+ +P+ +  YFG+KI  K+    + AE+ DL S +
Sbjct: 525 KLDANVFFQNYLAMPIVLFAYFGHKIYTKSWKFWIPAEKIDLDSHR 570

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  236 bits (603), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 155/545 (28%), Positives = 256/545 (46%), Gaps = 22/545 (4%)

Query: 8   KDSKLIREDI--IDLEKNTTSSLNSFEQEDDSNKISDGKEDG-VRLKKELKARHISMIAI 64
           +D + +  DI   DLE      L     +D+       KED    L++ +K RH+ M+++
Sbjct: 114 EDDQKVGPDIYIDDLENKQQVELIGTTIQDEELLPGQKKEDSNAELRQTIKPRHVIMMSL 173

Query: 65  XXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMA-TYIPLDG-FTSYA 122
                               PA ++I Y  +G  ++ ++   GEMA  Y  L G F ++ 
Sbjct: 174 GTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCIYCIIQACGEMAVAYGNLTGSFNTFP 233

Query: 123 TRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVII 182
           +   DP   FAV + Y  ++  + P +L   ++ IQYW  +  V+P V++ IF V+I++I
Sbjct: 234 SFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTIQYWTTK--VDPDVFVVIFYVLILLI 291

Query: 183 NTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSE 242
           N  G + + E EF  ++ K++++ G  +    I  G       +G +YW +PGAF+  ++
Sbjct: 292 NFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDTGAAGTDGYIGAKYWNDPGAFRGQTK 351

Query: 243 SITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIV 302
                  +F   +  FV A FA+   E   + AAE  NPR+ IP A K  +YR+++ ++ 
Sbjct: 352 I-----ERFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIPSAAKKIIYRVLVIFLN 406

Query: 303 TIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACN 362
           TI L+G  V Y+  +LL            P+V+AI   GVR   H  N  +LI V S  N
Sbjct: 407 TIILIGFLVPYDSDQLLGSGGSATKAS--PYVLAISLHGVRVAQHFVNAVILISVISVGN 464

Query: 363 SDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNY 422
           S  Y  +R L SLA  G APK+F   +R G P  A          A+   S    ++F +
Sbjct: 465 SAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCSAVIAVIAFCATSPKETEVFTW 524

Query: 423 FVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAF 482
            + +  +  + +W +I ++++ F RA   Q        Y +     G+       +L A 
Sbjct: 525 LMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEMGYLSQTGILGSLYAAIMMIL-AL 583

Query: 483 IKNFTVFIGEF-----DYKSFITGYIGLPLYVIFYFGYKIIYKT--KLVKAEEADLYSFK 535
           I  F V +        D  SF + Y+ +P+ ++FYFGYKI  +     ++A++ DL S +
Sbjct: 584 IAQFWVALVPMGTHTPDANSFFSNYLAMPILIVFYFGYKIWKRDWRLFIRAKDIDLISHR 643

Query: 536 EAIDR 540
              D 
Sbjct: 644 TIYDE 648

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  233 bits (595), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 151/536 (28%), Positives = 259/536 (48%), Gaps = 33/536 (6%)

Query: 7   TKDSKLIREDIID------LEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHIS 60
           ++D+ L++  + D      ++    + L+S    D    + D  +    L + L  RHI+
Sbjct: 10  SRDTGLLKNVVKDPKSAPVVQNYEVTPLDSIS--DAVTDLEDHDKIRESLNRSLSPRHIN 67

Query: 61  MIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FT 119
           MI++                    P S+ I Y+ +G +V+  M CLGEM+T++P+ G F 
Sbjct: 68  MISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTIMGGVVYLTMLCLGEMSTFMPISGSFC 127

Query: 120 SYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWIT--IFLV 177
           SYA ++   +  FA+   Y F   +   + LTA  LV+ YW   +   P  W    +F V
Sbjct: 128 SYAKKFGCESFAFALMCNYWFNDAVSVASDLTALQLVLDYWKSSQHNFP-YWAASLLFWV 186

Query: 178 VIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAF 237
            ++ +N + VR +GE E+WL+  K++ +    +   ++ +G  P+H+ +GF+YW      
Sbjct: 187 FLLGLNVIHVRVYGEAEYWLALLKVIAIVIFFILAIVVNVGHNPDHEYIGFKYWS----- 241

Query: 238 KPYSES--ITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYR 295
             Y E+  + G KG    FV +FV + F+Y G E   + A EA NP RN PR +K   +R
Sbjct: 242 --YKEAPFVNGFKG----FVTIFVSSAFSYGGTESITLTAGEARNPIRNTPRIVKTVFWR 295

Query: 296 IILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLI 355
           I++FY+ T+F + M + Y+ P L             PF +  Q +G +A     N  +L 
Sbjct: 296 ILIFYVATMFFISMNIPYDYPNL-----STKSVMTSPFTIIFQMAGTKAAGSFMNAVILT 350

Query: 356 FVFSACNSDLYVGTRSLYSLAIDGKA-PKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSS 414
            + SA N  L+ G+R LY++ ++G   PKL  KTNR+  PY A           +     
Sbjct: 351 SIVSAGNHALFAGSRVLYNMGLEGFVFPKLITKTNRYRAPYVAVILTWAVGGLCFGASFI 410

Query: 415 GSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITL 474
           G+  ++ +  N+V +   ++W+SI +T I F R  +AQ        ++    PYG Y  +
Sbjct: 411 GAGTLWTWLQNIVGVSNQVAWLSIAVTSIRF-RKGLAQQGKTQELQFKNWTYPYGPYFLV 469

Query: 475 FFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEAD 530
            F  LI  ++ ++ F   +    F + Y+ L ++   +  + I  + + VK E+ D
Sbjct: 470 IFVTLIILVQGWSAF-DPWSTSDFFSYYLELFVFPTCWLIWWIFKRDRFVKPEDMD 524

>TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.397
           YBR132C
          Length = 580

 Score =  234 bits (596), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 164/556 (29%), Positives = 272/556 (48%), Gaps = 27/556 (4%)

Query: 8   KDSKLIREDI--IDLEKNTTSS-----LNSFEQEDDS--NKISDGKEDGVR--------L 50
           KDS  I  D+  +DL + T+ S     LNS   ++ S  +K      + +          
Sbjct: 3   KDSGKILYDVQELDLLQTTSHSSSHTVLNSPSDDNSSTTSKCCWSSSESIHSDTTLIPTT 62

Query: 51  KKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMA 110
           K+ LK RH+  IAI                    P S+++A+    I +F +     EM 
Sbjct: 63  KRNLKNRHVQFIAISGVIGTALFVTIGKPLYKGGPVSLILAFILWCIPIFAITVSTAEMV 122

Query: 111 TYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPG 169
            + P+   F   A +  D +L F   + + F   +  P ++ +   +I YW    +  P 
Sbjct: 123 CFYPVSSPFLRLANKCVDESLAFMASWNFWFLECVQIPFEIVSVNTMIHYWTTNYS--PA 180

Query: 170 VWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFR 229
           + + + +V+  II+   V+Y+GE EFWLSSFKI++  G+ LF  I M GG P  D  GFR
Sbjct: 181 IPLVVQVVLYFIISITAVKYYGELEFWLSSFKIILAIGLFLFTLITMCGGNPERDHFGFR 240

Query: 230 YWK-NP-GAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPR 287
            +K  P   + P       S G F  F+   + A F   G E   ++A E   PR+ +P+
Sbjct: 241 NYKVEPFKQYFPSGNHSPASLGYFQGFLNCLIQAAFTIAGGEYISMLAGEVHLPRKVLPK 300

Query: 288 AIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXX-XXPFVVAIQNSGVRALP 346
           A K   YR+   +I +   +G+  + NDP L              P+V+A+ N  +R LP
Sbjct: 301 AFKQVFYRLTFIFIGSCLCVGIICSPNDPDLTAAISESRPGAGSSPYVIAMNNLKIRILP 360

Query: 347 HIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXX 406
           HI NV ++   FSA N+  Y  +R+LY +A+DG APK+F++ N++GVP  +         
Sbjct: 361 HIVNVALITAAFSAGNAYTYCSSRTLYGMALDGYAPKIFSRCNKYGVPIYSVVISLLWAL 420

Query: 407 XAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQ 466
            + + ++S SA + N+ VN+++   ++++  I ITY+FF ++  AQ+ D  S  +++ FQ
Sbjct: 421 LSLLQLNSNSAVVLNWLVNLITASQLINFSVICITYLFFRKSYRAQSNDLPSLPFKSWFQ 480

Query: 467 PYGAYITLFFCVLIAFIKNFTVFIGE-FDYKSFITGYIGLPLYVIFYFGYK---IIYKTK 522
           PY A   L   V++  ++ +T  I   +  ++F+  Y+ + L +IFYF +K     YKTK
Sbjct: 481 PYTAIFGLACAVIMIGVQGYTTLIPSIWSVQNFLFCYLMVFLNLIFYFVHKFGWTYYKTK 540

Query: 523 LVKAEEADLYSFKEAI 538
            +        +FK  +
Sbjct: 541 SLSFRNPTQINFKNDL 556

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  234 bits (596), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 158/537 (29%), Positives = 260/537 (48%), Gaps = 37/537 (6%)

Query: 20  LEKNTTSSLNSFEQEDDSNKI-SDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXX 78
           + K T    N F++  DS K   DG  D   LKK LKARH+ MIAI              
Sbjct: 55  VAKGTKPPRNIFQRAIDSFKPPEDGSFDTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQ 114

Query: 79  XXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRYCDPALGFAVGYC 137
                 P +++I ++  G  +   +  LGE+    P+ G F +Y+TR+ DP++ F V   
Sbjct: 115 ALATGGPLAVIIGWAIAGSQIIGTIHGLGEITVRFPVVGAFANYSTRFLDPSISFVVSTI 174

Query: 138 YLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWL 197
           Y+ ++F + P ++ + A+ +QYW   E+++P VW+ IF V IV IN  GVR FGE EF  
Sbjct: 175 YVIQWFFVLPLEIISSAMTVQYW--NESIDPVVWVAIFYVTIVSINLFGVRGFGEAEFIF 232

Query: 198 SSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAV 257
           S+ K++ + G IL   I++ GGGP+H  +G RYW NPG               F   ++V
Sbjct: 233 STIKVITISGFILLCIILIAGGGPDHVYVGSRYWHNPGCL----------ANGFPGVLSV 282

Query: 258 FVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPR 317
            V A ++  G E+T + + E +   + +P AIK   +RI+ F++V++ L+G  V Y +  
Sbjct: 283 MVVASYSLGGTEMTCLASGETDP--KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNEN 340

Query: 318 LLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAI 377
           LL            PFV+AI+   ++ LP I N  +LI + S  NS ++  +R+L S+A 
Sbjct: 341 LL----GGSSVDNSPFVIAIKIHHIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAH 396

Query: 378 DGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWIS 437
               P  F   +R G P             A++  S   +++F++ + +  +   + W+S
Sbjct: 397 QHLLPWWFGYIDRAGRPLVGIITNSLFGLLAFLVKSGSMSEVFDWLMAIAGLATCIVWLS 456

Query: 438 ILITYIFFYRACIAQNVDRNSFAYRAPFQPYGA-YITLFFCVLIAFIKNFTVFI------ 490
           I +++I F  A  AQ    N   + +    +G+ Y  +  C+++  +  F + +      
Sbjct: 457 INVSHIRFRLAMKAQGRSLNELEFVSAVGIWGSVYSAIINCLIL--VAQFYISLWPIGGW 514

Query: 491 --GEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVK------AEEADLYSFKEAID 539
              E   K F   Y+   + V  + G+KI Y  +  K        E DL   ++ ID
Sbjct: 515 KNSEDRAKKFFQSYLCALIMVCIWIGHKIYYWRQTGKIWAFTPLAEIDLDEGRKNID 571

>TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {ON}
           Anc_3.397 YBR132C
          Length = 575

 Score =  233 bits (594), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 148/547 (27%), Positives = 263/547 (48%), Gaps = 22/547 (4%)

Query: 7   TKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLK------KELKARHIS 60
           T D   +R  I++      SS+   ++ D    ++D ++    L       + LK RH+ 
Sbjct: 19  TNDLDSVRTTIVE------SSVKPAKKTDWLGCVTDDEDSSSDLLYSTQTFRRLKNRHVQ 72

Query: 61  MIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FT 119
           +IAI                    PA +LIA++   + +  +     EM  ++P+   F 
Sbjct: 73  LIAISGVIGTALFVAIGKALYKGGPAFLLIAFALWCVPILCITVSTAEMVCFLPVSSPFL 132

Query: 120 SYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVI 179
             A R  D +L     + + F   +  P ++ +   +I YW  R+  +  + + + +V+ 
Sbjct: 133 RLAARCADDSLAVMASWNFWFLQCVQIPFEIVSVNTIIHYW--RDDYSAAIPLVVQIVLY 190

Query: 180 VIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKP 239
            +I+   V+Y+GE EFWL+SFKI++  G+ LF FI MLGG P HDR GFRY+     FK 
Sbjct: 191 FLISICAVKYYGETEFWLASFKIILALGLFLFTFITMLGGNPKHDRYGFRYYGET-PFKK 249

Query: 240 Y----SESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYR 295
           Y     +    S G F  F+A  + A F   G E   ++A E + PR+ +PRA K   YR
Sbjct: 250 YYPNGDKDAGASVGYFQGFLACLIQASFTIAGGEYISMLAGEVKLPRKVLPRAFKQVFYR 309

Query: 296 IILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXX-XXPFVVAIQNSGVRALPHIFNVCVL 354
           +   ++ +   +G+  + NDP L              P+V+A+ N G++ LP I N  ++
Sbjct: 310 LTFLFLGSCLCVGIICSANDPALTAAIDESRPGAGSSPYVIAMNNLGIKVLPDIVNAALI 369

Query: 355 IFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSS 414
              FSA N+  Y  +R+LY +A+DG AP++F + N+ GVP  +          + + ++ 
Sbjct: 370 TAAFSAGNAYTYCSSRTLYGMALDGYAPRIFTRCNKHGVPIYSVLISLLWGLISLLQLND 429

Query: 415 GSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITL 474
            SA + N+ +N+++   ++++  + I Y+FF RA +          +++  QPY A + L
Sbjct: 430 NSAVVLNWLINLITASQLINFTVLCIIYLFFRRAYLLHKDILPKLPFKSWGQPYTAIVGL 489

Query: 475 FFCVLIAFIKNFTVFIGE-FDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYS 533
                +  I+ +TVF    +  + F+  Y+ + + +  Y GYK I++    K ++     
Sbjct: 490 VSATAMILIQGYTVFFPSLWTVRDFLFCYLMVFIDIGIYIGYKFIWRRGRDKFKDPKTVD 549

Query: 534 FKEAIDR 540
           F + +  
Sbjct: 550 FSKDLKE 556

>CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa]
           {ON} highly similar to uniprot|P38084 Saccharomyces
           cerevisiae YBR068c BAP2 or uniprot|P41815 Saccharomyces
           cerevisiae YDR046c PAP1
          Length = 634

 Score =  234 bits (597), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 148/496 (29%), Positives = 249/496 (50%), Gaps = 21/496 (4%)

Query: 34  EDDSNKISDGKEDGV----RLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASIL 89
           E+DS  +     D +     LKK +K+RH+ M+++                    PA+++
Sbjct: 95  EEDSLDLEGSDHDSIITNTHLKKAMKSRHVMMMSLGTGIGTGLLVANAKGLHFGGPAALV 154

Query: 90  IAYSFVGILVFFVMACLGEMA-TYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITP 147
           I Y  V  + +F++   GEMA TY  L G F +Y++ +   A GFA  + +  ++  + P
Sbjct: 155 IGYVLVSFVTYFMIQAAGEMAVTYPTLPGNFNAYSSIFVSNAFGFATVWIFCIQWLTVLP 214

Query: 148 NQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVG-VRYFGEFEFWLSSFKIMVMF 206
            +L   +L I+YW D+  +N  V+I IF V ++ I+  G V  +GE EF  +  KI+++ 
Sbjct: 215 LELITASLTIKYWNDK--INADVFIVIFYVFLLCIHLFGGVIAYGETEFLFNLCKILMVI 272

Query: 207 GVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYL 266
           G I+   +I  GG  N + +G ++W +PGAF   +    GS+ K + +V V  Y  F+Y 
Sbjct: 273 GFIIMSIVINAGGAGNREYIGGKFWHDPGAF---AGKTAGSRFKGICYVLVSGY--FSYG 327

Query: 267 GIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXX 326
           G EL  +   E  NPRR+ P+A K ++YRI++ Y++T+ L+G  V Y+   L+       
Sbjct: 328 GTELFALSVNEQSNPRRSTPQASKSSLYRILIIYLLTMILIGFNVPYDSDELMGSGGSAT 387

Query: 327 XXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFA 386
                P+V+A   +GV+  PH  N  +LI V S  NS LY   R + SLA  G APK   
Sbjct: 388 HAS--PYVLAASLNGVKIAPHFINAVILISVISVANSSLYAAPRLMCSLAQQGYAPKFLD 445

Query: 387 KTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFY 446
             +R G P  A           ++  S    ++F +   +  +  + +W SI+++++ F 
Sbjct: 446 YVDRQGRPLLALIACLLVGVIGFVAASPKEEEVFTWLAAIAGLSELFTWSSIMLSHVRFR 505

Query: 447 RACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI-----GEFDYKSFITG 501
            A   QN       Y+A    YG+   + F +L+   + +T        G+ +  SF   
Sbjct: 506 MAMKLQNRSLEELGYKATTGIYGSIYGVCFNLLVFAAQFWTALFPFGGDGKANANSFFAN 565

Query: 502 YIGLPLYVIFYFGYKI 517
           Y+ +P++++FYFGY +
Sbjct: 566 YLAMPIWLVFYFGYML 581

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  232 bits (592), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 158/515 (30%), Positives = 244/515 (47%), Gaps = 34/515 (6%)

Query: 13  IREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXX 72
           + E  +D + N  +   S  +ED  +  S        +K++LK RHIS++A+        
Sbjct: 26  VTEMEVDPKNNEYAEEQSLNREDTFDPDSG-------VKRQLKDRHISLLALGGIIGPGC 78

Query: 73  XXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRYCDPALG 131
                       P ++L+ +  +GIL F +M  +GEM T  P  G FT+   R+   AL 
Sbjct: 79  LIGAGNALAIGGPLALLLGFGIIGILAFIMMESIGEMITLYPSGGGFTTLTRRFHSDALS 138

Query: 132 FAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGV----WITIFLVVIVIINTVGV 187
              GY Y   +F +  N+    + ++Q+W       P V    +I IF     +   +GV
Sbjct: 139 AVCGYAYAVVFFAVLANEYNTLSSIMQFW------GPQVPLYGYILIFWAAFQVFQLLGV 192

Query: 188 RYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGS 247
             FGE E+WL+ FKI+ +    +F  + + GG  N    GF+YW +PGA          S
Sbjct: 193 GAFGETEYWLAWFKILGLLTYYIFSIVYISGGVKNRPAFGFQYWNDPGAL---------S 243

Query: 248 KGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLL 307
            G F     VFV+    Y G E   + A E++NPRR +P AI+ T +RI++ Y+      
Sbjct: 244 NG-FKGIANVFVFCSTFYSGTESVALAATESKNPRRAVPIAIRQTFWRILIVYLGISIFY 302

Query: 308 GMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYV 367
           G+ V YND  L             P  +AI  +G  A  H+ N  +LI   SA N  LY+
Sbjct: 303 GVTVPYNDENL----NFATKVLKSPIAIAISRAGWPAGVHLVNAFILITCISAINGSLYI 358

Query: 368 GTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVV 427
           G+R+L  LA +G APKL A T+R GVP  A          + MNVS  +   +NY VN+ 
Sbjct: 359 GSRTLTHLANEGLAPKLLAWTDRRGVPIPAITVFNALGLISLMNVSVTAVDAYNYIVNLS 418

Query: 428 SIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFT 487
            +   + W  I +T++ F +A   Q   R+   Y+A   P    +++   + +  ++ ++
Sbjct: 419 GVGVFIVWGIISLTHLRFRKAWKLQGHTRDELPYKAKLFPVFPIVSIIANIFLGLVQGWS 478

Query: 488 VFIGEFDYKSFITGYIGLPLYVIFYFGYKIIYKTK 522
            F   FD K+F+  YI +P  +I Y G    +KTK
Sbjct: 479 YF-KPFDAKNFVDAYILIPAGIILYLGVS-YWKTK 511

>ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON}
           similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 564

 Score =  232 bits (592), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 156/512 (30%), Positives = 240/512 (46%), Gaps = 28/512 (5%)

Query: 14  REDIIDLEKNTTSSL--NSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXX 71
           + D    E  T+S +  +  E  +  N  +   +    +K+ LK RHIS++A+       
Sbjct: 13  KGDDASCESYTSSGITPDQIETGEGKNHNASLYDPKTGVKRALKDRHISLLALGGIIGPG 72

Query: 72  XXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRYCDPAL 130
                        P ++L+ +S +GI+ F +M  +GEM T  P  G FT+ A R+   +L
Sbjct: 73  CLVGAGNALAKGGPLALLLGFSIIGIIAFTIMESIGEMITLYPSGGGFTTLARRFHSDSL 132

Query: 131 GFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGV----WITIFLVVIVIINTVG 186
               GY Y+  +F +  N+    + + Q+W       P V    +I IF          G
Sbjct: 133 SAVCGYAYIVVFFAVMANEYNTLSSIFQFW------GPQVPLYGYILIFWAAFQAFQMAG 186

Query: 187 VRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITG 246
           V  FGE E+WLS FKI+ +    +F  I + GG  +    GF YW NPGA          
Sbjct: 187 VGAFGEIEYWLSWFKILGLVAFYIFSTIYISGGIKDRPAFGFHYWNNPGAL--------- 237

Query: 247 SKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFL 306
           S G F     VFV+    Y G E     A+E++NP R IP AI+ T +RI++ YI   F 
Sbjct: 238 SHG-FKGIAEVFVFCSTFYSGTESVAYSASESKNPNRAIPLAIRQTFWRILVVYIGIGFF 296

Query: 307 LGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLY 366
            G+ V YND  L             P  +AI  +G     H+ N  +L+   SA N  L+
Sbjct: 297 YGVTVPYNDHNL----NAGTKALKSPISIAITRAGWEGGTHLVNAFILVTCISAINGSLF 352

Query: 367 VGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNV 426
           +G+R++ +LA +G APK  A T+R GVP  A          + MNVS G++  ++Y VN+
Sbjct: 353 IGSRTITNLAHEGLAPKFLAWTDRRGVPIPAITLFNALGLVSLMNVSVGASTAYSYIVNL 412

Query: 427 VSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNF 486
             +   + W +I +T++ F +A I Q        Y+A F PY   I +   + +A I+ +
Sbjct: 413 SGVGVFIVWGTIGLTHLRFRKAWIKQGRTVKELPYKALFYPYTQIIGIAANIFLALIQGW 472

Query: 487 TVFIGEFDYKSFITGYIGLPLYVIFYFGYKII 518
           T F+  F    F+  Y+ LP   + Y G  ++
Sbjct: 473 TSFV-PFKAGDFVDAYVLLPAAAVLYIGISLL 503

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  233 bits (594), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 148/510 (29%), Positives = 252/510 (49%), Gaps = 23/510 (4%)

Query: 35  DDSNKISDGK---EDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIA 91
           +++N + DG    +    LKK +K+RH+ M+++                    P S++I 
Sbjct: 68  EENNDLEDGTRPMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIG 127

Query: 92  YSFVGILVFFVMACLGEMA-TYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQ 149
           Y  V  + +F++   GEM   Y  L G F +Y + +   + GFA  + +  ++  + P +
Sbjct: 128 YVLVSFITYFMVQAAGEMGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLE 187

Query: 150 LTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVI 209
           L   ++ I+YW D  ++N  V+I IF V ++ I+  GV+ +GE EF  +S KI+++ G I
Sbjct: 188 LITSSMTIKYWND--SINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFI 245

Query: 210 LFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIE 269
           +   +I  GG      +G +YW++PG+F   S +      +F     + V A F++ GIE
Sbjct: 246 ILSVVINCGGAGVDGYIGGKYWRDPGSFADGSNAT-----RFKGICFILVTAYFSFGGIE 300

Query: 270 LTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXX 329
           L  +   E  N R++ P A K ++YRI++ Y++T+ L+G  V +N+ +L+          
Sbjct: 301 LFVLSINEQSNARKSTPLAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHAS 360

Query: 330 XXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTN 389
             P+V+A     VR +PHI N  +LI V S  NS LY   R + SLA  G AP+     +
Sbjct: 361 --PYVLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPRFLNYID 418

Query: 390 RWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRAC 449
           R G P  A           ++  S    Q F +   +  +  I +W  I++++I F +A 
Sbjct: 419 REGRPLRALAVCALVGVVGFVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAM 478

Query: 450 IAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI------GEFDYKSFITGYI 503
             Q        Y+A    +G+Y  +FF +L+ F+  F V +      G+ D ++F  GY+
Sbjct: 479 KVQGRSLGELGYKANTGIWGSYYGVFFNILV-FMAQFWVALSPIGNGGKCDVQAFFEGYL 537

Query: 504 GLPLYVIFYFGYKIIYK--TKLVKAEEADL 531
             PL++  Y GY +  K  T L   ++ DL
Sbjct: 538 AAPLWIFMYLGYMLYNKDFTLLNPLDKIDL 567

>KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  234 bits (596), Expect = 3e-68,   Method: Compositional matrix adjust.
 Identities = 160/532 (30%), Positives = 252/532 (47%), Gaps = 24/532 (4%)

Query: 21  EKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXX 80
             N    L     E       D  + G +LKK ++ RH+ +I++                
Sbjct: 87  HTNLDMELVGVTSETIEQHKKDEGDTGDKLKKTIQPRHVILISLGTGIGTGLLVGNGATL 146

Query: 81  XXXXPASILIAYSFVGILVFFVMACLGEMA-TYIPL-DGFTSYATRYCDPALGFAVGYCY 138
               PA ++I Y  +G L++ ++   GEMA  Y+ L  GF +Y T   DP   FA  + Y
Sbjct: 147 AQAGPAGLVIGYGIMGSLIYCIIQACGEMAVNYLTLVGGFNAYPTFLIDPGFSFATAWVY 206

Query: 139 LFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVG-VRYFGEFEFWL 197
             ++  + P +L   ++ I+YW  +  V+P V++ IF V I+ IN +G  R + E EF  
Sbjct: 207 CLQWLCVCPLELVTASMTIKYWTTK--VDPDVFVIIFYVFILGINILGGARGYAEAEFIF 264

Query: 198 SSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKG--KFVSFV 255
           +S KI++M G  +   II+ GG      +G RYW +PGAF+       G +   +F   V
Sbjct: 265 NSCKILMMIGFFILGIIIICGGAGTDGYIGGRYWHDPGAFR-------GERAVDRFKGVV 317

Query: 256 AVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYND 315
           A  V A F++   E   + A+E  NPRR IP A K  +YR +  Y+ +I LLG  V YN 
Sbjct: 318 ATLVTAAFSFGQSEFIAVTASEQSNPRRAIPSAAKKIIYRALCIYLASIILLGFLVPYNS 377

Query: 316 PRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSL 375
            +LL            P+V+A+ N GVR +PH  N  ++I V S  NS  Y   R L +L
Sbjct: 378 SQLLGAQSNGIKAS--PYVLAVANHGVRVVPHFINAVIIISVLSVSNSAFYSSPRMLLTL 435

Query: 376 AIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSW 435
           +  G APK+F+  +R G P             A+   S    Q+F + + V  +  I +W
Sbjct: 436 SQQGFAPKIFSYVDRAGRPTMGIIVASLFAVIAFCATSPKEDQVFTWLLAVSGLSQIFTW 495

Query: 436 ISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI----- 490
           +SI ++++ F RA   Q        + +    YG+  + F   LI  +  F V +     
Sbjct: 496 MSICLSHLRFRRAMTVQGRSLGECGFLSQVGIYGSAYSFFVLALI-LVGQFWVALKPVGS 554

Query: 491 GEFDYKSFITGYIGLPLYVIFYFGYKIIYKT-KL-VKAEEADLYSFKEAIDR 540
            + D  SF   Y+  P+++  Y GYK   K  +L +K+++ DL + ++  D 
Sbjct: 555 KKVDANSFFENYLAAPIWIALYIGYKCYTKDWRLYIKSQDIDLVAHRQIYDE 606

>TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.342
           YDR160W
          Length = 840

 Score =  237 bits (604), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 162/596 (27%), Positives = 289/596 (48%), Gaps = 63/596 (10%)

Query: 4   YEVTKDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIA 63
           +E T DS+    +   L K+++  +  FE+ D    ++        ++++L+ RHI MI 
Sbjct: 224 HEATHDSR--SSEFSTLSKSSSQKIGLFERVD--KHLNSPGHAKYHVQRKLRVRHIQMIG 279

Query: 64  IXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLD-GFTSYA 122
           I                    P   L+ ++  G +VF  +    E+A+ IP+  GF+  A
Sbjct: 280 IGACISVGICLTSGKAFSIAGPFGTLLGFAISGSVVFASLLSFTELASLIPVSSGFSGLA 339

Query: 123 TRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYW--IDRETVNPGVWITIFLVVIV 180
           +R+ + A GFA+G+ Y F   I  P Q+ A    + Y+  + R   +   ++T+FL+  +
Sbjct: 340 SRFVEDAFGFALGWTYWFSSMIALPAQVVASTFFLSYYSSMKRSRGSTAGFVTLFLLYPI 399

Query: 181 IINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLG-GGPNHDRLGFRYWKNP----- 234
            IN + VR  GE  +     KI++   VI+ + I   G GG +HD++GFRYW +      
Sbjct: 400 FINLLDVRIMGEVVYVTGLIKIIISVVVIISMLIFNAGHGGASHDQVGFRYWDSSKSFSQ 459

Query: 235 ---GAFKPY----------SESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENP 281
              G F+P           +  I G+ G+F++ ++V + + FAY G+E+T + + EA NP
Sbjct: 460 FTFGLFRPTFDLNDAGEGSTHGIEGATGRFLAVISVILISTFAYSGVEMTFVASGEAVNP 519

Query: 282 RRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXX------------ 329
           R+ IP AIK T+  +I+ Y++++  +G+ +   DPRLL                      
Sbjct: 520 RKTIPSAIKRTLNIVIIIYMLSLISVGVNIYCGDPRLLSYFSGSAERRFITAMNDDSIRW 579

Query: 330 --------------------XXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGT 369
                                 P+V+A+QN G+     + N  ++     A  S L+ G+
Sbjct: 580 QVSERCRSGLHYETGYQRNGSSPWVLALQNFGMCTYASVLNGIMIFITVGAEISSLFSGS 639

Query: 370 RSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSI 429
           R+LY++A+  KAP +  +  + GVPY +          +Y+ V + + + F    N+ S 
Sbjct: 640 RTLYAMAVQRKAPAILQRCTKAGVPYVSVLFTSAFGAISYLAVDTTAIENFGVLSNISSA 699

Query: 430 FGILSWISILITYIFFYRAC-IAQNV---DRNSFAYRAPFQPYGAYITLFFCVLIAFIKN 485
              + W+ + ++++ FY A  + Q++   D  S+ YR+PFQPY +   LF C +      
Sbjct: 700 STSIIWMGLNVSFLRFYYALKLRQDIISRDDRSYPYRSPFQPYLSMYGLFGCCMFVIFMG 759

Query: 486 FTVFIGEF-DYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAIDR 540
           +T F+ ++ + KSF + Y GL L+   Y GYKII  +K+ + ++ D+ + +  +DR
Sbjct: 760 YTNFLHKYWNTKSFFSAYGGLMLFSACYLGYKIIGTSKIQRLDQLDMDTGRREMDR 815

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  233 bits (594), Expect = 7e-68,   Method: Compositional matrix adjust.
 Identities = 157/539 (29%), Positives = 266/539 (49%), Gaps = 31/539 (5%)

Query: 17  IIDLEKNTTSS----LNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXX 72
           I DLE + T++    L+++     S+++   KE+   LK+++  RH+  +AI        
Sbjct: 83  IADLENDLTTAVSPQLSNYHGSIPSDEVVIKKEE---LKRDINQRHMVFMAIGSGVGTGL 139

Query: 73  XXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMA-TYIPL-DGFTSYATRYCDPAL 130
                       PA +LI Y+ +G  V+ V+   GE+  TY  L  GF +Y      P+ 
Sbjct: 140 LVGNASTLNSAGPAGLLIGYALMGTCVYCVIQAAGELGVTYANLIGGFNAYPAILVAPSF 199

Query: 131 GFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYF 190
            F+VG+ Y  ++  +TP +L   +L I+YW  +  V+P V++ IF ++I++IN  G + +
Sbjct: 200 AFSVGWIYTLQWLCMTPLELVTASLTIKYWTTK--VDPDVFVVIFYLLILLINFFGSKGY 257

Query: 191 GEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKG- 249
            E +F+ +  K+ ++ G  +   ++  GG  +   LG +YW NPGAF+       G K  
Sbjct: 258 AEADFFFNCMKLAMISGFFILGIVVACGGAGHDGYLGGKYWHNPGAFR-------GEKAI 310

Query: 250 -KFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLG 308
             F    +VFV + FA+ G E   + A+E  NPR++IP A KL +YRII  Y+ +I +LG
Sbjct: 311 DHFKGVSSVFVTSAFAFGGSEFVALSASEQANPRKSIPSAAKLILYRIIWVYLTSITILG 370

Query: 309 MCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVG 368
             V ++ P+L             P+VVAI   GV+ +PH+ N  +L+ V S  NS  +  
Sbjct: 371 FLVPWDSPQL---QPSSDGKKTSPYVVAIAMHGVKVVPHLINAVILMAVLSVSNSAFFYS 427

Query: 369 TRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVS 428
           +R L SL+  G APK F   +R G P  A           +   S     +F++ + +  
Sbjct: 428 SRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISALFGVICFCATSKKETDVFSWLLAISG 487

Query: 429 IFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTV 488
           +  I ++ SI +++I    A   Q        +R+    YG++      VL + +  F V
Sbjct: 488 LSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFRSQVGTYGSFYACLLLVL-SLMAEFWV 546

Query: 489 FI-----GEFDYKSFITGYIGLPLYVIFYFGYKIIYKT--KLVKAEEADLYSFKEAIDR 540
            +     G+ D +SF   Y+  P+ ++FYFGY I  K     +++++ DL   ++  D 
Sbjct: 547 ALAPIGEGKLDAESFFENYLAAPIGIVFYFGYMIWKKDFRIFIRSKDIDLDFKRQVFDE 605

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  232 bits (591), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 144/512 (28%), Positives = 242/512 (47%), Gaps = 22/512 (4%)

Query: 14  REDIIDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXX 73
           R+     +K +       E       ++DG     RL++ ++ RH++M+++         
Sbjct: 48  RDSFKRAQKRSVPQGGDLETASVQTDLTDG-----RLRRSIRPRHVAMMSVCTGIGTGLL 102

Query: 74  XXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPL--DGFTSYATRYCDPALG 131
                      P  ++I Y+ V ++ + +M   GEMA   P     F +Y++ +     G
Sbjct: 103 VANGKSLRYGGPGGLIIGYAAVSVVAYIMMQAAGEMAVAYPSMPGNFNAYSSVFISKPFG 162

Query: 132 FAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFG 191
           FA  + Y  ++  + P +L   +L I+YW D  +VN  V+I IF V I+ I+  G R +G
Sbjct: 163 FASVWLYCLQWLTVFPLELITASLTIKYWTD--SVNADVFIAIFYVFILFIHFFGSRGYG 220

Query: 192 EFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKF 251
           E EF     K++++ G ++   +I  GG  N   +G RYW +PGAF     ++     KF
Sbjct: 221 ESEFIFGLCKVLMIAGFVILAIVINCGGAGNSGYIGARYWHDPGAF-----AVGDPASKF 275

Query: 252 VSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCV 311
             F  V V   F+Y G EL  +   E  +PRR I  A K  +YRI++ Y++T+ L+G  V
Sbjct: 276 KGFCYVLVTGYFSYGGTELYAMTVNEQSSPRRAIHSATKQCIYRILVIYMLTMVLIGFLV 335

Query: 312 AYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRS 371
            +    L+            P+V+A+   GV+ +PHI N  +LI V S  NS +Y G R 
Sbjct: 336 PHTSDELMGSGGKSATHAS-PYVLAVSLHGVKVVPHIVNAVILIAVVSVGNSAMYSGPRV 394

Query: 372 LYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFG 431
           L +LA  G APK  A  +R G P  A          A++  S     +F +   +  +  
Sbjct: 395 LNALAEQGYAPKFLAYIDRAGRPLMALIACSVIGLLAFVAASDHEEDVFTWLAAIAGLSE 454

Query: 432 ILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI- 490
           + +W +IL+++I F +A        +   Y++    +G+   + F +L+ F+  F V + 
Sbjct: 455 LFTWSAILLSHIRFRQAMKYHGYSLSQLGYKSITGLWGSIYGVCFNILV-FVAQFWVALA 513

Query: 491 -----GEFDYKSFITGYIGLPLYVIFYFGYKI 517
                G+ D  SF   Y+  PL+ +F+ GY +
Sbjct: 514 PIGNNGKTDVLSFFQSYLAFPLWFVFFLGYMV 545

>KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} similar
           to uniprot|P38090 Saccharomyces cerevisiae YBR132C AGP2
           Plasma membrane carnitine transporter expression is
           down-regulated by osmotic stress also functions as a
           low-affinity amino acid permease
          Length = 568

 Score =  231 bits (588), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 145/501 (28%), Positives = 255/501 (50%), Gaps = 15/501 (2%)

Query: 51  KKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMA 110
            ++L+ RH+ +I I                    P S+++ +S   I +  +     EM 
Sbjct: 54  SRKLQNRHVQLIGISGVIGTALFVSIGKALYRGGPVSLILGFSLWCIPILCITVSTAEMV 113

Query: 111 TYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPG 169
            Y+P+   F   A R C+ +L    G+ + F   +  P ++ A   ++ YW  R+  +P 
Sbjct: 114 CYLPISSPFLRMAKRCCNDSLAVTAGWNFWFLECVQIPFEIVAVNTILHYW--RDDFSPA 171

Query: 170 VWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFR 229
           + + + +++ + I+   VR +GE E +L+SFKI++  G+ LF FI MLGG P HDR GFR
Sbjct: 172 IPLCVQVLLYIGISLFAVRCYGETEAFLASFKILLAIGLFLFTFITMLGGNPKHDRYGFR 231

Query: 230 YWKNPGAFKPYSESITGSK--GKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPR 287
           Y  +   FK Y  +  GS   G F  F+A  + A F   G +   ++A E + PR+ +P 
Sbjct: 232 YITDT-KFKQYFPNNEGSSSMGYFQGFLACVIQASFTIAGPDYVAMIAGECKLPRKVLPV 290

Query: 288 AIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXX-XXPFVVAIQNSGVRALP 346
           A K    R+ + ++     +G+  + NDP L              P+V+A+ N G++ LP
Sbjct: 291 AFKQVFIRLTVLFLGGCLCVGIVCSSNDPNLTAVINNPRPGAGSSPYVIAMNNLGIKVLP 350

Query: 347 HIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXX 406
            + N  ++   FSA N+  Y  +R+LY L++DG APKLF    + GVP NA         
Sbjct: 351 DVVNAALVTAAFSAGNAYTYCSSRTLYGLSLDGYAPKLFQYCTKSGVPINAVLVSLAWAF 410

Query: 407 XAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNV--DRNSFAYRAP 464
            + + + S SA + N+ +N+++   ++++  + + Y+ F RA I Q+   +     +++ 
Sbjct: 411 ISLLQLGSNSAVVLNWLINLITASQLINFSILCVIYLSFRRAYIKQHPSGELPELPFKSW 470

Query: 465 FQPYGAYITLFFCVLIAFIKNFTVFI-GEFDYKSFITGY----IGLPLYVIFYFGYKIIY 519
            QPY AY  LF   L+  ++ +TVF+ G ++ +SF+  Y    I L ++++ +F YK   
Sbjct: 471 GQPYTAYCGLFAVTLMIGVQGYTVFLHGSWEVQSFLFCYLMVFIDLGIFLLCFFVYKRT- 529

Query: 520 KTKLVKAEEADLYSFKEAIDR 540
           +   VK E+ADL +  + ++ 
Sbjct: 530 RDPWVKPEDADLLTGMDEVEE 550

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  231 bits (588), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 154/530 (29%), Positives = 255/530 (48%), Gaps = 24/530 (4%)

Query: 22  KNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXX 81
           +  T      E   ++ + +D      ++K+ +K+RHI+MI++                 
Sbjct: 48  QGQTIREEKLENGLETVRTNDYNATQKKMKQTMKSRHITMISLGTGIGTGLLVANGKALH 107

Query: 82  XXXPASILIAYSFVGILVFFVM-ACLGEMATYIPLDG-FTSYATRYCDPALGFAVGYCYL 139
              P  ++I Y     +++ V+ AC     +Y  L G + SY +   D    FAV + Y 
Sbjct: 108 FGGPGGLVIGYVTTSTMLYCVIQACCELGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYG 167

Query: 140 FKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSS 199
            ++ I+ P +L   ++ I+YW D  ++NP V++ IF   IV I+  G + + E EF  +S
Sbjct: 168 LQWAIVLPLELVTSSMTIKYWND--SINPDVFVAIFYCFIVFIHFFGSQGYAESEFIFNS 225

Query: 200 FKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKG--KFVSFVAV 257
            K+++M G I+ + I +  G      +G +YW  PGAF        G K    F    +V
Sbjct: 226 CKVLMMVGFII-MGISVNCGASKSGYIGGKYWHTPGAF-------VGEKAIDHFKGICSV 277

Query: 258 FVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPR 317
           +V + FAY G E   + AAE  NPR+++P+A K  +YR+++ ++  I L+G  V Y+ P 
Sbjct: 278 WVQSAFAYGGSEFIALTAAEQTNPRKSVPKATKRWLYRVLIVFLTPIILVGFLVPYDSP- 336

Query: 318 LLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAI 377
           LL            PFV+A  + GV+ +PHI N  +LI V S  NS  Y   R L SLA 
Sbjct: 337 LLLGSPGQAASHASPFVIAAASHGVKVVPHIINAVILISVISVGNSAFYSAPRILLSLAE 396

Query: 378 DGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWIS 437
            G  PK+F   +R G P             +++  S     +F +   +VS+  + +W +
Sbjct: 397 QGMGPKVFTYVDRKGRPLVTMLFVAIFGLISFVAASDNEETVFTWLSAIVSLSQLFTWSA 456

Query: 438 ILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFI------G 491
           I +++I F  A   Q        Y+A    +G++  + F +++     F V I      G
Sbjct: 457 ISLSHIRFRDAMKTQGRSLGELGYKANTGYWGSWYAIAFNIIV-LAAQFWVAIAPIGNGG 515

Query: 492 EFDYKSFITGYIGLPLYVIFYFGYKIIYKT-KL-VKAEEADLYSFKEAID 539
           + D  +F   Y+  P+ V FYFGYK+ Y+  KL + A++ DL S ++  D
Sbjct: 516 KLDVNNFFQNYLAFPVLVFFYFGYKLWYRDWKLFIPADKVDLESHRKIFD 565

>YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}
           AGP3Low-affinity amino acid permease, may act to supply
           the cell with amino acids as nitrogen source in
           nitrogen-poor conditions; transcription is induced under
           conditions of sulfur limitation; plays a role in
           regulating Ty1 transposition
          Length = 558

 Score =  229 bits (585), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 157/520 (30%), Positives = 251/520 (48%), Gaps = 29/520 (5%)

Query: 1   MSVYEVTKDSKLIREDII-DLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHI 59
           M+V  + +++  I E    D++    S++ + + ++D +      + GV  K+ LK RHI
Sbjct: 1   MAVLNLKRETVDIEETAKKDIKPYFASNVEAVDIDEDPDVSRYDPQTGV--KRALKNRHI 58

Query: 60  SMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-F 118
           S++A+                    P ++L+ +S +GI+ F VM  +GEM T  P  G F
Sbjct: 59  SLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSIIGIIAFSVMESIGEMITLYPSGGGF 118

Query: 119 TSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGV----WITI 174
           T+ A R+   AL    GY Y+  +F +  N+    + ++Q+W       P V    +I I
Sbjct: 119 TTLARRFHSDALPAVCGYAYVVVFFAVLANEYNTLSSILQFW------GPQVPLYGYILI 172

Query: 175 FLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNP 234
           F     I   VGV  FGE E+WL+  KI+ +    +F  + + G   N    GF YW +P
Sbjct: 173 FWFAFEIFQLVGVGLFGETEYWLAWLKIVGLVAYYIFSIVYISGDIRNRPAFGFHYWNSP 232

Query: 235 GAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMY 294
           GA          S G F     VFV+    Y G E   + A E++NP + +P A++ T++
Sbjct: 233 GAL---------SHG-FKGIAIVFVFCSTFYSGTESVALAATESKNPGKAVPLAVRQTLW 282

Query: 295 RIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVL 354
           RI++ YI      G  V ++DP L             P  +AI  +G     H+ N  +L
Sbjct: 283 RILVVYIGIAVFYGATVPFDDPNL----SASTKVLKSPIAIAISRAGWAGGAHLVNAFIL 338

Query: 355 IFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSS 414
           I   SA N  LY+G+R+L  LA +G APK+ A T+R GVP  A          + MNVS 
Sbjct: 339 ITCISAINGSLYIGSRTLTHLAHEGLAPKILAWTDRRGVPIPAITVFNALGLISLMNVSV 398

Query: 415 GSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITL 474
           G+A  ++Y VN+  +   + W  I  T++   +A +AQ        Y A F P+   ++L
Sbjct: 399 GAANAYSYIVNLSGVGVFIVWGVISYTHLRIRKAWVAQGRSIEELPYEALFYPWTPVLSL 458

Query: 475 FFCVLIAFIKNFTVFIGEFDYKSFITGYIGLPLYVIFYFG 514
              + +A I+ ++ F+  FD  +F+  YI LP+ ++ Y G
Sbjct: 459 AANIFLALIQGWSYFV-PFDAGNFVDAYILLPVGILLYIG 497

>SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {ON}
           similar to uniprot|P38090 Saccharomyces cerevisiae
           YBR132C AGP2 Plasma membrane carnitine transporter
           expression is down-regulated by osmotic stress also
           functions as a low-affinity amino acid permease
          Length = 558

 Score =  229 bits (583), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 141/491 (28%), Positives = 247/491 (50%), Gaps = 13/491 (2%)

Query: 51  KKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMA 110
            ++L+ RH+ +I I                    P  +L+ +S   I +  +     EM 
Sbjct: 45  HRKLQNRHVQLIGISGVIGTALFVSIGRALYHGGPVFLLLGFSLWCIPILCITVSTAEMV 104

Query: 111 TYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPG 169
            Y+P    F   A+R  D +L     + + F   +  P ++ A   +I YW  R+  +  
Sbjct: 105 CYMPFSSPFLRIASRCVDNSLAIMASWNFWFLECVQIPFEIVAVNTMIHYW--RDDYSAA 162

Query: 170 VWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFR 229
           + + + +V+ + I+   VRY+GE EFWL+SFKI +  G+  F FI MLGG P HDR GFR
Sbjct: 163 IPLVVQVVLYLAISVFAVRYYGEMEFWLASFKIFLAIGLFFFTFITMLGGNPKHDRYGFR 222

Query: 230 YWKNPGAFKPY----SESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNI 285
            +K+   FK Y     +++  S G F  F+A  + A F   G +   ++A E   PR+ +
Sbjct: 223 NFKDL-PFKEYFPNNDKTVGSSAGYFQGFLACLIQASFTIAGPDYVSMIAGETLLPRKVL 281

Query: 286 PRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXXXXX-XXPFVVAIQNSGVRA 344
           P A K    R+ + ++     +G+  + NDP L              P+V+A+ N G++ 
Sbjct: 282 PIAFKQVFVRLTVLFLGGCLCIGIVCSANDPNLTAAITEDRPGAGASPYVIAMNNLGIKV 341

Query: 345 LPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXX 404
           LP I N  ++   FSA N+  Y  +R+LY +A+DG APK+F++ NR GVP  A       
Sbjct: 342 LPDIVNAALITAAFSAGNAYTYCSSRTLYGMALDGYAPKVFSRCNRHGVPIFAVAVSLLW 401

Query: 405 XXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAP 464
              + + +   SA + N+ VN+++   ++++  + + Y+FF RA +AQ  +     +++ 
Sbjct: 402 ALLSLLQLGKNSAVVLNWLVNLITASQLINFGVLCVVYLFFRRAYMAQRDNLPELPFKSW 461

Query: 465 FQPYGAYITLFFCVLIAFIKNFTVFIGE-FDYKSFITGYIGLPLYVIFYFGYKIIY---K 520
           +QPY A I L    ++  ++ +TVF    ++Y+SF+  Y+ + + +  Y G+K +    K
Sbjct: 462 WQPYPAIIGLVSVSVMTIVQGYTVFFKTLWNYESFLFSYLMIFVDIFIYLGHKFVINYGK 521

Query: 521 TKLVKAEEADL 531
             + + ++ DL
Sbjct: 522 DPVKRPQDVDL 532

>NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.397
           YBR132C
          Length = 584

 Score =  229 bits (584), Expect = 6e-67,   Method: Compositional matrix adjust.
 Identities = 148/536 (27%), Positives = 266/536 (49%), Gaps = 13/536 (2%)

Query: 9   DSKLIREDI-IDLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXX 67
           D+ L  +D  I      T+S++S  Q++DS             K+ L  RH+ +IAI   
Sbjct: 36  DTDLDSDDFFIPTTSRGTTSVSS--QDNDSKTFLVASH---TTKRNLVNRHVQLIAISGV 90

Query: 68  XXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRYC 126
                            PA +L+A++   I +  +     EM  ++P+   F   AT+  
Sbjct: 91  IGTAIFVAIGKPLYRGGPAFLLLAFAIWCIPILCITVSTAEMVCFMPVSSPFLRLATKCV 150

Query: 127 DPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVG 186
           D +L     + + F   +  P ++     +I YW  R+  +  + + I  ++ ++I+   
Sbjct: 151 DDSLAVMASWNFWFLECVQIPYEIVTVNTIIHYW--RDDYSAAIPLVIQSLLYLLISLAA 208

Query: 187 VRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESIT- 245
           V+++GE EFWL+SFKI++  G+  F FI MLGG P  DR GFRY+ +    K + + I  
Sbjct: 209 VKWYGEMEFWLASFKIVLAMGLFCFTFITMLGGNPKKDRFGFRYFHDTPFKKYFPDGIDR 268

Query: 246 -GSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTI 304
             S G F  F    + A F   G E   ++A E E PRR +PRA K    R+ + ++ + 
Sbjct: 269 GSSAGYFQGFFICLIQASFTIAGGEYISMLAGEIEIPRRVLPRAFKQVFMRLTILFLGSC 328

Query: 305 FLLGMCVAYNDPRLLXXXXXXXXXX-XXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNS 363
             +G+  + ND  L              P+V+A+ N G+R LP I N+ ++   FS+ N+
Sbjct: 329 LCVGILCSPNDSSLTAAINEARPGAGSSPYVIAMNNLGIRILPDIVNITLITAAFSSGNA 388

Query: 364 DLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYF 423
             Y  +R+LY +A+DG APK+F + N+ GVP  A          + + ++S SA + N+ 
Sbjct: 389 YTYCSSRTLYGMALDGYAPKIFTRCNKQGVPIYAVGVSLLWAFISLLQLNSNSAIVLNWL 448

Query: 424 VNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFI 483
           +N+++   ++++  + ITY+FF RA + Q        +++ +QPY A   L   +++  +
Sbjct: 449 INIITASQLINFAILCITYLFFRRAYLLQKDKLPELPFKSWWQPYTAIFGLVCAMVMMIV 508

Query: 484 KNFTVFIGE-FDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVKAEEADLYSFKEAI 538
           + +TVF  + ++ + F+  Y+ + + +  Y  YK I++    K ++    SF++ +
Sbjct: 509 QGYTVFFPKNWNVQDFLFCYLMIFINIGIYIFYKFIWRLGKDKIKDPATISFEDEL 564

>CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa]
           {ON} highly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132c AGP2 amino-acid permease
          Length = 593

 Score =  229 bits (584), Expect = 7e-67,   Method: Compositional matrix adjust.
 Identities = 146/508 (28%), Positives = 258/508 (50%), Gaps = 11/508 (2%)

Query: 23  NTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXX 82
           + T S++  E E  SN       +     ++L  RH+  IAI                  
Sbjct: 51  DVTRSISFDEDERSSNDSRTQLIESTSTHRKLLNRHVQFIAISGVIGTALFVAIGKPLYR 110

Query: 83  XXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRYCDPALGFAVGYCYLFK 141
             PA++L+A++   I +  +     EM +++P+   F   A +  D +LG    + + F 
Sbjct: 111 GGPANLLLAFALWCIPILCITVSTAEMVSFMPVSSPFLRLAKKCVDESLGVTASWNFWFL 170

Query: 142 YFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFK 201
             +  P ++ +   +I YW  R+  +P + + I +V+ V+I+   V+Y+GE EFWL+SFK
Sbjct: 171 ECVQIPYEIVSVNTIIHYW--RDDYSPAIPLVIQVVLYVLISVCAVKYYGEMEFWLASFK 228

Query: 202 IMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPY----SESITGSKGKFVSFVAV 257
           I++  G+  F FI MLGG P HDR GFRY+     FK Y    +E    S G F  F+  
Sbjct: 229 IILAVGLFCFTFITMLGGNPKHDRYGFRYYGE-SPFKKYFPDGNEGAGKSAGYFQGFLTC 287

Query: 258 FVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPR 317
            + A F   G E   ++A E + PR+ +P+A K    R+ + ++ +   +G+  + ND  
Sbjct: 288 LIQAAFTIAGGEYISMLAGEVKLPRKVLPKAFKQVFVRLTVIFLGSCLCVGIVCSPNDSA 347

Query: 318 LLXXXXXXXXXX-XXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLA 376
           L              P+V+A+ N  +R LP I N+ ++   FSA N+  Y  +R+LY +A
Sbjct: 348 LTAAINEARPGAGSSPYVIAMNNLQIRVLPDIVNIALITAAFSAGNAYTYCSSRTLYGMA 407

Query: 377 IDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWI 436
           +DG APK+F K N++GVP  A          + + ++S SA + N+ +N+++   +++++
Sbjct: 408 LDGYAPKIFTKCNKYGVPIYAVGVSLCWALLSLLQLNSNSAVVLNWLINLITASQLINFV 467

Query: 437 SILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGE-FDY 495
            + + Y+FF RA + Q        +++ +QPY   + L   +++  ++ +TVF  + ++ 
Sbjct: 468 FLCVIYLFFRRAYMTQKERLPELPFKSWWQPYTVIVGLVSVLIMILLQGYTVFFPKLWNG 527

Query: 496 KSFITGYIGLPLYV-IFYFGYKIIYKTK 522
           + FI  Y+ + L + I+ F   I YK K
Sbjct: 528 RDFIFCYLMVFLDIGIYVFTKFIWYKGK 555

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  229 bits (583), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 162/548 (29%), Positives = 270/548 (49%), Gaps = 35/548 (6%)

Query: 8   KDSKLIREDIIDLEKNTTSSLNSFEQEDDSNKIS-DGKEDGVRLKKELKARHISMIAIXX 66
            D  + +E  IDL+K    + N   +  DS K   DG      LK++LK+RH+ MIAI  
Sbjct: 27  SDGIMSKETEIDLDKKEDKNKNIVRRMIDSFKPPLDGSYHSDNLKRKLKSRHLIMIAIGG 86

Query: 67  XXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRY 125
                             P +++I +S  G  +   +  LGE+    P+ G F +Y+TR 
Sbjct: 87  SIGTGLFVGSGKALATGGPLAMIIGWSIAGSQMVGTIHGLGEITMRFPVVGAFANYSTRL 146

Query: 126 CDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTV 185
            DP++ F V   Y+ +++ + P +L A A+ +Q+W  +  V+P VW+ IF V++V +N  
Sbjct: 147 LDPSISFMVSSIYICQWYFVLPIELIASAMTVQFWTTK--VDPVVWVAIFYVIVVSVNLF 204

Query: 186 GVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESIT 245
           GV+ FGE EF  S  K++ + G I+   I++ GGGP+H  +G  YW +PGA         
Sbjct: 205 GVKVFGEAEFAFSLVKVITIIGFIILSIILICGGGPDHRFIGTEYWHHPGALA------N 258

Query: 246 GSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIF 305
           G KG      +VFV A ++  G E+  + +AE +   + +P AIK   +RI+ F++V++ 
Sbjct: 259 GFKG----VASVFVTASYSLGGSEMVCLCSAETDP--KELPHAIKQVFWRIVFFFLVSLT 312

Query: 306 LLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDL 365
           L+G  V Y +  LL            PFV+AI+ SG+R LP I N  +LI + S  NS +
Sbjct: 313 LVGFLVPYTNENLLGGSSVNNS----PFVIAIKLSGIRVLPSIINAVILISILSVGNSCI 368

Query: 366 YVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVN 425
           +  +R+L S+A  G  P++F   +R G P             A++  S+    +F++ + 
Sbjct: 369 FASSRTLCSMAHQGLIPRVFGYVDRAGRPLVGIIVNSLFGLLAFLVKSASMGVVFDWLMA 428

Query: 426 VVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKN 485
           +  +   + W+SI I++I F  A  AQN   +   +++    YG+  +    +LI  I  
Sbjct: 429 IAGLATCVVWLSINISHIRFRLAMKAQNRSLDELEFKSSVGVYGSIYSATVNILI-LIAQ 487

Query: 486 FTVFI--------GEFDYKSFITGYIGLPLYVIFYFGYKIIYKTKLVK------AEEADL 531
           F + +         +   +SF   Y+   + V  +  +KI +K    K        E DL
Sbjct: 488 FYISLWPVGGWTSSQQRTESFFKNYLCALVLVFVFVTHKIYFKCSTGKWFDFKPLAEIDL 547

Query: 532 YSFKEAID 539
            + ++ ID
Sbjct: 548 ETDRKNID 555

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  229 bits (584), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 173/546 (31%), Positives = 278/546 (50%), Gaps = 22/546 (4%)

Query: 8   KD-SKLIREDIIDLEK--NTTSSLNSFEQEDDSNKISDGKEDGVR-----LKKELKARHI 59
           KD S    E  ID  +  N   S    E E+    ++D ++  ++     L+ +LK+RH+
Sbjct: 38  KDLSNTTPESTIDKSRWRNFLDSFKRIEVEEVDPNLTDIEKIAIKTARSPLQHKLKSRHL 97

Query: 60  SMIAIXXXXXXXXXXXXXXXXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-F 118
            MIAI                    PA ILI +   G ++F ++  LGE+A   P+ G F
Sbjct: 98  QMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGITGTMIFTMVMALGELAVVFPVSGGF 157

Query: 119 TSYATRYCDPALGFAVGYCYLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVV 178
            +YATR+ D + GFA  + Y+F++ +  P ++ A ++ + YW        G ++ +F +V
Sbjct: 158 LTYATRFIDESFGFANNFNYMFQWLVALPLEIVAASITVDYWETPVRYTDG-FVALFWLV 216

Query: 179 IVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFK 238
           +VIIN  GVR +GE EF  S  K++ + G I+   I++ GGGP    +G RYW +PGAF 
Sbjct: 217 VVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGIILVCGGGPVGGYVGGRYWHDPGAFA 276

Query: 239 PYSESITGSKGKFVSFVAVFVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIIL 298
            +S        +F  F +VFV A F++ G EL GI +AE++NPR+++P+A K   +RI+L
Sbjct: 277 GHSPG-----RRFKGFCSVFVTAAFSFAGSELVGIASAESKNPRKSVPQAAKQVFWRILL 331

Query: 299 FYIVTIFLLGMCVAYNDPRLLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVF 358
           FYI+ + L+G+ V Y DPRLL            PFV+AI   G+  LP + NV +LI V 
Sbjct: 332 FYILCLLLVGLLVPYTDPRLL--GSSGVDASASPFVIAIVTHGISGLPSVVNVVILISVL 389

Query: 359 SACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQ 418
           S  NS +Y  +R+L +L+  G  PK  A  +R G P             A++  S+   Q
Sbjct: 390 SVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGIAICSGFGLIAFVAASNKKEQ 449

Query: 419 IFNYFVNVVSIFGILSWISILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAY--ITLFF 476
           +FN+ + +  I   L+W SI   +I F  A        +   +++P    G+Y  + L  
Sbjct: 450 MFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDELPFKSPVGIIGSYWGMCLAV 509

Query: 477 CVLIAFIKNFTVFIGEF-DYKSFITGYIGLPLYVIFYFGYKIIYKT--KLVKAEEADLYS 533
            +L+A   N    IG   +   F + Y+  P+ + FY  +K+  +    L+  ++ D+ +
Sbjct: 510 LMLVAQFYNALFPIGSSPNAYDFFSAYLAAPIVLAFYIAHKLWKRNWKLLIPLKDIDIDT 569

Query: 534 FKEAID 539
            +   D
Sbjct: 570 GRRETD 575

>TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.397
           YBR132C
          Length = 583

 Score =  228 bits (582), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 144/496 (29%), Positives = 247/496 (49%), Gaps = 14/496 (2%)

Query: 37  SNKISDGKEDGVRLK------KELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPASILI 90
           SN+   G ++ + +K      + LK RH+  IAI                    P +++I
Sbjct: 48  SNRSRTGSDEELLIKEIYTTKRNLKNRHVQFIAISGVIGTAIFVAIGKALYKGGPGNLII 107

Query: 91  AYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIITPNQ 149
           A++   I +  +     EM ++ P+   F   AT   D +      + + F   +  P +
Sbjct: 108 AFAVWCIPILCITMSTAEMVSFYPVHSPFLRLATMCGDDSFSIMASWNFWFLECVQIPFE 167

Query: 150 LTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVI 209
           + +   +I YW  R+  +  + + + +V+ ++I+ + V+Y+GE EFWL+SFKI++  G+ 
Sbjct: 168 IVSVNTIIHYW--RDDYSAAIPLVVQVVLYILISVLAVKYYGELEFWLASFKIILALGLF 225

Query: 210 LFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITG---SKGKFVSFVAVFVYALFAYL 266
           LF FI M+GG P HDR GFRY       K Y +  T    S G F  F+   + A F   
Sbjct: 226 LFTFITMVGGNPKHDRYGFRYLSESPFKKYYPDGDTTAGPSAGHFQGFLICLIQAAFTIA 285

Query: 267 GIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXX 326
           G E   ++A E   PR+ +P+A K   +R+   +I + F +G+  + NDP L        
Sbjct: 286 GGEYISMLAGEVCLPRKVMPKAFKQVFWRLTFIFIGSCFCVGIVCSSNDPLLTSAINESR 345

Query: 327 XXX-XXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLF 385
                 P+V+A+QN  +R LP I N+ ++   FSA N+  Y  +R+LY +A+DG APK+F
Sbjct: 346 PGAGSSPYVIAMQNLQIRILPDIVNIALITAAFSAGNAYTYCSSRTLYGIALDGNAPKIF 405

Query: 386 AKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFF 445
            K N+ GVP             + + ++S SA + N+ +N+++   ++++  I ITY+ F
Sbjct: 406 KKCNKEGVPIYCVLVSTLWALLSLLQLNSNSAVVLNWLINLITASQLINFSCICITYLLF 465

Query: 446 YRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGE-FDYKSFITGYIG 504
            RA  AQ        + + +QPY  Y  LF  + +  ++ +TVF  + +    F+  Y+ 
Sbjct: 466 RRAYRAQEDSLPRLPFTSWYQPYTTYFGLFCSISMMLVQGYTVFFKKLWAVDDFLFNYLM 525

Query: 505 LPLYVIFYFGYKIIYK 520
           + + +  Y G K I+K
Sbjct: 526 IFIDLAIYLGVKFIWK 541

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  228 bits (581), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 158/534 (29%), Positives = 261/534 (48%), Gaps = 33/534 (6%)

Query: 21  EKNTTSSLNSFEQEDDSNKIS-DGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXX 79
           + +  S+ N F++  DS K   DG  D   LK+ LK RH+ MIAI               
Sbjct: 48  DNHQYSNRNIFQRCVDSFKPPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKA 107

Query: 80  XXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRYCDPALGFAVGYCY 138
                P  +++ ++  G  +   +  LGE+    P+ G F +Y TR+ DP++ F V   Y
Sbjct: 108 IAEGGPLGVVLGWTIAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIY 167

Query: 139 LFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLS 198
           + ++F + P ++ A A+ +QYW    +++P VW+ IF V+IV IN  GVR FGE EF  S
Sbjct: 168 VLQWFFVLPLEIIAAAMTVQYW--NSSIDPVVWVAIFYVIIVSINLFGVRGFGEAEFAFS 225

Query: 199 SFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVF 258
           + K + + G I+   +++ GGGP+H+ +G +YW +PG               F   ++V 
Sbjct: 226 TIKAITVCGFIILCIVLIFGGGPDHEYVGAKYWYDPGCL----------ANGFPGILSVL 275

Query: 259 VYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRL 318
           V A ++  GIE+T +  A  E   + +P AIK   +RI+ F++V++ L+G  V Y +  L
Sbjct: 276 VVASYSLGGIEMTCL--ASGETDPKGLPSAIKQVFWRILFFFLVSLTLVGFLVPYTNQNL 333

Query: 319 LXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAID 378
           L            PFV+AI+   ++ LP I NV +LI V S  NS ++  +R+L S+A  
Sbjct: 334 L----GGSSVDNSPFVIAIKLHHIKVLPSIVNVVILISVLSVGNSCIFASSRTLCSMAHQ 389

Query: 379 GKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISI 438
           G  P  F   +R G P             A++  S     +FN+ + +  +   + W+SI
Sbjct: 390 GLIPWWFGYIDRAGRPLVGIMANSLFGLLAFLVKSGSMGDVFNWLMAIAGLATCIVWLSI 449

Query: 439 LITYIFFYRACIAQNVDRNSFAYRAPFQPYG-AYITLFFC-VLIAFIKNFTVFIGEFDYK 496
            +++I F  A  AQ    +   + +    +G AY  L  C +L+A        IG +   
Sbjct: 450 NVSHIRFRMAMKAQGKKLDELEFVSAVGIWGSAYSALINCLILLAQFYCSLWPIGGWKNS 509

Query: 497 S-----FITGYIGLPLYVIFYFGYKIIYKTKL-----VKA-EEADLYSFKEAID 539
           S     F   Y+   + +  +  +KI YK +      +KA ++ DL + ++ ID
Sbjct: 510 SDRAKIFFQNYLCALIVLFIFIAHKIYYKCQTGQWWGIKALKDIDLETDRKNID 563

>Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)
          Length = 523

 Score =  226 bits (577), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 150/497 (30%), Positives = 238/497 (47%), Gaps = 20/497 (4%)

Query: 19  DLEKNTTSSLNSFEQEDDSNKISDGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXX 78
           D++  +  ++ + +  DD +        GV  K+ LK RHIS++A+              
Sbjct: 3   DVKAFSPLNIKTVKIRDDRDVSEFDPNTGV--KRALKNRHISLLALGGIIGPGCLVGAGN 60

Query: 79  XXXXXXPASILIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRYCDPALGFAVGYC 137
                 P ++L+ +  +GI+ F VM  +GEM T  P  G FT+ A R+   AL    GY 
Sbjct: 61  ALQKGGPLALLLGFVIIGIIAFAVMESIGEMITLYPSGGGFTTLARRFHSDALSAVCGYA 120

Query: 138 YLFKYFIITPNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWL 197
           Y+  +F +  N+    + ++Q+W  +  +    +  IF +V  I   +GV  FGE E+WL
Sbjct: 121 YVIVFFAVLANEYNTLSSILQFWGPQVPLY--AYTLIFWIVFEIFQLIGVGVFGETEYWL 178

Query: 198 SSFKIMVMFGVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAV 257
           S  KI+ +    +F  I M GG  N    GF YWK+PG+          S G F     V
Sbjct: 179 SLLKILGLIVYYIFSIIYMSGGVRNKPAFGFHYWKDPGSL---------SHG-FKGIAVV 228

Query: 258 FVYALFAYLGIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPR 317
           FV+    Y G E   + A E++NP +++P A++ T++RI++ YI      G  V +NDP 
Sbjct: 229 FVFCSSFYSGTESVALTATESKNPTKSVPYAVRQTLWRIVVVYIGIAIFYGSTVPFNDPN 288

Query: 318 LLXXXXXXXXXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAI 377
           L             P  +AI  +G     H+ N  +L    SA N  LY+G+R+L +LA 
Sbjct: 289 L----SVNTKVLKSPIAIAISRAGWAGGSHLVNAFILFSCISAINGSLYIGSRTLTNLAY 344

Query: 378 DGKAPKLFAKTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWIS 437
           +G APK  A T++ GVP  A          + MN+S G++  ++Y VN+  +   + W  
Sbjct: 345 EGLAPKFLAWTDKRGVPIPAITIFNALGLISLMNMSVGASNAYSYIVNLSGVGVFIVWGV 404

Query: 438 ILITYIFFYRACIAQNVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKS 497
           I  T++   +A +AQ        Y+A F P+    +L   + +A I+ +T  +  F    
Sbjct: 405 ISYTHLRLRKAWVAQGRLLEELPYKALFYPWTPIFSLISNIFLALIQGWTSLV-PFKAPE 463

Query: 498 FITGYIGLPLYVIFYFG 514
           F+  YI LP  +I Y G
Sbjct: 464 FVDAYILLPAAIILYVG 480

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  228 bits (581), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 156/528 (29%), Positives = 259/528 (49%), Gaps = 37/528 (7%)

Query: 29  NSFEQEDDSNKIS-DGKEDGVRLKKELKARHISMIAIXXXXXXXXXXXXXXXXXXXXPAS 87
           N F++  DS K   DG  D   LK+ LK RH+ MIAI                    P  
Sbjct: 56  NIFQRCVDSFKSPLDGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLG 115

Query: 88  ILIAYSFVGILVFFVMACLGEMATYIPLDG-FTSYATRYCDPALGFAVGYCYLFKYFIIT 146
           ++I ++  G  +   +  LGE+    P+ G F +Y TR+ DP++ F V   Y+ ++F + 
Sbjct: 116 VVIGWAIAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVL 175

Query: 147 PNQLTAGALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMF 206
           P ++ A A+ +QYW    +++P +W+ IF  VIV IN  GVR FGE EF  S+ K + + 
Sbjct: 176 PLEIIAAAMTVQYW--NSSIDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVC 233

Query: 207 GVILFLFIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYL 266
           G I+   +++ GGGP+H+ +G +YW +PG               F   ++V V A ++  
Sbjct: 234 GFIILCVVLICGGGPDHEFIGAKYWHDPGCL----------ANGFPGVLSVLVVASYSLG 283

Query: 267 GIELTGIVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLXXXXXXX 326
           GIE+T +  A  E   + +P AIK   +RI+ F+++++ L+G  V Y +  LL       
Sbjct: 284 GIEMTCL--ASGETDPKGLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLL----GGS 337

Query: 327 XXXXXPFVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFA 386
                PFV+AI+   ++ALP I N  +LI V S  NS ++  +R+L S+A  G  P  F 
Sbjct: 338 SVDNSPFVIAIKLHHIKALPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFG 397

Query: 387 KTNRWGVPYNAXXXXXXXXXXAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFY 446
             +R G P             A++  S   +++FN+ + +  +   + W+SI +++I F 
Sbjct: 398 YIDRAGRPLVGIMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFR 457

Query: 447 RACIAQNVDRNSFAYRAPFQPYG-AYITLFFCVLIAFIKNFTVFI--------GEFDYKS 497
            A  AQ    +   + +    +G AY  L  C+++  I  F   +        G+   K 
Sbjct: 458 LAMKAQGKSLDELEFVSAVGIWGSAYSALINCLIL--IAQFYCSLWPIGGWTSGKERAKI 515

Query: 498 FITGYIGLPLYVIFYFGYKIIYKTKL-----VKA-EEADLYSFKEAID 539
           F   Y+   + +  +  +KI YK +      VKA ++ DL + ++ ID
Sbjct: 516 FFQNYLCALIMLFIFIVHKIYYKCQTGKWWGVKALKDIDLETDRKDID 563

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.329    0.145    0.445 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 52,861,860
Number of extensions: 2124540
Number of successful extensions: 10003
Number of sequences better than 10.0: 383
Number of HSP's gapped: 8332
Number of HSP's successfully gapped: 404
Length of query: 575
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 460
Effective length of database: 40,294,809
Effective search space: 18535612140
Effective search space used: 18535612140
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.8 bits)
S2: 68 (30.8 bits)