Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_348.92.534ON1301306733e-92
TPHA0G035202.534ON2041305875e-78
SAKL0A09504g2.534ON1671305341e-70
CAGL0K03025g2.534ON1671305342e-70
TBLA0G022402.534ON1671305281e-69
KNAG0C058002.534ON1671305202e-68
Skud_13.2272.534ON1671305185e-68
YMR071C (TVP18)2.534ON1671305176e-68
Suva_13.2482.534ON1671305115e-67
TDEL0A030802.534ON1671305091e-66
NCAS0F008902.534ON1671305082e-66
NDAI0H013902.534ON1671305072e-66
KLTH0D06864g2.534ON1671305055e-66
KAFR0A018702.534ON1671304742e-61
Smik_13.2502.534ON1671304672e-60
ZYRO0B02024g2.534ON1661314282e-54
AGL072W2.534ON1671304057e-51
Ecym_72542.534ON1671303882e-48
KLLA0E18525g2.534ON1711313493e-42
Kwal_26.80252.534ON64652534e-29
KAFR0C062405.143ON48546700.51
TBLA0E036002.205ON89984652.1
YBR275C (RIF1)1.337ON191629652.7
TBLA0E007007.17ON1274104625.4
TPHA0I020308.515ON40752625.7
KLLA0D13200g5.365ON55051608.6
Suva_7.4915.143ON54256608.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_348.9
         (130 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_348.9 s348 complement(17797..18189) [393 bp, 130 aa] {ON} c...   263   3e-92
TPHA0G03520 Chr7 complement(751783..752397) [615 bp, 204 aa] {ON...   230   5e-78
SAKL0A09504g Chr1 complement(833526..833958,834035..834105) [504...   210   1e-70
CAGL0K03025g Chr11 complement(283076..283579) [504 bp, 167 aa] {...   210   2e-70
TBLA0G02240 Chr7 complement(581646..582149) [504 bp, 167 aa] {ON...   207   1e-69
KNAG0C05800 Chr3 (1126605..1127108) [504 bp, 167 aa] {ON} Anc_2....   204   2e-68
Skud_13.227 Chr13 complement(385097..385600) [504 bp, 167 aa] {O...   204   5e-68
YMR071C Chr13 complement(410762..411265) [504 bp, 167 aa] {ON}  ...   203   6e-68
Suva_13.248 Chr13 complement(392000..392503) [504 bp, 167 aa] {O...   201   5e-67
TDEL0A03080 Chr1 complement(550148..550651) [504 bp, 167 aa] {ON...   200   1e-66
NCAS0F00890 Chr6 (179151..179654) [504 bp, 167 aa] {ON} Anc_2.53...   200   2e-66
NDAI0H01390 Chr8 (338958..339461) [504 bp, 167 aa] {ON} Anc_2.53...   199   2e-66
KLTH0D06864g Chr4 complement(599324..599756,599835..599905) [504...   199   5e-66
KAFR0A01870 Chr1 complement(389508..390011) [504 bp, 167 aa] {ON...   187   2e-61
Smik_13.250 Chr13 complement(394856..395359) [504 bp, 167 aa] {O...   184   2e-60
ZYRO0B02024g Chr2 complement(163601..164101) [501 bp, 166 aa] {O...   169   2e-54
AGL072W Chr7 (574009..574512) [504 bp, 167 aa] {ON} Syntenic hom...   160   7e-51
Ecym_7254 Chr7 (536391..536894) [504 bp, 167 aa] {ON} similar to...   154   2e-48
KLLA0E18525g Chr5 (1647606..1648121) [516 bp, 171 aa] {ON} simil...   139   3e-42
Kwal_26.8025 s26 complement(615707..615901) [195 bp, 64 aa] {ON}...   102   4e-29
KAFR0C06240 Chr3 complement(1242911..1244368) [1458 bp, 485 aa] ...    32   0.51 
TBLA0E03600 Chr5 (903482..906181) [2700 bp, 899 aa] {ON} Anc_2.2...    30   2.1  
YBR275C Chr2 complement(751356..757106) [5751 bp, 1916 aa] {ON} ...    30   2.7  
TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {...    28   5.4  
TPHA0I02030 Chr9 (453623..454846) [1224 bp, 407 aa] {ON} Anc_8.5...    28   5.7  
KLLA0D13200g Chr4 (1130332..1131984) [1653 bp, 550 aa] {ON} simi...    28   8.6  
Suva_7.491 Chr7 complement(849038..850666) [1629 bp, 542 aa] {ON...    28   8.8  

>Kpol_348.9 s348 complement(17797..18189) [393 bp, 130 aa] {ON}
           complement(17797..18189) [393 nt, 131 aa]
          Length = 130

 Score =  263 bits (673), Expect = 3e-92,   Method: Compositional matrix adjust.
 Identities = 130/130 (100%), Positives = 130/130 (100%)

Query: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60
           MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC
Sbjct: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60

Query: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120
           IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF
Sbjct: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120

Query: 121 PHDAVVREML 130
           PHDAVVREML
Sbjct: 121 PHDAVVREML 130

>TPHA0G03520 Chr7 complement(751783..752397) [615 bp, 204 aa] {ON}
           Anc_2.534 YMR071C
          Length = 204

 Score =  230 bits (587), Expect = 5e-78,   Method: Compositional matrix adjust.
 Identities = 110/130 (84%), Positives = 123/130 (94%)

Query: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60
           MALGIANLFHVNAVIAFGIVAIVQSL+ILF+E+PFLLKICPLS+NF+NF+K FETNG+RC
Sbjct: 75  MALGIANLFHVNAVIAFGIVAIVQSLVILFIEIPFLLKICPLSDNFVNFVKYFETNGWRC 134

Query: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120
           +F+T MAIVQWCSL L VTSLIVVAI L+ISA FYAIA+FK QEFQHT+NVIKNPTDDDF
Sbjct: 135 LFFTGMAIVQWCSLILKVTSLIVVAIGLSISAAFYAIAFFKKQEFQHTSNVIKNPTDDDF 194

Query: 121 PHDAVVREML 130
           PH+AVVREML
Sbjct: 195 PHEAVVREML 204

>SAKL0A09504g Chr1 complement(833526..833958,834035..834105) [504
           bp, 167 aa] {ON} highly similar to uniprot|Q04767
           Saccharomyces cerevisiae YMR071C TVP18 Tlg2-Vesicle
           Protein of 18 kDa Integral membrane vesicle protein
          Length = 167

 Score =  210 bits (534), Expect = 1e-70,   Method: Compositional matrix adjust.
 Identities = 100/130 (76%), Positives = 119/130 (91%), Gaps = 1/130 (0%)

Query: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60
           +ALGIANLFHVNAV+AFG+++I+QSL+ILF+EVPFLLKICPLS+NFI FIK FETNG R 
Sbjct: 39  LALGIANLFHVNAVVAFGVLSIIQSLVILFIEVPFLLKICPLSDNFIEFIKRFETNGKRT 98

Query: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120
           +FYT MAI+QWCSLALM TSLIVVAI LTISA  YA+A+ K+Q+FQ+ TN+IKNPTD+DF
Sbjct: 99  LFYTAMAIIQWCSLALMTTSLIVVAIGLTISAASYAVAWSKHQQFQN-TNIIKNPTDEDF 157

Query: 121 PHDAVVREML 130
           PH+AVVREML
Sbjct: 158 PHEAVVREML 167

>CAGL0K03025g Chr11 complement(283076..283579) [504 bp, 167 aa] {ON}
           highly similar to uniprot|Q04767 Saccharomyces
           cerevisiae YMR071c
          Length = 167

 Score =  210 bits (534), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 102/130 (78%), Positives = 117/130 (90%), Gaps = 1/130 (0%)

Query: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60
           +ALGIANLFHV+AVIAFGIV IVQ LIILF+E+PFLLKICPLS+ FI FIK FETNGYRC
Sbjct: 39  IALGIANLFHVSAVIAFGIVGIVQGLIILFIEIPFLLKICPLSDRFIEFIKRFETNGYRC 98

Query: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120
           IFYTLMAIVQ+CSLA+M TSL+V+ I LTISA+ Y IA+ K+QEF + TN+IKNPTD+DF
Sbjct: 99  IFYTLMAIVQYCSLAVMTTSLLVLGITLTISAVSYGIAFTKHQEFAN-TNIIKNPTDEDF 157

Query: 121 PHDAVVREML 130
           PHDAVVREML
Sbjct: 158 PHDAVVREML 167

>TBLA0G02240 Chr7 complement(581646..582149) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  207 bits (528), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 103/130 (79%), Positives = 116/130 (89%), Gaps = 1/130 (0%)

Query: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60
           +ALGIANLFHVN VIAFGIV+I+QS IILFVEVPFLLKICPLS+NFI FIK+F+TNG+RC
Sbjct: 39  VALGIANLFHVNPVIAFGIVSIIQSFIILFVEVPFLLKICPLSDNFIAFIKHFQTNGFRC 98

Query: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120
           IFY  MA VQWCS+ L  TSLIVVAI LTISAI YA+AYFKNQEFQ+ + +IKNPTDDDF
Sbjct: 99  IFYIAMATVQWCSIILKATSLIVVAIGLTISAISYAVAYFKNQEFQNVS-IIKNPTDDDF 157

Query: 121 PHDAVVREML 130
           P +AVVREML
Sbjct: 158 PREAVVREML 167

>KNAG0C05800 Chr3 (1126605..1127108) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  204 bits (520), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 97/130 (74%), Positives = 117/130 (90%), Gaps = 1/130 (0%)

Query: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60
           +ALGIANLFHV+ VIAFGIV+IVQ LIILF+E+PFLLKICPLS+NFI FI  FETNGYR 
Sbjct: 39  VALGIANLFHVSGVIAFGIVSIVQGLIILFIEIPFLLKICPLSDNFIEFISRFETNGYRA 98

Query: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120
           +FY  MA++Q+CS+ LMVTSL+VVAICLT+SA+FYA+A+ K+QEFQ+ TN+IKNP D DF
Sbjct: 99  MFYLAMAVIQYCSVILMVTSLLVVAICLTVSAVFYAVAFVKHQEFQN-TNIIKNPADADF 157

Query: 121 PHDAVVREML 130
           PH+AVVREML
Sbjct: 158 PHEAVVREML 167

>Skud_13.227 Chr13 complement(385097..385600) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  204 bits (518), Expect = 5e-68,   Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 118/130 (90%), Gaps = 1/130 (0%)

Query: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60
           +ALGIANLFHV+ VIAFGI++I+Q L+ILF+E+PFLLKICPLS+NF+ FIK FETNG+RC
Sbjct: 39  IALGIANLFHVSGVIAFGIISIIQGLVILFIEIPFLLKICPLSDNFVEFIKKFETNGWRC 98

Query: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120
           IFY  MA++Q+ S+A+M TSLIVVA+ LTIS+I YA+AY K+QEFQ+ TN+IKNPTDDDF
Sbjct: 99  IFYLAMAVIQYVSIAVMATSLIVVAVGLTISSISYAVAYTKHQEFQN-TNIIKNPTDDDF 157

Query: 121 PHDAVVREML 130
           PH+AVVREML
Sbjct: 158 PHEAVVREML 167

>YMR071C Chr13 complement(410762..411265) [504 bp, 167 aa] {ON}
           TVP18Integral membrane protein localized to late Golgi
           vesicles along with the v-SNARE Tlg2p; may interact with
           ribosomes, based on co-purification experiments
          Length = 167

 Score =  203 bits (517), Expect = 6e-68,   Method: Compositional matrix adjust.
 Identities = 96/130 (73%), Positives = 118/130 (90%), Gaps = 1/130 (0%)

Query: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60
           +ALGIANLFHV+ VIAFGI++I+Q L+ILF+E+PFLLKICPLS+NFI FIK FETNG+RC
Sbjct: 39  IALGIANLFHVSGVIAFGIISIIQGLVILFIEIPFLLKICPLSDNFIEFIKRFETNGWRC 98

Query: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120
           +FY  MAI+Q+ S+A+M TSLIVVA+ LTIS+I YA+AY K+QEFQ+ TN+IKNPTDDDF
Sbjct: 99  LFYLAMAIIQYISIAVMATSLIVVAVGLTISSISYAVAYTKHQEFQN-TNIIKNPTDDDF 157

Query: 121 PHDAVVREML 130
           PH+AVVREML
Sbjct: 158 PHEAVVREML 167

>Suva_13.248 Chr13 complement(392000..392503) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  201 bits (511), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 94/130 (72%), Positives = 117/130 (90%), Gaps = 1/130 (0%)

Query: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60
           +ALGIANLFHV+ VIAFGI++I+Q L+ILF+E+PFLLKICPLS+NF+ FIK FETNG+RC
Sbjct: 39  IALGIANLFHVSGVIAFGIISIIQGLVILFIEIPFLLKICPLSDNFVEFIKRFETNGWRC 98

Query: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120
           IFY  MA +Q+ S+A+M TSLIVVA+ LTIS+I YA+AY K+QEFQ+ TN++KNPTDDDF
Sbjct: 99  IFYLAMATIQYISIAVMATSLIVVAVGLTISSISYAVAYTKHQEFQN-TNILKNPTDDDF 157

Query: 121 PHDAVVREML 130
           PH+AVVREML
Sbjct: 158 PHEAVVREML 167

>TDEL0A03080 Chr1 complement(550148..550651) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  200 bits (509), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 97/130 (74%), Positives = 116/130 (89%), Gaps = 1/130 (0%)

Query: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60
           +ALGIANLFHV+AVIAFGIVAIVQ LIILFVE+PFLLKICPLS+NFI FIK FETNGYR 
Sbjct: 39  IALGIANLFHVSAVIAFGIVAIVQGLIILFVEIPFLLKICPLSDNFIEFIKRFETNGYRT 98

Query: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120
           +FY +MA++QWCS+A+  TSLIVVA+ LTISA  YA+A  K+QEFQ+ T+++K+PT DDF
Sbjct: 99  LFYVVMAVIQWCSIAVQATSLIVVAVGLTISACSYAVALTKHQEFQN-THILKDPTSDDF 157

Query: 121 PHDAVVREML 130
           PH+AVVREML
Sbjct: 158 PHEAVVREML 167

>NCAS0F00890 Chr6 (179151..179654) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  200 bits (508), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 116/130 (89%), Gaps = 1/130 (0%)

Query: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60
           +ALG+ANLFHVNAVIAFGI++I+Q L+ILF+E+PFLLKICPLSENFI FIK FETNGYRC
Sbjct: 39  IALGVANLFHVNAVIAFGIISIIQGLVILFIEIPFLLKICPLSENFIEFIKRFETNGYRC 98

Query: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120
           +FY  MAI+Q+CS+ LM TSLIVVAI LTIS++ YA+A+  +QEFQ+ TN+IKNP D DF
Sbjct: 99  LFYLGMAIIQYCSIILMATSLIVVAIGLTISSMSYAVAFANHQEFQN-TNIIKNPADADF 157

Query: 121 PHDAVVREML 130
           PH+AVVREM+
Sbjct: 158 PHEAVVREMV 167

>NDAI0H01390 Chr8 (338958..339461) [504 bp, 167 aa] {ON} Anc_2.534
           YMR071C
          Length = 167

 Score =  199 bits (507), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 95/130 (73%), Positives = 115/130 (88%), Gaps = 1/130 (0%)

Query: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60
           + LGI+NLFHVNAVIAFGIV+I+Q L+ILF+E+PFLLKICPLSE FI FIK FETNGYRC
Sbjct: 39  IGLGISNLFHVNAVIAFGIVSIIQGLVILFIEIPFLLKICPLSERFIEFIKRFETNGYRC 98

Query: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120
           +FY +MAI+Q+CS+ALM TSLIVVA+ LTIS+I YAIA+  +QEFQ+ T ++KNPTD DF
Sbjct: 99  VFYLVMAIIQYCSIALMATSLIVVAVGLTISSISYAIAFTNHQEFQN-TQILKNPTDPDF 157

Query: 121 PHDAVVREML 130
           P +AVVREML
Sbjct: 158 PREAVVREML 167

>KLTH0D06864g Chr4 complement(599324..599756,599835..599905) [504
           bp, 167 aa] {ON} highly similar to uniprot|Q04767
           Saccharomyces cerevisiae YMR071C TVP18 Tlg2-Vesicle
           Protein of 18 kDa Integral membrane vesicle protein
          Length = 167

 Score =  199 bits (505), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 97/130 (74%), Positives = 112/130 (86%), Gaps = 1/130 (0%)

Query: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60
           +ALGIANLFHV+AVI FGI+AIVQ L+ILFVEVPFLL+ICPLS+NFI FIK FETNG R 
Sbjct: 39  VALGIANLFHVSAVIVFGIIAIVQGLVILFVEVPFLLRICPLSDNFIAFIKRFETNGKRT 98

Query: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120
           +FY  MA VQWCSLA+M TSLI VAI LTISA  Y +A+FK+Q+FQ T+ VIK+P DDDF
Sbjct: 99  LFYVGMAAVQWCSLAVMATSLIAVAIGLTISAASYGVAFFKHQQFQGTS-VIKSPADDDF 157

Query: 121 PHDAVVREML 130
           PH+AVVREML
Sbjct: 158 PHEAVVREML 167

>KAFR0A01870 Chr1 complement(389508..390011) [504 bp, 167 aa] {ON}
           Anc_2.534 YMR071C
          Length = 167

 Score =  187 bits (474), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 116/130 (89%), Gaps = 1/130 (0%)

Query: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60
           +ALGI+NLFHVNAVIAFGI++I+Q LIILF+E+PFLLKICPLS+NF+ FIK FETNGYRC
Sbjct: 39  IALGISNLFHVNAVIAFGIISIIQGLIILFIEIPFLLKICPLSDNFVEFIKRFETNGYRC 98

Query: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120
           +FY +MAI+Q+CS+ LM TSLIVVAICLT+S   Y IA FK QEFQ+ TN+IKNPTD DF
Sbjct: 99  VFYLVMAIIQYCSIILMATSLIVVAICLTVSCASYGIAAFKKQEFQN-TNIIKNPTDTDF 157

Query: 121 PHDAVVREML 130
           PH+AVVREML
Sbjct: 158 PHEAVVREML 167

>Smik_13.250 Chr13 complement(394856..395359) [504 bp, 167 aa] {ON}
           YMR071C (REAL)
          Length = 167

 Score =  184 bits (467), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 98/130 (75%), Positives = 118/130 (90%), Gaps = 1/130 (0%)

Query: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60
           +ALGIANLFHV+ VIAFGI++I+Q LIILF+E+PFLLKICPLS+NFI FIK FETNG+RC
Sbjct: 39  IALGIANLFHVSGVIAFGIISIIQGLIILFIEIPFLLKICPLSDNFIEFIKKFETNGWRC 98

Query: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120
           IFY  MAI+Q+ S+A+M TSLIVVA+ LTIS+I YA+AY K+QEFQ+ TN+IKNPTDDDF
Sbjct: 99  IFYLAMAIIQYISIAVMATSLIVVAVGLTISSISYAVAYTKHQEFQN-TNIIKNPTDDDF 157

Query: 121 PHDAVVREML 130
           PH+AVVREML
Sbjct: 158 PHEAVVREML 167

>ZYRO0B02024g Chr2 complement(163601..164101) [501 bp, 166 aa] {ON}
           similar to uniprot|Q04767 Saccharomyces cerevisiae
           YMR071C TVP18 Tlg2-Vesicle Protein of 18 kDa Integral
           membrane vesicle protein
          Length = 166

 Score =  169 bits (428), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 83/131 (63%), Positives = 105/131 (80%), Gaps = 2/131 (1%)

Query: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60
           +A GIANLFHVNAVIAFG+++IVQ  IILF+EVPFLL+ICPLS+NFI F+  FETNG+R 
Sbjct: 37  IAFGIANLFHVNAVIAFGVISIVQGAIILFLEVPFLLRICPLSDNFIEFVSRFETNGWRT 96

Query: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120
           IFY   A++QW SLAL +TSLIVVA+ LTISA FY +AYFK+Q FQ++++ IK P  +  
Sbjct: 97  IFYIFNAVLQWASLALKITSLIVVAVGLTISAAFYGVAYFKHQNFQNSSH-IKEPVGEGV 155

Query: 121 P-HDAVVREML 130
             ++  VREML
Sbjct: 156 EANEQNVREML 166

>AGL072W Chr7 (574009..574512) [504 bp, 167 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR071C (TVP18)
          Length = 167

 Score =  160 bits (405), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 81/130 (62%), Positives = 99/130 (76%), Gaps = 1/130 (0%)

Query: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60
           +ALGIAN+FH + VIAF IVAIVQ L+++FVEVP LLKICPLS+NFI  +K  +TNG R 
Sbjct: 39  LALGIANIFHFSIVIAFAIVAIVQGLLLIFVEVPILLKICPLSDNFIGLVKKCDTNGRRT 98

Query: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120
           + YT +AIVQ+ SL++ VTSL+ VAI LTISAIFY   Y K QEF    NVI+NPTD  F
Sbjct: 99  LLYTALAIVQYASLSVQVTSLLAVAIGLTISAIFYGTGYLKKQEFLE-GNVIRNPTDPAF 157

Query: 121 PHDAVVREML 130
             +A VRE+L
Sbjct: 158 MREAAVREVL 167

>Ecym_7254 Chr7 (536391..536894) [504 bp, 167 aa] {ON} similar to
           Ashbya gossypii AGL072W
          Length = 167

 Score =  154 bits (388), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 73/130 (56%), Positives = 96/130 (73%), Gaps = 1/130 (0%)

Query: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60
           +ALGIAN+FH   VI F I+A+ Q   +LFVEVPFL+KICPLSE F++ +K F +N  R 
Sbjct: 39  IALGIANIFHFGPVIIFSILALGQGFFLLFVEVPFLVKICPLSERFVSNVKIFNSNMKRT 98

Query: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDF 120
           + Y +MA++QW SL   VTSL+V+AICLT+SAIFYA  +   QEF+  +NV++ P  D F
Sbjct: 99  MLYGVMAVIQWVSLVFEVTSLVVLAICLTVSAIFYASGWLTKQEFKE-SNVLRGPGSDTF 157

Query: 121 PHDAVVREML 130
           PH+A VREML
Sbjct: 158 PHEASVREML 167

>KLLA0E18525g Chr5 (1647606..1648121) [516 bp, 171 aa] {ON} similar
           to uniprot|Q04767 Saccharomyces cerevisiae YMR071C TVP18
           Tlg2-Vesicle Protein of 18 kDa Integral membrane vesicle
           protein
          Length = 171

 Score =  139 bits (349), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 69/131 (52%), Positives = 94/131 (71%), Gaps = 1/131 (0%)

Query: 1   MALGIANLFHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYRC 60
           +A GIAN+FH +AVI F I+AIVQ LIILF+EVPFLLKICPLS+NFI F+  F+TN  R 
Sbjct: 41  LAFGIANIFHFSAVIVFSIIAIVQGLIILFIEVPFLLKICPLSDNFIGFVSKFDTNLRRA 100

Query: 61  IFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVI-KNPTDDD 119
           +FY +M  +QWCS+ +  TSLIVVA+ L+I+A  YA+     QEF+++  +  +      
Sbjct: 101 LFYLVMCAIQWCSIIVQSTSLIVVAVGLSITATVYALGAAAGQEFKNSAILSDRGRVAAS 160

Query: 120 FPHDAVVREML 130
             ++AVVR+ML
Sbjct: 161 VTNEAVVRDML 171

>Kwal_26.8025 s26 complement(615707..615901) [195 bp, 64 aa] {ON}
           YMR071C - Hypothetical ORF [contig 55] FULL
          Length = 64

 Score =  102 bits (253), Expect = 4e-29,   Method: Compositional matrix adjust.
 Identities = 48/65 (73%), Positives = 58/65 (89%), Gaps = 1/65 (1%)

Query: 66  MAIVQWCSLALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDFPHDAV 125
           MA VQWCS+ALMVTSLIVVA+ LTISA  Y++A+FK+Q+FQ  T+VIKNP D+DFPH+AV
Sbjct: 1   MAAVQWCSIALMVTSLIVVAVGLTISAASYSVAFFKHQQFQ-GTSVIKNPADEDFPHEAV 59

Query: 126 VREML 130
           VREML
Sbjct: 60  VREML 64

>KAFR0C06240 Chr3 complement(1242911..1244368) [1458 bp, 485 aa]
           {ON} Anc_5.143 YGR197C
          Length = 485

 Score = 31.6 bits (70), Expect = 0.51,   Method: Compositional matrix adjust.
 Identities = 13/46 (28%), Positives = 27/46 (58%), Gaps = 1/46 (2%)

Query: 74  LALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDD 119
           L  ++ SLI+  +C+++ +I++   Y K  +F H  N++    DD+
Sbjct: 68  LRFLIVSLILACVCISVCSIYWGATY-KTSKFYHKINIVAVIEDDN 112

>TBLA0E03600 Chr5 (903482..906181) [2700 bp, 899 aa] {ON} Anc_2.205
           YNL085W
          Length = 899

 Score = 29.6 bits (65), Expect = 2.1,   Method: Composition-based stats.
 Identities = 26/84 (30%), Positives = 40/84 (47%), Gaps = 14/84 (16%)

Query: 48  NFIKNFETNGYRCIFYTLMAIVQWCSLALMVTSLIVVAI-----CLTISAI--FYAIAYF 100
           + IK F  NG   I Y +   V WC LA ++ +  + AI     CL + +   F     F
Sbjct: 185 DLIKYFIENG---IIYQVAPFVSWCQLAYLLRNEYIDAIYGPTDCLMLKSTTKFILGMEF 241

Query: 101 KNQEFQ--HTTNVIK--NPTDDDF 120
            N+EF+    + ++K  N T D+F
Sbjct: 242 PNKEFRFIDKSKILKEFNCTHDEF 265

>YBR275C Chr2 complement(751356..757106) [5751 bp, 1916 aa] {ON}
            RIF1Protein that binds to the Rap1p C-terminus and acts
            synergistically with Rif2p to help control telomere
            length and establish telomeric silencing; deletion
            results in telomere elongation
          Length = 1916

 Score = 29.6 bits (65), Expect = 2.7,   Method: Composition-based stats.
 Identities = 10/29 (34%), Positives = 17/29 (58%)

Query: 102  NQEFQHTTNVIKNPTDDDFPHDAVVREML 130
            NQ F    NV++N +D +     ++RE+L
Sbjct: 1042 NQNFSEIENVLQNASDSELEKSEIIRELL 1070

>TBLA0E00700 Chr5 complement(138121..141945) [3825 bp, 1274 aa] {ON}
           Anc_7.17 YOR363C
          Length = 1274

 Score = 28.5 bits (62), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 22/104 (21%), Positives = 46/104 (44%), Gaps = 11/104 (10%)

Query: 9   FHVNAVIAFGIVAIVQSLIILFVEVPFLLKICPLSENFINFIKNFETNGYR-CIFYTLMA 67
            H   ++A   +++ Q L I +    +  K C +S   +N+ KNF   GY  C   +   
Sbjct: 810 LHFEKLLATKTLSLEQGLSIYYT---YFEKCCKISLKLVNYFKNFFGVGYGICAPLSNYM 866

Query: 68  IVQWCSLALMVTSLIVVAI-------CLTISAIFYAIAYFKNQE 104
           + +   L+LM     ++ I       C++++++  + +   N E
Sbjct: 867 VTKMAQLSLMTVLFSLIGIIMRLELACISLNSMITSHSQNNNTE 910

>TPHA0I02030 Chr9 (453623..454846) [1224 bp, 407 aa] {ON}
          Anc_8.515 YBR162C
          Length = 407

 Score = 28.5 bits (62), Expect = 5.7,   Method: Composition-based stats.
 Identities = 19/52 (36%), Positives = 24/52 (46%), Gaps = 7/52 (13%)

Query: 45 NFINFIKNFETNGYRCIFYTLMAIVQWCSLALMVTSLIVVAICLTISAIFYA 96
          N+IN   N ET       YTL+AI  +CS+     S      CL   AI Y+
Sbjct: 14 NYINLYCNLETRILAMFLYTLIAI--YCSI-----SFFFDIHCLATDAIVYS 58

>KLLA0D13200g Chr4 (1130332..1131984) [1653 bp, 550 aa] {ON} similar
           to uniprot|P38799 Saccharomyces cerevisiae YHR078W
           Hypothetical ORF
          Length = 550

 Score = 27.7 bits (60), Expect = 8.6,   Method: Compositional matrix adjust.
 Identities = 13/51 (25%), Positives = 29/51 (56%)

Query: 78  VTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDFPHDAVVRE 128
           VT + +++   ++S  +YA  YF+++  + T   I N  D  +  ++V+R+
Sbjct: 219 VTVMGILSGLASVSTPYYAYQYFRHRNKRDTKYTIHNNVDLLWSSESVIRD 269

>Suva_7.491 Chr7 complement(849038..850666) [1629 bp, 542 aa] {ON}
           YGR197C (REAL)
          Length = 542

 Score = 27.7 bits (60), Expect = 8.8,   Method: Composition-based stats.
 Identities = 12/56 (21%), Positives = 29/56 (51%), Gaps = 3/56 (5%)

Query: 74  LALMVTSLIVVAICLTISAIFYAIAYFKNQEFQHTTNVIKNPTDDDFPHDAVVREM 129
           L   V + ++  +C+++ +I++  +Y  N+ F    N++      D P ++ V+ M
Sbjct: 109 LKFGVNNFLIACLCISLISIYWGASYGTNRYFFKVKNIV---VLQDVPSNSTVQSM 161

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.333    0.144    0.436 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,886,404
Number of extensions: 450469
Number of successful extensions: 2553
Number of sequences better than 10.0: 40
Number of HSP's gapped: 2578
Number of HSP's successfully gapped: 40
Length of query: 130
Length of database: 53,481,399
Length adjustment: 97
Effective length of query: 33
Effective length of database: 42,358,797
Effective search space: 1397840301
Effective search space used: 1397840301
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 39 (21.6 bits)
S2: 59 (27.3 bits)