Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_348.82.530ON42242218910.0
YHR004C (NEM1)2.530ON44648010371e-138
TPHA0G035002.530ON39237310201e-136
Skud_8.492.530ON44748010121e-134
TDEL0A030502.530ON3554199931e-132
Suva_8.582.530ON45239110011e-132
NCAS0F009302.530ON4224519881e-131
Smik_8.532.530ON4464809751e-128
CAGL0K02959g2.530ON4645079761e-128
KNAG0C058502.530ON4434789591e-126
KAFR0A018302.530ON4424709511e-125
NDAI0H014202.530ON4484869491e-124
SAKL0A09416g2.530ON3854349201e-121
KLTH0D06776g2.530ON4094608851e-115
Kwal_26.80012.530ON4134628791e-114
TBLA0I014602.530ON3933778571e-111
ZYRO0B01958g2.530ON3363478061e-105
Ecym_72572.530ON3524187831e-101
AGL070W2.530ON3433527781e-100
KLLA0E18613g2.530ON3744426863e-86
Smik_12.825.202ON3922352613e-24
SAKL0G12870g5.202ON3992372518e-23
NDAI0D018605.202ON5142212531e-22
TPHA0E030705.202ON4942332493e-22
YLR019W (PSR2)5.202ON3972352446e-22
Skud_12.875.202ON3922332446e-22
TBLA0H019905.202ON6882412433e-21
Suva_10.995.202ON3852402393e-21
NDAI0I021705.202ON3912372393e-21
CAGL0D05610g5.202ON4472112377e-21
ZYRO0B10428g5.202ON4822372361e-20
Kpol_2002.1005.202ON4772152315e-20
KLLA0F15620g5.202ON4142332297e-20
Ecym_71045.202ON4922372307e-20
TDEL0E042705.202ON4532372281e-19
KLTH0B03388g5.202ON4092332261e-19
NCAS0D027405.202ON3982222262e-19
Smik_12.535.202ON4142432262e-19
CAGL0D03234g5.202ON4102372252e-19
YLL010C (PSR1)5.202ON4272432252e-19
Suva_10.655.202ON4152222252e-19
AAL158W5.202ON4782242262e-19
Skud_12.575.202ON4152332225e-19
KNAG0M017405.202ON4812372237e-19
KAFR0J009905.202ON4832142228e-19
Kwal_33.151405.202ON4102222209e-19
TBLA0C060905.202ON4842332211e-18
NCAS0A068005.202ON4732262201e-18
Kpol_478.165.202ON3502222091e-17
TPHA0N006705.202ON4522242103e-17
YPL063W (TIM50)8.527ON4761731623e-11
ZYRO0F09130g8.527ON4891741588e-11
TDEL0B031908.527ON4771731561e-10
Smik_16.1728.527ON4771741542e-10
Suva_16.2498.527ON4801731524e-10
SAKL0H10296g8.527ON4781731524e-10
Kpol_457.58.527ON4891731482e-09
NCAS0C022108.527ON4911741472e-09
Kwal_27.119908.527ON4741731444e-09
Skud_16.2188.527ON4801731444e-09
TBLA0A005408.527ON4852181392e-08
NDAI0E029108.527ON4411741373e-08
KLTH0E12254g8.527ON4761731373e-08
TPHA0I020008.527ON4781731373e-08
CAGL0H05159g8.527ON4851801373e-08
KLLA0E23101g8.527ON4801771356e-08
Ecym_11778.527ON4901741266e-07
KNAG0A020608.527ON4501801195e-06
KAFR0E010208.527ON4481701161e-05
ADR045W8.527ON4761731124e-05
TPHA0I002408.839ON732106850.077
ABL127W8.839ON728103830.13
NCAS0C004208.839ON725107732.0
Kpol_1018.1413.425ON76496722.8
KAFR0B039108.839ON724104713.1
Suva_13.268.844ON112263704.4
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_348.8
         (422 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON} ...   733   0.0  
YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}  ...   404   e-138
TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {O...   397   e-136
Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON} Y...   394   e-134
TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {O...   387   e-132
Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}...   390   e-132
NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.5...   385   e-131
Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON} Y...   380   e-128
CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa] ...   380   e-128
KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON} Anc_2...   374   e-126
KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {O...   370   e-125
NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530    370   e-124
SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {...   358   e-121
KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {...   345   e-115
Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {O...   343   e-114
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...   334   e-111
ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {...   315   e-105
Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar t...   306   e-101
AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic ho...   304   e-100
KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} simi...   268   3e-86
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...   105   3e-24
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...   101   8e-23
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202    102   1e-22
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...   100   3e-22
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    99   6e-22
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    99   6e-22
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...    98   3e-21
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    97   3e-21
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     97   3e-21
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    96   7e-21
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    96   1e-20
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    94   5e-20
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    93   7e-20
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    93   7e-20
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    92   1e-19
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...    92   1e-19
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    92   2e-19
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    92   2e-19
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    91   2e-19
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    91   2e-19
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    91   2e-19
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    92   2e-19
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    90   5e-19
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    91   7e-19
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    90   8e-19
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    89   9e-19
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    90   1e-18
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    89   1e-18
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    85   1e-17
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    86   3e-17
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    67   3e-11
ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {...    65   8e-11
TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.5...    65   1e-10
Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063...    64   2e-10
Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063...    63   4e-10
SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {...    63   4e-10
Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON} ...    62   2e-09
NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527     61   2e-09
Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]...    60   4e-09
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    60   4e-09
TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {O...    58   2e-08
NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {O...    57   3e-08
KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]...    57   3e-08
TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.5...    57   3e-08
CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {...    57   3e-08
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    57   6e-08
Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar t...    53   6e-07
KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.5...    50   5e-06
KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.5...    49   1e-05
ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic ho...    48   4e-05
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...    37   0.077
ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic ho...    37   0.13 
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...    33   2.0  
Kpol_1018.141 s1018 complement(374392..376686) [2295 bp, 764 aa]...    32   2.8  
KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.8...    32   3.1  
Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W ...    32   4.4  

>Kpol_348.8 s348 complement(15969..17237) [1269 bp, 422 aa] {ON}
           complement(15969..17237) [1269 nt, 423 aa]
          Length = 422

 Score =  733 bits (1891), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/422 (87%), Positives = 370/422 (87%)

Query: 1   MNALSYISSNLITPIEEEELPSGSQSEDVQTYTNDVSDTCVSSQTQIISKVEDVLNEDNQ 60
           MNALSYISSNLITPIEEEELPSGSQSEDVQTYTNDVSDTCVSSQTQIISKVEDVLNEDNQ
Sbjct: 1   MNALSYISSNLITPIEEEELPSGSQSEDVQTYTNDVSDTCVSSQTQIISKVEDVLNEDNQ 60

Query: 61  RSTLVLVLLFFPKYLLVKPIFFLWFLITFPITLFEQKNKKLPKSSANLDTMSKSKNLNIL 120
           RSTLVLVLLFFPKYLLVKPIFFLWFLITFPITLFEQKNKKLPKSSANLDTMSKSKNLNIL
Sbjct: 61  RSTLVLVLLFFPKYLLVKPIFFLWFLITFPITLFEQKNKKLPKSSANLDTMSKSKNLNIL 120

Query: 121 VEEDLSGGGEIILQRDTLNGSLLKSRANXXXXXXXXXXXXXXXXVGLISKKIGRFLFPKK 180
           VEEDLSGGGEIILQRDTLNGSLLKSRAN                VGLISKKIGRFLFPKK
Sbjct: 121 VEEDLSGGGEIILQRDTLNGSLLKSRANQQHSHQSRHAKSSSSSVGLISKKIGRFLFPKK 180

Query: 181 LIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKR 240
           LIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKR
Sbjct: 181 LIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKR 240

Query: 241 PYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYI 300
           PYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYI
Sbjct: 241 PYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYI 300

Query: 301 KDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILI 360
           KDLSIVNAIPG                                    QLQNNLLSEVILI
Sbjct: 301 KDLSIVNAIPGSHAASTTSHNNHNNNNNSNTNSNDNNDNNDTNAHTHQLQNNLLSEVILI 360

Query: 361 DNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNILSLKNGERAFNV 420
           DNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNILSLKNGERAFNV
Sbjct: 361 DNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNILSLKNGERAFNV 420

Query: 421 NN 422
           NN
Sbjct: 421 NN 422

>YHR004C Chr8 complement(111754..113094) [1341 bp, 446 aa] {ON}
           NEM1Probable catalytic subunit of Nem1p-Spo7p
           phosphatase holoenzyme; regulates nuclear growth by
           controlling phospholipid biosynthesis, required for
           normal nuclear envelope morphology and sporulation;
           homolog of the human protein Dullard
          Length = 446

 Score =  404 bits (1037), Expect = e-138,   Method: Compositional matrix adjust.
 Identities = 230/480 (47%), Positives = 294/480 (61%), Gaps = 93/480 (19%)

Query: 1   MNALSYISSNLITPIEEEELPS---------GSQSEDVQTYTNDVSDTCVSSQTQIISKV 51
           MNAL Y S++LIT  +++++           G   E    YT+   + CVS   Q     
Sbjct: 1   MNALKYFSNHLITTKKQKKINVEVTKNQDLLGPSKEVSNKYTSHSENDCVSEVDQQYDHS 60

Query: 52  EDVLNEDNQ---------------RSTLV--------LVLLFFPKYLLVKPIFFLWFLIT 88
              L E +Q               RS L+         +LLF P YL++KP+  LWF+ T
Sbjct: 61  SSHLKESDQNQERKNSVPKKPKALRSILIEKIASILWALLLFLPYYLIIKPLMSLWFVFT 120

Query: 89  FPITLFEQKNK--------------KLPKSSANLD-----TMSKSKNLNIL---VEEDLS 126
           FP+++ E++ K              +LP SS+N++     T  K+ NLN +   VE+DL+
Sbjct: 121 FPLSVIERRVKHTDKRNRGSNASENELPVSSSNINDSSEKTNPKNCNLNTIPEAVEDDLN 180

Query: 127 GGGEIILQRDTLNGSLL-----KSRANXXXXXXXXXXXXXXXXVGLISKKIGRFLFPKKL 181
              EIILQRD + GSLL     KSR                      +K++GRFLFPKKL
Sbjct: 181 ASDEIILQRDNVKGSLLRAQSVKSRPRSYSKSELSLSNHSSSNTVFGTKRMGRFLFPKKL 240

Query: 182 IPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKRP 241
           IP+S+L++ +KKKLV+DLDETLIHS SRST +SN++Q HLVEVKF +SGI TLY++HKRP
Sbjct: 241 IPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGLSGIRTLYFIHKRP 300

Query: 242 YCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIK 301
           YCDLFL+KV +WYDLIIFTASMKEYADPVIDWLE+SF  SFSKR+YR+DC+LRDGVGYIK
Sbjct: 301 YCDLFLTKVSKWYDLIIFTASMKEYADPVIDWLESSFPSSFSKRYYRSDCVLRDGVGYIK 360

Query: 302 DLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILID 361
           DLSIV                                         +  ++ L +VI+ID
Sbjct: 361 DLSIVK----------------------------------DSEENGKGSSSSLDDVIIID 386

Query: 362 NSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNILSLKNGERAFNVN 421
           NSPVSYAMNVDNAIQV+GWISDPTD DLLNLLPFLE++R +TDVRNIL+LK+GE+AFN+N
Sbjct: 387 NSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAFNIN 446

>TPHA0G03500 Chr7 complement(746466..747644) [1179 bp, 392 aa] {ON}
           Anc_2.530 YHR004C
          Length = 392

 Score =  397 bits (1020), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 224/373 (60%), Positives = 254/373 (68%), Gaps = 60/373 (16%)

Query: 78  KPIFFLWFLITFPITLFEQKNKKLPKS--SANLDTMSKS--------------------- 114
           KP+ F W+L+TFP+TLFEQ N    +S  S   +++S +                     
Sbjct: 51  KPLLFSWYLLTFPLTLFEQNNSNNGRSRDSQTANSLSDASSIANNNAFYVTKGRKRTEQL 110

Query: 115 KNLNILVEEDLSGGGEIILQRDTLNGSLL------KSRANXXXXXXXXXXXXXXXXVGLI 168
           +NL+ ++E+D+ GG E+ILQRDT+ GSLL      K                    V   
Sbjct: 111 QNLDSVLEDDMKGG-EMILQRDTVKGSLLNASNLYKVPGAAGSGKNNSAVKSMSSSVAFG 169

Query: 169 SKKIGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPI 228
           +KK+GRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRS  NSNNAQAHLVEVKF I
Sbjct: 170 TKKMGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSNSNSNNAQAHLVEVKFQI 229

Query: 229 SGISTLYYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYR 288
           SGISTLYYVHKRPYCDLFLS V +WYDLIIFTASMKEYADPVIDWLE+SF G+FSKR+YR
Sbjct: 230 SGISTLYYVHKRPYCDLFLSNVSKWYDLIIFTASMKEYADPVIDWLESSFVGNFSKRYYR 289

Query: 289 NDCILRDGVGYIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQ 348
           N CILRDGVGYIKDLSI+N                                         
Sbjct: 290 NHCILRDGVGYIKDLSIINDTNDDHGNELVR----------------------------- 320

Query: 349 LQNNLLSEVILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNI 408
             N++L E+ILIDNSPVSYAMNVDNAIQV+GWISDPTDQDLLNLLPFLESLR TTDVRNI
Sbjct: 321 -ANSILHEIILIDNSPVSYAMNVDNAIQVEGWISDPTDQDLLNLLPFLESLRYTTDVRNI 379

Query: 409 LSLKNGERAFNVN 421
           LSLKNGERAF++N
Sbjct: 380 LSLKNGERAFDIN 392

>Skud_8.49 Chr8 complement(93604..94947) [1344 bp, 447 aa] {ON}
           YHR004C (REAL)
          Length = 447

 Score =  394 bits (1012), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 226/480 (47%), Positives = 294/480 (61%), Gaps = 92/480 (19%)

Query: 1   MNALSYISSNLITPIEEEELPSG--SQSEDVQTYTNDVSDTCV-SSQTQIIS------KV 51
           MNAL Y S++LIT  + ++  +   ++S+D+   +N+ S T    ++  II         
Sbjct: 1   MNALKYFSNHLITTKKPKKTINVELTKSQDLVNASNETSKTGARHTENDIIGGNHQHNHS 60

Query: 52  EDVL-----NEDNQRSTLV------------------LVLLFFPKYLLVKPIFFLWFLIT 88
            D L     NEDN +S  +                   +LLF P YL++KP+  LWF+ T
Sbjct: 61  TDNLEGSKQNEDNNQSVYIKPKALRSILRRKIASILWTILLFLPYYLIIKPLMSLWFVFT 120

Query: 89  FPITLFEQ------KNKKLPKSSANLDTMS-------------KSKNLNIL---VEEDLS 126
           FP+++ E+      K  K P +S N+ + S             K+ NLN +   V++DL+
Sbjct: 121 FPLSVIERRVKHTDKRHKEPGNSGNVSSTSSGNGNDSNEKAGSKNGNLNTIPETVDDDLN 180

Query: 127 GGGEIILQRDTLNGSLLKSRA-----NXXXXXXXXXXXXXXXXVGLISKKIGRFLFPKKL 181
              EIILQRD + GSLLK+++                          +K++GRFLFPKKL
Sbjct: 181 ASDEIILQRDNVKGSLLKAQSVKSRSRSYSKSDVSLTNHSNTNTVFGTKRMGRFLFPKKL 240

Query: 182 IPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKRP 241
           IP+SIL++ +KKKLV+DLDETLIHS SRST +SN++Q HLVEVKF ISGI TLY++HKRP
Sbjct: 241 IPKSILNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGISGIPTLYFIHKRP 300

Query: 242 YCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIK 301
           YCD FL+KV RWYDLIIFTASMKEYADPVIDWLE+SF  +FSKR+YR+DC+LRDGVGYIK
Sbjct: 301 YCDFFLTKVSRWYDLIIFTASMKEYADPVIDWLESSFPANFSKRYYRSDCVLRDGVGYIK 360

Query: 302 DLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILID 361
           DLSI+ +                                             L +VI+ID
Sbjct: 361 DLSIIKSSEENGKGSSPSS---------------------------------LDDVIIID 387

Query: 362 NSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNILSLKNGERAFNVN 421
           NSPVSYAMNVDNAIQV+GWISDPTD DLLNLLPFLE++R +TDVRNIL+LK+GE+AFN+N
Sbjct: 388 NSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAFNIN 447

>TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {ON}
           Anc_2.530 YHR004C
          Length = 355

 Score =  387 bits (993), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 204/419 (48%), Positives = 264/419 (63%), Gaps = 67/419 (15%)

Query: 1   MNALSYISSNLITPIEEEELPSGSQSEDVQTYTNDVSDTCVSSQTQIISKVEDVLNEDNQ 60
           MNA+SYIS  L                D    T DV D         + K E ++   ++
Sbjct: 1   MNAVSYISDQL-------------SKRDKNGKTEDVEDKVA------VQKREKIVRRRSK 41

Query: 61  RSTLVL-VLLFFPKYLLVKPIFFLWFLITFPITLFEQKNKKLPKSSANLDTMSKSKNLNI 119
            ++    V+LFFP++L++KP   +W++I+ P+ L E   K   +  +   +    ++++ 
Sbjct: 42  FTSYAWAVILFFPQWLIIKPTQLIWWIISLPLLLIEYGLKSRLQRKSTKRSTGTLQSISE 101

Query: 120 LVEEDLSGGGEIILQRDTLNGSLLKSRANXXXXXXXXXXXXXXXXVGLISKKIGRFLFPK 179
           L E+DL+GG EI LQRD + GSL  ++                  V L +K++GRFLFPK
Sbjct: 102 LEEDDLAGGDEIFLQRDAVKGSLAPAK------YRRSRSGSRSSTVMLGTKRMGRFLFPK 155

Query: 180 KLIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHK 239
           KLIPRS+LH+ ++K+LV+DLDETLIHS SR+T +SN+AQ H+VE++F ISG+STLYYVHK
Sbjct: 156 KLIPRSVLHAEKRKRLVVDLDETLIHSASRTTSHSNSAQGHMVEIRFAISGVSTLYYVHK 215

Query: 240 RPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGY 299
           RP+CDLFLSKV +WYDL++FTASM+EYADPVIDWLE SF G FSKR YRN+CILRDGVGY
Sbjct: 216 RPHCDLFLSKVSKWYDLVVFTASMREYADPVIDWLEGSFSGRFSKRLYRNNCILRDGVGY 275

Query: 300 IKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVIL 359
           IKDLSIV                                               L EVIL
Sbjct: 276 IKDLSIVCG-----------------------------------------PTVTLGEVIL 294

Query: 360 IDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNILSLKNGERAF 418
           +DNSP+SYAMNVDNAIQV+GWISDP+D DLL LLPFLE+LR TTDVR+IL+LKN E+AF
Sbjct: 295 VDNSPISYAMNVDNAIQVEGWISDPSDTDLLTLLPFLEALRYTTDVRDILALKNSEQAF 353

>Suva_8.58 Chr8 complement(108197..109555) [1359 bp, 452 aa] {ON}
           YHR004C (REAL)
          Length = 452

 Score =  390 bits (1001), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 203/391 (51%), Positives = 252/391 (64%), Gaps = 64/391 (16%)

Query: 62  STLVLVLLFFPKYLLVKPIFFLWFLITFPITLFEQKNKKLPK-----------------S 104
           S L  +LLF P YL++KP+  LWF+ TFP+ + E++ K   K                  
Sbjct: 95  SILWAILLFLPYYLIIKPLMSLWFVFTFPLNVIERRVKHTDKRHKESGDSGHEPSTDSSH 154

Query: 105 SANLDTMSKSKNLNI-----LVEEDLSGGGEIILQRDTLNGSLL---------KSRANXX 150
           S + +    +KN N+     +VE+DL+   EIILQRD + GSLL         KS++   
Sbjct: 155 SGDFNEKQDAKNRNLNTIHEIVEDDLNASDEIILQRDNVKGSLLQAADGVHSAKSKSRRY 214

Query: 151 XXXXXXXXXXXXXXVGLISKKIGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRS 210
                             +K++GRFLFPKKLIP+SIL++ +KKKLV+DLDETLIHS SR 
Sbjct: 215 SKSEASLTNHSTANTVFGTKRMGRFLFPKKLIPKSILNTQKKKKLVIDLDETLIHSASRG 274

Query: 211 TPNSNNAQAHLVEVKFPISGISTLYYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPV 270
           T +SN++Q HLVEVKF ISGISTLY++HKRPYCDLFL+K  +WYDLIIFTASMKEYADPV
Sbjct: 275 TTHSNSSQGHLVEVKFGISGISTLYFIHKRPYCDLFLTKASKWYDLIIFTASMKEYADPV 334

Query: 271 IDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXX 330
           IDWLE SF  SFSKR+YR+DC+LRDGVGYIKDLSI+ +                      
Sbjct: 335 IDWLEGSFAASFSKRYYRSDCVLRDGVGYIKDLSILKSSEENGKGSSLSS---------- 384

Query: 331 XXXXXXXXXXXXXXXXXQLQNNLLSEVILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLL 390
                                  L +VI+IDNSPVSYAMNVDNAIQV+GWISDPTD DLL
Sbjct: 385 -----------------------LDDVIIIDNSPVSYAMNVDNAIQVEGWISDPTDTDLL 421

Query: 391 NLLPFLESLRNTTDVRNILSLKNGERAFNVN 421
           NLLPFLE++R +TDVRNIL+LK+GE+AFN+N
Sbjct: 422 NLLPFLEAMRYSTDVRNILALKHGEKAFNMN 452

>NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.530
           YHR004C
          Length = 422

 Score =  385 bits (988), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 226/451 (50%), Positives = 279/451 (61%), Gaps = 65/451 (14%)

Query: 1   MNALSYISSNLITPIEE-----------EELPSGS----QSEDVQTYTND---VSDTCVS 42
           MNALSYISS+L +PI             E+ P+ +    +S    T  ND    +    S
Sbjct: 1   MNALSYISSHLASPIHYLKKKEPTIVPVEQEPTNNNEKIKSHSKATTNNDEDYSTPMADS 60

Query: 43  SQTQIISKVEDVLNEDNQRSTLVLV---LLFFPKYLLVKPIFFLWFLITFPITLFEQ--- 96
           S +  I K   V   D      VL    +LFFPK+L+VKP+ FLWF++TFP+ L E+   
Sbjct: 61  SSSNTIEKSIAVYGSDRALRFSVLFWTFVLFFPKFLIVKPLLFLWFIVTFPLYLLERGMK 120

Query: 97  -----KNKKLPKSSANLDTM-SKSKNLNIL---VEEDLSGGGEIILQRDTLNGSLLKSRA 147
                KNK    S  N + + + S  L ++    E+DL+GG EI LQRDT+ GSLLK+ +
Sbjct: 121 HRTLLKNKLDENSQKNAERVPTTSPELTVIDETTEDDLAGGDEIYLQRDTIKGSLLKATS 180

Query: 148 NXXXXXXXXXXXXXXXXVGLISKKIGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSI 207
                                SK++G+FLFPKKLIPRSI+ + R+KKLVLDLDETLIHS+
Sbjct: 181 AKQLSSSKTVKSISSNNTSFSSKRMGKFLFPKKLIPRSIVQTNRRKKLVLDLDETLIHSM 240

Query: 208 SRSTPNSNNAQAHLVEVKFPISGISTLYYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYA 267
           SR T +SN++Q H+VEVKF +SG+STLYYVHKRPYCD FLSKV +WYDLIIFTASMKEYA
Sbjct: 241 SRGTTHSNSSQGHIVEVKFSVSGVSTLYYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYA 300

Query: 268 DPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLSIVNAIPGXXXXXXXXXXXXXXXX 327
           DPVIDWLE S    FS+R YR DCILRDGVGYIKDLS+++   G                
Sbjct: 301 DPVIDWLEDSLPDKFSQRLYRTDCILRDGVGYIKDLSVISEASGMKNISALPPS------ 354

Query: 328 XXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILIDNSPVSYAMNVDNAIQVQGWISDPTDQ 387
                                     L E+I+IDNSP+SYAMNV+NAIQV+GWISDPTD 
Sbjct: 355 --------------------------LGEIIIIDNSPISYAMNVENAIQVEGWISDPTDN 388

Query: 388 DLLNLLPFLESLRNTTDVRNILSLKNGERAF 418
            LLNLLP LE+LR TTDVRN+L+LKNGE+AF
Sbjct: 389 ALLNLLPLLEALRFTTDVRNVLALKNGEKAF 419

>Smik_8.53 Chr8 complement(90635..91975) [1341 bp, 446 aa] {ON}
           YHR004C (REAL)
          Length = 446

 Score =  380 bits (975), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 223/480 (46%), Positives = 291/480 (60%), Gaps = 93/480 (19%)

Query: 1   MNALSYISSNLIT---PIEEEELPSGSQ------SEDVQTYTNDVSDTCVSSQTQIISKV 51
           MNAL Y S++LIT   P +     + +Q      +ED  TY   + + C     Q     
Sbjct: 1   MNALKYFSNHLITTKKPRKNHVEVTNNQDILDTSNEDSNTYATHIENNCTIEVNQHFDHS 60

Query: 52  EDVLNEDNQR-----------------------STLVLVLLFFPKYLLVKPIFFLWFLIT 88
            D L + NQ                        S L  +LLF P YL++KP+  LW++ T
Sbjct: 61  SDHLKDFNQNEERKLFISAKPKSLRSILKEKIGSILWALLLFLPYYLVIKPLMSLWYVFT 120

Query: 89  FPITLFEQK----NKKLPKSSANLDTM---------------SKSKNLNIL---VEEDLS 126
           FP+++ E++    +K+  +SS N +                 SK+ NLN +   VE+DL+
Sbjct: 121 FPLSVIERRVKHTDKRNKESSDNENGSPTSSSSAGDSSEKINSKNCNLNTISETVEDDLN 180

Query: 127 GGGEIILQRDTLNGSLLKS-----RANXXXXXXXXXXXXXXXXVGLISKKIGRFLFPKKL 181
              EIILQRD + GSLL++     R+                     +K++GRFLFPKKL
Sbjct: 181 ASDEIILQRDNVKGSLLRAQSVKLRSRSYSKSEVSLTNHSSTNTVFGTKRMGRFLFPKKL 240

Query: 182 IPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKRP 241
           IP+S+L++ +KKKLV+DLDETLIHS SRST +SN++Q HLVEVKF ISGI TLY++HKRP
Sbjct: 241 IPKSVLNTQKKKKLVIDLDETLIHSASRSTTHSNSSQGHLVEVKFGISGIRTLYFIHKRP 300

Query: 242 YCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIK 301
           YCDLFL+KV +WY+LIIFTASMKEYADPVIDWLE+SF  SFS+R+YR+DC+LRDGVGYIK
Sbjct: 301 YCDLFLTKVSKWYELIIFTASMKEYADPVIDWLESSFPSSFSRRYYRSDCVLRDGVGYIK 360

Query: 302 DLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILID 361
           DLSI+                                         +  ++ L +VI+ID
Sbjct: 361 DLSII----------------------------------KNSEENEKGSSSSLDDVIIID 386

Query: 362 NSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNILSLKNGERAFNVN 421
           NSPVSYAMNVDNAIQV+GWISDPTD DLLNLLPFLE++R +TDVRNIL+LK+GE+AFN+N
Sbjct: 387 NSPVSYAMNVDNAIQVEGWISDPTDTDLLNLLPFLEAMRYSTDVRNILALKHGEKAFNIN 446

>CAGL0K02959g Chr11 complement(262936..264330) [1395 bp, 464 aa]
           {ON} similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004c
          Length = 464

 Score =  380 bits (976), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 220/507 (43%), Positives = 289/507 (57%), Gaps = 129/507 (25%)

Query: 1   MNALSYISSNLITPIE--------EEELPSGSQSEDVQTYTN---DVSDTCVSSQTQII- 48
           MNALSY+   L+ PI+        +E+L       D + +TN   + +D C++++ QI  
Sbjct: 1   MNALSYVYEYLVLPIDHFKVKKNRKEQLVDSKHVVDNEEHTNQDTEGNDKCLNTKAQIRV 60

Query: 49  --------------------------SKVEDVLN----------EDNQRS---------- 62
                                     SK  +V N          ED ++           
Sbjct: 61  NDDSVLKLRKVNPLIQDKDGAQKDRDSKTRNVSNNKIEIKPVSDEDEEKDIDGQMSRGLK 120

Query: 63  ---TLVLVLLFFPKYLLVKPIFFLWFLITFPITLFEQ---------KNKKLPKSSANLDT 110
               +  ++ FFP Y+L+KP  F+WF++TFP++L E          +N+ L +S A    
Sbjct: 121 FFIVVWSIITFFPNYILIKPTLFVWFILTFPLSLIEHSVRRRGKATENEHLSQSPATNKD 180

Query: 111 MSKSKNLNIL---VEEDLSGGGEIILQRDTLNGSLLKSRANXXXXXXXXXXXXXXXXVG- 166
            S SK LN++   +E+DL  G  + LQ+D L GSLL +  +                   
Sbjct: 181 NSPSKRLNVIEEAIEDDLISGEVMELQKDALKGSLLPTNKDSSQNSSQKDRGKKTTSTPS 240

Query: 167 -----LISKKIGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHL 221
                L +K +GRF FPKKLIPRSIL+S +KK LV+DLDETLIHS+SR T +SN++QAH+
Sbjct: 241 HTSNILGTKSMGRFQFPKKLIPRSILYSEKKKTLVIDLDETLIHSVSRGTTHSNSSQAHI 300

Query: 222 VEVKFPISGISTLYYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGS 281
           +EV+F ISG+STLYYVHKRPYCDLFLSKVC+WY+LIIFTASMKEYADPVIDWLE+SF GS
Sbjct: 301 IEVRFAISGVSTLYYVHKRPYCDLFLSKVCKWYNLIIFTASMKEYADPVIDWLESSFSGS 360

Query: 282 FSKRFYRNDCILRDGVGYIKDLSIVN-------AIPGXXXXXXXXXXXXXXXXXXXXXXX 334
           F++R YRN CI RDGVGYIKDL  +         IP                        
Sbjct: 361 FTQRMYRNHCIARDGVGYIKDLGNIKDPYSKNATIP------------------------ 396

Query: 335 XXXXXXXXXXXXXQLQNNLLSEVILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLP 394
                              L++V++IDNSPVSYAM+VDNAIQV+GWISDPTD +LLNLLP
Sbjct: 397 -------------------LTDVVIIDNSPVSYAMHVDNAIQVEGWISDPTDTELLNLLP 437

Query: 395 FLESLRNTTDVRNILSLKNGERAFNVN 421
           FLE+LR TTDVRN+L+LKN E+AF ++
Sbjct: 438 FLEALRYTTDVRNVLALKNSEKAFQLS 464

>KNAG0C05850 Chr3 (1138155..1139486) [1332 bp, 443 aa] {ON}
           Anc_2.530 YHR004C
          Length = 443

 Score =  374 bits (959), Expect = e-126,   Method: Compositional matrix adjust.
 Identities = 226/478 (47%), Positives = 282/478 (58%), Gaps = 92/478 (19%)

Query: 1   MNALSYISSNLITPIE------EEELPSGSQSED--VQTYTNDV---------------- 36
           MN +SYI+ +LI P+         E+ SG    D  V    NDV                
Sbjct: 1   MNTISYITQHLIYPLRPRAKSLHNEVKSGEGKVDDGVGVTENDVADGKLKTTANVEKQEN 60

Query: 37  ------------SDTCVSSQTQIISKVEDVLNED--NQR--STLVLVLLFFPKYLLVKPI 80
                       SD   +S+  I+    D+LNE+  +Q+  + LV V+ F P YL+ KP+
Sbjct: 61  STLKEELLDRQGSDAEKASKPIIVINDGDILNENILHQKVWNVLVFVIFFLPTYLIYKPL 120

Query: 81  FFLWFLITFPITLFEQ--KNKKLPK------SSANLDTMSKSKNLNILVEEDLSGGGEII 132
             LWFL+T P+ L E+  K +  PK      S   L   SK  ++N  VEEDL+ G E  
Sbjct: 121 LLLWFLVTLPLALVERGIKLRNRPKMKTEKVSELVLSDPSKLGSINEEVEEDLAAGDEFY 180

Query: 133 LQRDTLNGSLLKSRANXXXXXXXXXXXXXXXXVG---------LISKKIGRFLFPKKLIP 183
           LQRD + GSLLK+  N                 G           +KK+GRFLFPKKLIP
Sbjct: 181 LQRDIVKGSLLKATTNKHHTPLKSKKNSAQNQHGNETHPNSTVFGTKKMGRFLFPKKLIP 240

Query: 184 RSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKRPYC 243
           +SIL+  +KK LV+DLDETLIHS+SR T + N++Q H+VEVKF ISG+STLYYV KRPYC
Sbjct: 241 KSILNREKKKTLVMDLDETLIHSVSRGTTHPNSSQGHIVEVKFSISGVSTLYYVFKRPYC 300

Query: 244 DLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDL 303
           DLFL+KV +WYD++IFTASMKEYADPVIDWLE+SF G FS+R YRNDCILRDGVGYIKDL
Sbjct: 301 DLFLTKVSKWYDIVIFTASMKEYADPVIDWLESSFAGKFSRRLYRNDCILRDGVGYIKDL 360

Query: 304 SIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILIDNS 363
            +V                                             + L +VI++DNS
Sbjct: 361 KMV-----------------------------------TRGSNLGTSPDRLEDVIIVDNS 385

Query: 364 PVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNILSLKNGERAFNVN 421
           PVSYA+NVDNAIQV+GWI+DPTD DLLNL+P LE+L NTTDVRNILSLKNGE+AFN++
Sbjct: 386 PVSYALNVDNAIQVEGWINDPTDTDLLNLIPLLEALENTTDVRNILSLKNGEKAFNID 443

>KAFR0A01830 Chr1 complement(376645..377973) [1329 bp, 442 aa] {ON}
           Anc_2.530 YHR004C
          Length = 442

 Score =  370 bits (951), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 214/470 (45%), Positives = 283/470 (60%), Gaps = 83/470 (17%)

Query: 1   MNALSYISSNLITP---------IEEEELPSG-SQSEDVQTYTNDVSDTCV---SSQTQI 47
           MNALSYI++++  P         ++   +P      +D  + +ND   T     +S  + 
Sbjct: 1   MNALSYITNHVQLPFSKLRDNNKVKANIVPENIVGKKDWSSISNDQKGTITRENASPEKG 60

Query: 48  ISKVEDVLNED-------------------------NQRSTLVLVLLFFPKYLLVKPIFF 82
           +S V+D  N++                         N  S L  ++LF P+YL + P+ +
Sbjct: 61  LSSVKDAHNQNVEGAIHIKQQIPRKRITILSVFEKFNLFSLLANIILFVPRYLFLNPLIY 120

Query: 83  LWFLITFPITLFE--------QKNKKLPKSSANLDTMSKSKNLNILVEEDLSGGGEIILQ 134
           +WF++T P+TL E        +K  +L  +      +S  ++++ + EEDLS   E  LQ
Sbjct: 121 VWFILTLPLTLVERGIKLRDRKKKAELRGNFGESSELSPLRSISEVGEEDLSTSDEFFLQ 180

Query: 135 RDTLNGSLLKSRANXXXXXXXXXXXXXXXXVGL-----ISKKIGRFLFPKKLIPRSILHS 189
           RDT+ GSLL++ ++                  +      +KK+GRFLFPKKLIPRSIL +
Sbjct: 181 RDTIKGSLLRASSDKPPVFQRYKSTIKQDHEAMNTNIFGTKKMGRFLFPKKLIPRSILCN 240

Query: 190 GRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKRPYCDLFLSK 249
            RKK LV+DLDETLIHS+SR T + N++Q HLVEVKF I+GISTLYYVHKRP+CDLFLSK
Sbjct: 241 ERKKTLVVDLDETLIHSVSRGTTHVNSSQGHLVEVKFSINGISTLYYVHKRPFCDLFLSK 300

Query: 250 VCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLSI-VNA 308
           V +WY+++IFTASMKEYADPVIDWLE SF+G+F+KR YR++C+LRDGVGYIKDLS+ VNA
Sbjct: 301 VSKWYNIVIFTASMKEYADPVIDWLEGSFQGNFAKRLYRHNCLLRDGVGYIKDLSVLVNA 360

Query: 309 IPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILIDNSPVSYA 368
                                                   L    L EVI+IDNSPVSYA
Sbjct: 361 -------------------------------NHAQDNKTFLPVEGLHEVIIIDNSPVSYA 389

Query: 369 MNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNILSLKNGERAF 418
           +NVDNAIQV+GWISDPTD DLLNLLP LE+LR TTDVRN+L+LKNGE+ F
Sbjct: 390 LNVDNAIQVEGWISDPTDTDLLNLLPILEALRYTTDVRNVLALKNGEKMF 439

>NDAI0H01420 Chr8 (348020..349366) [1347 bp, 448 aa] {ON} Anc_2.530
          Length = 448

 Score =  370 bits (949), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 219/486 (45%), Positives = 283/486 (58%), Gaps = 104/486 (21%)

Query: 1   MNALSYISSNLITPIE--------------EEELPSGSQSED--VQTYTNDVSDTCVSSQ 44
           MNALSY+S +L+ P++              E+++ +G+ +E    Q Y + +     + +
Sbjct: 1   MNALSYVSDSLVLPLQLFKKKDKKDARNVIEKKVAAGAATEINLEQPYVDRIGKQVGTKK 60

Query: 45  TQ-----------------IISK--------VEDVLNEDNQRSTLVLVLLFFPKYLLVKP 79
            +                 I+ +         +D   ++N  S L   LLFFPK L++KP
Sbjct: 61  AEESLKKPTPGLEFTDNNFIVEEEGHSSLNVTDDRKTKNNVTSILWSFLLFFPKILIIKP 120

Query: 80  IFFLWFLITFPITL-----------FEQKNKKLPKSSANL--------DTMSKSKNLNIL 120
           I FLW+++TFP++L           F Q     P+    L        +  SK   +N L
Sbjct: 121 ILFLWYILTFPLSLIERGTKYRMRPFSQSKDSSPEKDETLVHNNSFLPEEPSKLDAINEL 180

Query: 121 VEEDLSGGGEIILQRDTLNGSLLKSRANXXXXXXXXXXXXXXXXVGLISKKIGRFLFPKK 180
            E+DL  G  I LQRD + GSLLK+ +                     SK++G+FLFPKK
Sbjct: 181 TEDDLVSGDGIYLQRDNVKGSLLKASSVRQPSLSRSMKTMVSNNTSFSSKRMGKFLFPKK 240

Query: 181 LIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKR 240
           LIP+SI  + R+KKLVLDLDETLIHSISR T ++N +Q H+VEVKF  SG+S LYYVHKR
Sbjct: 241 LIPKSITQTERRKKLVLDLDETLIHSISRGTTHTNVSQGHIVEVKFSSSGVSMLYYVHKR 300

Query: 241 PYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYI 300
           PYCD FLSKVC+WYDLIIFTASMKEYADPVIDWLE SF+G+F++R+YR DCI RDGVGYI
Sbjct: 301 PYCDFFLSKVCKWYDLIIFTASMKEYADPVIDWLEASFQGTFTERYYRTDCIRRDGVGYI 360

Query: 301 KDLSIVN-----AIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLS 355
           KDL+I+      ++P                                       Q + LS
Sbjct: 361 KDLTIIKDDSNVSVP---------------------------------------QTSTLS 381

Query: 356 EVILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNILSLKNGE 415
           EVI++DNSP+SYAMN DNAIQV+GWISDPTD  LLNLLP LE+LR TTDVR+IL+LKNGE
Sbjct: 382 EVIILDNSPISYAMNADNAIQVEGWISDPTDTALLNLLPLLEALRYTTDVRSILALKNGE 441

Query: 416 RAFNVN 421
           RAF  N
Sbjct: 442 RAFYAN 447

>SAKL0A09416g Chr1 complement(820552..821709) [1158 bp, 385 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 385

 Score =  358 bits (920), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 203/434 (46%), Positives = 273/434 (62%), Gaps = 63/434 (14%)

Query: 1   MNALSYISSNLITPIEEEELPSGSQSEDVQTYTNDVSDTCVSSQTQIISKVEDVLNEDNQ 60
           MNA+SYI++++  P  +E         D Q +        VS   Q   + ++  N+  +
Sbjct: 1   MNAISYITNHVTPPKFDEANSIKKDQADAQAHG------TVSKSEQNAPEDDEDKNQTKK 54

Query: 61  RSTLVL---VLLFFPKYLLVKPIFFLWFLITFPITLFEQ-----KNKKLPKSSANLDTMS 112
            + L L   ++LF P + ++KP+ F W++ITFP+ L E      ++++  +   +     
Sbjct: 55  ATKLSLLWSIILFLPNFFIIKPVLFFWYIITFPLNLIEHSPADDEDERNGEEGNSTGDEE 114

Query: 113 KSKNLNILVEEDLS--GGGEIILQRDTLNGSLL----KSRANXXXXXXXXXXXXXXXXVG 166
           K+ ++NI+VEED     G EIILQ D + GSL       +                    
Sbjct: 115 KTPSINIIVEEDEEDLAGDEIILQTDAVKGSLSTISESQQVKTIKASTRSSIRSGSTGTA 174

Query: 167 LISKKIGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKF 226
           L S+++GRFLFPKKLIP+S+L++ +KK LVLDLDETLIHS+SR T +SN++Q H+VEVKF
Sbjct: 175 LGSRRMGRFLFPKKLIPQSVLNNEKKKILVLDLDETLIHSMSRGTSSSNSSQGHMVEVKF 234

Query: 227 PISGISTLYYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRF 286
            +SGIS+LY+VHKRPYCDLFLSKV +WY L++FTASMKEYADPVIDWLE+SF GSFS+R 
Sbjct: 235 AVSGISSLYFVHKRPYCDLFLSKVAKWYTLVVFTASMKEYADPVIDWLESSFSGSFSQRL 294

Query: 287 YRNDCILRDGVGYIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 346
           YR DCILRDGVGYIKDLS+++                                       
Sbjct: 295 YRQDCILRDGVGYIKDLSLIS--------------------------------------- 315

Query: 347 XQLQNNLLSEVILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVR 406
                  L+E+I++DNSP+SYAMNVDNAIQV+GWISDPTD DLLNLLP LE+LR TTD+R
Sbjct: 316 ----KKSLNEIIIVDNSPISYAMNVDNAIQVEGWISDPTDTDLLNLLPLLEALRFTTDIR 371

Query: 407 NILSLKNGERAFNV 420
           N+LSLK+GE+AFN+
Sbjct: 372 NVLSLKSGEQAFNI 385

>KLTH0D06776g Chr4 complement(591149..592378) [1230 bp, 409 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 409

 Score =  345 bits (885), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 205/460 (44%), Positives = 272/460 (59%), Gaps = 94/460 (20%)

Query: 1   MNALSYISSNLITPIEEEELPSGSQSEDVQTYTNDVSDTCVSSQTQIISKVEDVLNEDNQ 60
           MNA+SY+++N++ P  EE   +  + ED +            +  +I    ++       
Sbjct: 1   MNAISYLTNNILPPKHEESTATPHRVEDSE-----------KANARIDVAPKEAQKRKRA 49

Query: 61  RSTLVLVLL-FFPKYLLVKPIFFLWFLITFPITLFEQ----KNKKL--------PKSSAN 107
           R TL+  +L F P  ++VKP+ F+WF+ITFP++L E+    +N+ +         KS A+
Sbjct: 50  RWTLLWSMLAFLPNLIVVKPVLFVWFVITFPLSLIERASSSENQGMGFDNAEGDSKSEAS 109

Query: 108 LDTMS---KSKNLNILVEEDLSGGGEIILQRDTLNGSL---------------------- 142
             T+S    S+   I  EED   G E+ILQ DT+ GSL                      
Sbjct: 110 AGTISPKNSSRISTITEEEDDLAGEEMILQADTVKGSLTVTSGAKERPQDKGRRQPLQPQ 169

Query: 143 ---LKSRANXXXXXXXXXXXXXXXXVGLISKKIGRFLFPKKLIPRSILHSGRKKKLVLDL 199
               K+                     L S+++GRFLFPKKLIP+S+L+  +++ LVLDL
Sbjct: 170 QQQPKTSRQSLKTSSVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKRRTLVLDL 229

Query: 200 DETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKRPYCDLFLSKVCRWYDLIIF 259
           DETLIHS+SR T +SN++Q H+VEVKF  SGISTLY+VHKRPYCDLFL+K+ +WY+L++F
Sbjct: 230 DETLIHSMSRGTSSSNSSQGHMVEVKFATSGISTLYHVHKRPYCDLFLTKIAKWYELVVF 289

Query: 260 TASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLSIVNAIPGXXXXXXXX 319
           TASMKEYADPVIDWLE+SF G FS+R YR DCILRDGVGYIKDLS+V             
Sbjct: 290 TASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSVV------------- 336

Query: 320 XXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILIDNSPVSYAMNVDNAIQVQG 379
                                        + N  LS++ +IDNSPVSYAM+VDNAIQV+G
Sbjct: 337 -----------------------------VPNASLSDIFIIDNSPVSYAMHVDNAIQVEG 367

Query: 380 WISDPTDQDLLNLLPFLESLRNTTDVRNILSLKNGERAFN 419
           WISDPTD DLLNLLP LE+LR TTD+RN+L+LK+GE AF 
Sbjct: 368 WISDPTDTDLLNLLPLLEALRFTTDIRNVLALKSGEHAFT 407

>Kwal_26.8001 s26 complement(607534..608775) [1242 bp, 413 aa] {ON}
           YHR004C (NEM1) - Nuclear Envelope Morphology [contig 55]
           FULL
          Length = 413

 Score =  343 bits (879), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 212/462 (45%), Positives = 273/462 (59%), Gaps = 92/462 (19%)

Query: 1   MNALSYISSNLITPIEEEELPSGSQSEDVQTYTNDVSDTCVSSQTQIISKVEDVLNEDNQ 60
           MNA+SY+++N +TP  + E PS S  E+++  + DV+ +      Q+  KV+        
Sbjct: 1   MNAISYLTNNALTP--KPEGPS-SSPENIEG-SADVNVSGNGKNPQL--KVKKTRKSRGI 54

Query: 61  R-STLVLVLLFFPKYLLVKPIFFLWFLITFPITLFEQKNKKLPKSSANL----------- 108
           R + L  +L+F P  L+VKPI F+WF+ITFP++L E+ +   P+S+              
Sbjct: 55  RWAFLWSILVFLPNLLVVKPILFVWFVITFPLSLIERSST--PESAGGTESSLQRTGNLY 112

Query: 109 ---------DTMSKSKNLNILVEEDLS-GGGEIILQRDTLNGSLL--------------- 143
                    D++     +N + EED   GG EI LQ DT+ GSL                
Sbjct: 113 SDEQVSTTSDSVGSKPRINTIQEEDDDLGGDEIFLQPDTVKGSLTATNCVPPEHSQDLSR 172

Query: 144 -----KSRANXXXXXXXXXXXXXXXXVGLISKKIGRFLFPKKLIPRSILHSGRKKKLVLD 198
                K                      L S+++GRFLFPKKLIP+S+L+  + + LVLD
Sbjct: 173 RQQHSKGSRQSPKAASVRSGASSSAGTALGSRRMGRFLFPKKLIPQSVLNRRKPRTLVLD 232

Query: 199 LDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKRPYCDLFLSKVCRWYDLII 258
           LDETLIHS+SR T +SN++Q H+VEVKF ISGISTLY+VHKRPYCDLFL+ +  WY+L++
Sbjct: 233 LDETLIHSMSRGTSSSNSSQGHMVEVKFAISGISTLYHVHKRPYCDLFLTTIANWYELVV 292

Query: 259 FTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLSIVNAIPGXXXXXXX 318
           FTASMKEYADPVIDWLE+SF G FS+R YR DCILRDGVGYIKDLS V            
Sbjct: 293 FTASMKEYADPVIDWLESSFPGKFSRRLYRQDCILRDGVGYIKDLSAVAP---------- 342

Query: 319 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILIDNSPVSYAMNVDNAIQVQ 378
                                           N LLS++ +IDNSPVSYAM+VDNAIQV+
Sbjct: 343 --------------------------------NTLLSDIFIIDNSPVSYAMHVDNAIQVE 370

Query: 379 GWISDPTDQDLLNLLPFLESLRNTTDVRNILSLKNGERAFNV 420
           GWISDPTD DLLNLLP LE+LR TTDVRNIL+LK+GE AF+ 
Sbjct: 371 GWISDPTDTDLLNLLPLLEALRFTTDVRNILALKSGEHAFSA 412

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score =  334 bits (857), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 185/377 (49%), Positives = 229/377 (60%), Gaps = 74/377 (19%)

Query: 75  LLVKPIFFLWFLITFPITLFEQK-NKKLPKSSANLDTMSKSKNLNILVEEDLSGGGEIIL 133
           +L+KP+ FLW++ TFP+ L EQ  N+K   +   +D    S +   L  +DL+   EIIL
Sbjct: 57  ILIKPLIFLWYIFTFPLLLIEQHTNRKYKDTPPLIDPKIASSSATDL--DDLNSNDEIIL 114

Query: 134 QRDTLNGSLLKSRANXXXXXXXXXXXXXXXXVGLI-------------------SKKIGR 174
           Q D++ GSLL+ +                    +I                   SK +GR
Sbjct: 115 QTDSIKGSLLEKKNTSAAATPSATPPATSPSPLVIKQKKIQNKSVYSLTSNFIGSKNMGR 174

Query: 175 FLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISG---- 230
           FLFPKKLIP SIL + ++KKL+LDLDETLIHS+SR+  +S  +  HL+EVKFP       
Sbjct: 175 FLFPKKLIPNSILKTNKRKKLILDLDETLIHSMSRNISSSTISNYHLIEVKFPTPTSAPT 234

Query: 231 --------ISTLYYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSF 282
                   +S+LYYV+KRPYCD FL+ V  WYDLIIFTASMKEYADPVIDWLE SF G+F
Sbjct: 235 SAPGPSLPLSSLYYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPVIDWLEDSFNGNF 294

Query: 283 SKRFYRNDCILRDGVGYIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 342
            KR YRN CILRDG+GYIKDLS++N                                   
Sbjct: 295 QKRLYRNHCILRDGIGYIKDLSVLNTD--------------------------------- 321

Query: 343 XXXXXQLQNNLLSEVILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNT 402
                    + L+E+ILIDNSP+S+AMNVDNAIQVQGWISDPTD +LL LLPFLESLR+T
Sbjct: 322 -------NQSTLNELILIDNSPISFAMNVDNAIQVQGWISDPTDTELLTLLPFLESLRHT 374

Query: 403 TDVRNILSLKNGERAFN 419
           TDVRNIL+LKNGERAF+
Sbjct: 375 TDVRNILALKNGERAFH 391

>ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 336

 Score =  315 bits (806), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 177/347 (51%), Positives = 224/347 (64%), Gaps = 71/347 (20%)

Query: 75  LLVKPIFFLWFLITFPITLFEQ--KNKKLPKSSANLDTMSKSKNLNILVEEDLSGGGEII 132
           + +KP   +WF+IT P+ L E   K+K+  +S++    + + K ++  + ED     E+ 
Sbjct: 59  IFLKPFHLIWFVITSPLILIEYGLKSKQKVESTSRKGEIIRKKEVDDDLAED-----EMF 113

Query: 133 LQRDTLNGSLLKSRANXXXXXXXXXXXXXXXXVGLISKKIGRFLFPKKLIPRSILHSGRK 192
           LQRDT+ G L + +A                     +KK+GRFLFPKKL+P+SIL + RK
Sbjct: 114 LQRDTVKGGL-RGKA-------------------FGTKKMGRFLFPKKLVPQSILFAERK 153

Query: 193 KKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKRPYCDLFLSKVCR 252
           K+LV+DLDETLIHS +RS  +SN+AQ H+VEV+FP S ISTLYYVHKRP+CDLFLSKV +
Sbjct: 154 KRLVVDLDETLIHSATRSVSHSNSAQGHMVEVRFPPSSISTLYYVHKRPHCDLFLSKVSK 213

Query: 253 WYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLSIVNAIPGX 312
           WYDLIIFTASMKEYADPVIDWLE+SF G F KR YR++C++R+GVGYIKDLS+V  +   
Sbjct: 214 WYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLYRHNCVVREGVGYIKDLSVVTEV--- 270

Query: 313 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILIDNSPVSYAMNVD 372
                                                    L EV+LIDNSP SYA N D
Sbjct: 271 -----------------------------------------LDEVVLIDNSPTSYARNED 289

Query: 373 NAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNILSLKNGERAFN 419
           NAIQV+GWISDP+D DLLNLLP LE+LR  TDVR+IL LKNGE+A  
Sbjct: 290 NAIQVEGWISDPSDTDLLNLLPLLEALRYVTDVRSILGLKNGEKALG 336

>Ecym_7257 Chr7 (542416..543474) [1059 bp, 352 aa] {ON} similar to
           Ashbya gossypii AGL070W
          Length = 352

 Score =  306 bits (783), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 188/418 (44%), Positives = 253/418 (60%), Gaps = 67/418 (16%)

Query: 1   MNALSYISSNLITPIEEEELPSGSQSEDVQTYTNDVSDTCVSSQTQIISKVEDVLNEDNQ 60
           MN+LSY++ +          P+ S  E+++   ++ S   V+ + ++ +      ++  +
Sbjct: 1   MNSLSYLTGS--------SQPTSSSKEELRFPFSESSLPNVTEEQEVENGEVSQDSKGGR 52

Query: 61  RSTLVLVLLFFPKYLLVKPIFFLWFLITFPITLFEQKNKKLPKSSANLDTMSKSKNLNIL 120
            S +  V+ F P +L++KPI+ +WF++TFP+ L E  + K           S  +   I 
Sbjct: 53  PSWVWRVVFFLPTWLIIKPIWLIWFVLTFPLNLIEHTSSK---------DGSVEEEEVIP 103

Query: 121 VEEDLSGGGEIILQRDTLNGSLLKSRANXXXXXXXXXXXXXXXXVGLISKKIGRFLFPKK 180
                SGGGE+I   D +  S++    +                    S ++G+FLFPKK
Sbjct: 104 TNSQGSGGGEVIEDDDLVGESMVLHEDSIKSSRPSTSRSSYT------STRLGKFLFPKK 157

Query: 181 LIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKR 240
           LIP+SIL + RKK LVLDLDETLIHS+SRST +SN +Q H+VEV F +SG+S+LYYVHKR
Sbjct: 158 LIPQSILQTDRKKVLVLDLDETLIHSMSRSTSSSNTSQGHMVEVTFSVSGVSSLYYVHKR 217

Query: 241 PYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYI 300
           PYCDLFLS+VC+WYDL+IFTASM+EYADPVIDWLE+     F+KR YR+DCILRDG+GY+
Sbjct: 218 PYCDLFLSRVCKWYDLVIFTASMREYADPVIDWLESGISARFTKRKYRSDCILRDGIGYV 277

Query: 301 KDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILI 360
           KDL++++                                          +N  L + I++
Sbjct: 278 KDLTMIS------------------------------------------KN--LQDTIIV 293

Query: 361 DNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNILSLKNGERAF 418
           DNSPVSYAMNVDNAIQV+GWISDPTD  LLNLLP LE LR TTD RNILSLKNGE AF
Sbjct: 294 DNSPVSYAMNVDNAIQVEGWISDPTDTGLLNLLPLLEGLRFTTDTRNILSLKNGEHAF 351

>AGL070W Chr7 (577092..578123) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR004C (NEM1)
          Length = 343

 Score =  304 bits (778), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 179/352 (50%), Positives = 230/352 (65%), Gaps = 62/352 (17%)

Query: 67  VLLFFPKYLLVKPIFFLWFLITFPITLFEQKNKKLPKSSANLDTMSKSKNLNILVEEDLS 126
           VL F PK+L+VKP+  +WF++TFP++L EQ + K    +   +   + +    + ++DL+
Sbjct: 53  VLFFLPKWLVVKPVVLVWFVLTFPLSLIEQTSSKEADGAPGPEAAEEEQLAEAVEDDDLA 112

Query: 127 GGGEIILQRDTLNGSLLKSRANXXXXXXXXXXXXXXXXVGLISKKIGRFLFPKKLIPRSI 186
           G   ++LQ D++  S   +  +                    S ++G+FLFPKKLIP+SI
Sbjct: 113 GE-SMVLQEDSVKSSRPSTSRSSYT-----------------STRLGKFLFPKKLIPQSI 154

Query: 187 LHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKRPYCDLF 246
           L + RKK LVLDLDETLIHS+SRST + +N+Q H+VEV F  SG+STLYYVHKRPYCDLF
Sbjct: 155 LQTDRKKLLVLDLDETLIHSMSRSTSSVSNSQGHMVEVTFAASGVSTLYYVHKRPYCDLF 214

Query: 247 LSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLSIV 306
           LS+V +WYDL+IFTASMKEYADPVIDWLE+     FS+R YR+DC+LRDGVGY+KDLSI+
Sbjct: 215 LSRVSKWYDLVIFTASMKEYADPVIDWLESGISVRFSQRRYRSDCLLRDGVGYVKDLSII 274

Query: 307 NAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILIDNSPVS 366
           +                                          +N  L ++I++DNSP+S
Sbjct: 275 S------------------------------------------KN--LQDIIIVDNSPIS 290

Query: 367 YAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNILSLKNGERAF 418
           YAMNVDNAIQV+GWISDPTD  LLNLLP LE LR TTD RNILSLKNGERAF
Sbjct: 291 YAMNVDNAIQVEGWISDPTDTGLLNLLPLLEGLRFTTDTRNILSLKNGERAF 342

>KLLA0E18613g Chr5 (1652892..1654016) [1125 bp, 374 aa] {ON} similar
           to uniprot|Q750M6 Ashbya gossypii AGL070W AGL070Wp and
           weakly similar to YHR004C uniprot|P38757 Saccharomyces
           cerevisiae YHR004C NEM1 Protein of the nuclear envelope
           required for the spherical shape of the nucleus required
           for normal sporulation
          Length = 374

 Score =  268 bits (686), Expect = 3e-86,   Method: Compositional matrix adjust.
 Identities = 176/442 (39%), Positives = 248/442 (56%), Gaps = 92/442 (20%)

Query: 1   MNALSYISSNLITP----IEEEE------LPSGSQSEDVQTYTNDVSDTCVSSQTQIISK 50
           MNA+S++S+ L  P    I+E+E       P+ +Q   V+   N  +    ++ T   S 
Sbjct: 1   MNAISFLSNALPAPQEVPIKEKEGILVDPTPTNTQPNKVK---NKTTTASTTTSTTTTST 57

Query: 51  VEDVLNEDNQRSTLVLVLLFFPKYLLVKPIFFLWFLITFPITLFE---QKNKKLPKSSAN 107
             +  N    R  +  +L+F P YLL+KPI  +W++ITFP+ L E   Q NK L +  + 
Sbjct: 58  ATNKRNRPFMR-WIWCILIFLPNYLLIKPIITIWYVITFPLNLMETNTQGNKGLIQVGSE 116

Query: 108 LDTMSKSKNLNILVEEDLSGGGEIILQRDTLNGSLLKSRANXXXXXXXXXXXXXXXXVGL 167
            D+ ++ K    +VEEDLS   EII+ +D +     K R                     
Sbjct: 117 TDSRTE-KLSKYVVEEDLSPTDEIIINQDKM-----KPRP-------------------- 150

Query: 168 ISKKIGRFLFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRS---------TPNSNNAQ 218
           I++ +G+F FPKKL+P+S+L S  +K LVLDLDETLIHS+S S          P+     
Sbjct: 151 ITEYLGKFHFPKKLVPQSMLLSTSRKLLVLDLDETLIHSMSNSRSLGNPTDKNPSGTTPM 210

Query: 219 AHLVEVKFPISGISTLYYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSF 278
            HLVEV+FP + ISTLY V KRPYCD+FL +  +WYD+ IFTASMKEYADPVIDWL+ + 
Sbjct: 211 IHLVEVRFPQTNISTLYNVAKRPYCDMFLQQTSQWYDIAIFTASMKEYADPVIDWLQQTC 270

Query: 279 RGSFSKRFYRNDCILRDGVGYIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXX 338
              F  R+YR DC LR GVGY+KD+  V                                
Sbjct: 271 SVQFHYRWYREDCTLRPGVGYVKDIGTV-------------------------------- 298

Query: 339 XXXXXXXXXQLQNNL-LSEVILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLE 397
                    Q++ +  LS++I+IDNSP+SYAM++DNAIQV GWI+DP+D +LL+LLP L+
Sbjct: 299 -------ATQIETSRDLSQMIIIDNSPISYAMHLDNAIQVHGWINDPSDSELLHLLPLLK 351

Query: 398 SLRNTTDVRNILSLKNGERAFN 419
           ++R+ TD R IL+LK+G  + +
Sbjct: 352 AMRHVTDSRCILALKSGRASIS 373

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score =  105 bits (261), Expect = 3e-24,   Method: Compositional matrix adjust.
 Identities = 72/235 (30%), Positives = 113/235 (48%), Gaps = 59/235 (25%)

Query: 181 LIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLY--YVH 238
           L+P  +    +KK L+LDLDETL+HS  +          H  +   P+     ++  YV 
Sbjct: 211 LLPPKLEKFQQKKCLILDLDETLVHSSFKYM--------HTADFVLPVEIDDQVHNVYVI 262

Query: 239 KRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVG 298
           KRP  D FLS+VC+ Y++++FTAS+  YA+P++D L+ +  G+   R +R  C   +G  
Sbjct: 263 KRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-N 319

Query: 299 YIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVI 358
           YIK+LS +                                               LSE I
Sbjct: 320 YIKNLSQI--------------------------------------------GRPLSETI 335

Query: 359 LIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNILSL 411
           ++DNSP SY  +  +A+ +  W SD  D +LL+++P LE L  +N  DV ++L +
Sbjct: 336 ILDNSPASYIFHPQHAVPISSWFSDTHDNELLDIIPLLEDLSSKNVLDVGSVLDV 390

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score =  101 bits (251), Expect = 8e-23,   Method: Compositional matrix adjust.
 Identities = 75/237 (31%), Positives = 112/237 (47%), Gaps = 64/237 (27%)

Query: 181 LIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKF--PISGISTLY--Y 236
           L P+  +  G KK LVLDLDETL+HS  +          +L    F  P+     ++  Y
Sbjct: 219 LPPKDPVFEG-KKCLVLDLDETLVHSSFK----------YLRTADFVIPVEIDDQVHNVY 267

Query: 237 VHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDG 296
           V KRP  D FL +V + Y++++FTAS+  Y DP++D L+   RG+   R +R+ C   DG
Sbjct: 268 VIKRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDP--RGAVHHRLFRDSCYNYDG 325

Query: 297 VGYIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSE 356
             YIK+LS +                                               LS+
Sbjct: 326 -NYIKNLSQI--------------------------------------------GRPLSD 340

Query: 357 VILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNILSL 411
           +I++DNSP SY ++  +AI +  W SD  D +LL+++P LE L  +   DV  IL +
Sbjct: 341 LIILDNSPASYILHPQHAIPISSWFSDAHDNELLDIMPLLEDLSKQKVPDVGKILDV 397

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score =  102 bits (253), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 70/221 (31%), Positives = 104/221 (47%), Gaps = 56/221 (25%)

Query: 181 LIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLY--YVH 238
           L P+  +    KK LVLDLDETL+HS  +  PN+        +   P++    ++  YV 
Sbjct: 332 LSPKDEIKFKHKKCLVLDLDETLVHSSFKYLPNA--------DFNLPVNIDDQIHNVYVI 383

Query: 239 KRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVG 298
           KRP  D FL KV + ++++IFTAS+  Y DP++D L+   + S   R +R  C   +G  
Sbjct: 384 KRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGK-SIHHRLFREACYNYEG-N 441

Query: 299 YIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVI 358
           YIK+LS +                                               LSE+I
Sbjct: 442 YIKNLSQMGRP--------------------------------------------LSEII 457

Query: 359 LIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL 399
           ++DNSP SY  +  +AI +  W SD  D +LL+++P LE L
Sbjct: 458 ILDNSPASYIFHPQHAIPISSWFSDSHDNELLDIIPLLEDL 498

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score =  100 bits (249), Expect = 3e-22,   Method: Compositional matrix adjust.
 Identities = 75/233 (32%), Positives = 109/233 (46%), Gaps = 54/233 (23%)

Query: 181 LIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKR 240
           L P+ I   GRKK L+LDLDETL+HS  +         A  V +   I   +   YV KR
Sbjct: 312 LAPKEIKRFGRKKCLILDLDETLVHSSFKYVD-----SADFV-IPVTIDNQTHHVYVIKR 365

Query: 241 PYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYI 300
           P  D FL +V   Y++++FTAS+  Y DP+++ L+ +       R +R  C   +G  Y+
Sbjct: 366 PGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPA-NTIIHHRLFRESCYTYEG-NYV 423

Query: 301 KDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILI 360
           K+LS                                           QL    L+E+I++
Sbjct: 424 KNLS-------------------------------------------QL-GRPLNEIIIL 439

Query: 361 DNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRN--TTDVRNILSL 411
           DNSP SY  +  +AI +  W SD  D +LL++LP L++L N    DV NIL +
Sbjct: 440 DNSPASYIFHPQHAIPISSWFSDIHDNELLDILPLLDNLANPDVLDVGNILDV 492

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 98.6 bits (244), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 70/235 (29%), Positives = 111/235 (47%), Gaps = 59/235 (25%)

Query: 181 LIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLY--YVH 238
           L+P  +    +KK L+LDLDETL+HS  +          H  +   P+     ++  YV 
Sbjct: 216 LLPPKLQEFQQKKCLILDLDETLVHSSFK--------YMHSADFVLPVEIDDQVHNVYVI 267

Query: 239 KRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVG 298
           KRP  D FL++V + Y++++FTAS+  YA+P++D L+ +  G+   R +R  C   +G  
Sbjct: 268 KRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-N 324

Query: 299 YIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVI 358
           YIK+LS +                                               LSE I
Sbjct: 325 YIKNLSQIGRP--------------------------------------------LSETI 340

Query: 359 LIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLR--NTTDVRNILSL 411
           ++DNSP SY  +  +A+ +  W SD  D +LL+++P LE L   N  DV ++L +
Sbjct: 341 ILDNSPASYIFHPQHAVPISSWFSDTHDNELLDIIPLLEDLSSGNVLDVGSVLDV 395

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 98.6 bits (244), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 112/233 (48%), Gaps = 55/233 (23%)

Query: 181 LIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKR 240
           L+P  +    +KK L+LDLDETL+HS  +    ++      VE+   +  +    YV KR
Sbjct: 211 LLPPKLQEFQQKKCLILDLDETLVHSSFKYMQTADFVLP--VEIDDQVHNV----YVIKR 264

Query: 241 PYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYI 300
           P  D FL +V + Y++++FTAS+  YA+P++D L+ +  G+   R +R  C   +G  YI
Sbjct: 265 PGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPN--GTIHHRLFREACYNYEG-NYI 321

Query: 301 KDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILI 360
           K+LS +                                               LSE I++
Sbjct: 322 KNLSQI--------------------------------------------GRPLSETIIL 337

Query: 361 DNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNILSL 411
           DNSP SY  +  +A+ +  W SD  D +LL+++P LE L  +N  DV ++L +
Sbjct: 338 DNSPASYIFHPQHAVPISSWFSDSHDNELLDIIPLLEDLSSKNVLDVGSVLDV 390

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score = 98.2 bits (243), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 76/241 (31%), Positives = 113/241 (46%), Gaps = 64/241 (26%)

Query: 177 FPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKF--PISGISTL 234
           F   L P++ + SG KK L+LDLDETL+HS  +          +L    F  P+     +
Sbjct: 504 FNTLLPPQNQIFSG-KKCLILDLDETLVHSSFK----------YLTSADFVIPVDIDEQI 552

Query: 235 Y--YVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCI 292
           +  YV KRP  D FL  V + +++++FTAS+  Y DP++D L+         R +R  C 
Sbjct: 553 HNVYVIKRPGVDQFLETVSKIFEVVVFTASVSRYGDPLLDVLDK--HRCIHHRLFREACY 610

Query: 293 LRDGVGYIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNN 352
             +G  YIK+LS +   P                                          
Sbjct: 611 DYEG-NYIKNLSQI-GRP------------------------------------------ 626

Query: 353 LLSEVILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNILS 410
            LSE+I++DNSP SY  +  +AI +  W SD  D +LL++LP L+ L   N  D+RNIL+
Sbjct: 627 -LSELIILDNSPASYIFHPQHAIPISSWFSDTHDNELLDILPLLQDLAEENIPDIRNILN 685

Query: 411 L 411
           +
Sbjct: 686 V 686

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 96.7 bits (239), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 72/240 (30%), Positives = 111/240 (46%), Gaps = 64/240 (26%)

Query: 176 LFPKKLIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLY 235
           L P KL+P       +KK L+LDLDETL+HS  +          H  +   P+     ++
Sbjct: 204 LLPPKLLPFQ-----QKKCLILDLDETLVHSSFKYL--------HTADFVLPVEIDDQVH 250

Query: 236 --YVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCIL 293
             YV KRP  D FL +V + Y++++FTAS+  YA+P++D L+ +   +   R +R  C  
Sbjct: 251 NVYVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPN--RTIHHRLFREACYN 308

Query: 294 RDGVGYIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNL 353
            +G  YIK+LS +                                               
Sbjct: 309 YEG-NYIKNLSQI--------------------------------------------GRP 323

Query: 354 LSEVILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLR--NTTDVRNILSL 411
           LSE I++DNSP SY  +  +A+ +  W SD  D +LL+++P LE L   N  DV ++L +
Sbjct: 324 LSETIILDNSPASYIFHPQHAVPISSWFSDTHDNELLDIIPLLEDLSAGNVLDVGSVLDV 383

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 96.7 bits (239), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 70/237 (29%), Positives = 108/237 (45%), Gaps = 59/237 (24%)

Query: 179 KKLIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLY--Y 236
           + L+P        KK LVLDLDETL+HS  +          H  +   P+     ++  Y
Sbjct: 208 RTLLPPQTNECFGKKCLVLDLDETLVHSSFK--------YLHTADFVLPVDIDDQIHNVY 259

Query: 237 VHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDG 296
           V KRP  D FL +V + Y++++FTAS+  Y DP++D L++S   S   R +R  C   +G
Sbjct: 260 VIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSS--NSIHHRLFREACYNYEG 317

Query: 297 VGYIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSE 356
             Y+K+L+ +                                               LSE
Sbjct: 318 -NYVKNLAQI--------------------------------------------GRPLSE 332

Query: 357 VILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNILSL 411
           ++++DNSP SY  +  +AI +  W SD  D +LL+++P LE L  +   DV  IL +
Sbjct: 333 IVILDNSPASYMFHPQHAIPISSWFSDTHDNELLDIIPLLEDLSQKYVPDVGKILDV 389

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 95.9 bits (237), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 67/211 (31%), Positives = 97/211 (45%), Gaps = 57/211 (27%)

Query: 191 RKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLY--YVHKRPYCDLFLS 248
            KK LVLDLDETL+HS  +          H  +   P+     ++  YV KRP  D FL 
Sbjct: 276 HKKCLVLDLDETLVHSSFK--------YLHTADFVLPVDIDDQIHNVYVIKRPGVDEFLQ 327

Query: 249 KVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLSIVNA 308
           +V   Y++++FTAS+  Y DP++D L+ S   +   R +R+ C   +G  YIK+LS +  
Sbjct: 328 RVGELYEVVVFTASVSRYGDPLLDVLDKS--NNIHHRLFRDACYTYEG-NYIKNLSQI-- 382

Query: 309 IPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILIDNSPVSYA 368
                                                        LSE+I++DNSP SY 
Sbjct: 383 ------------------------------------------GRPLSEIIILDNSPPSYI 400

Query: 369 MNVDNAIQVQGWISDPTDQDLLNLLPFLESL 399
            +  +AI +  W SD  D +LL++LP LE L
Sbjct: 401 FHPQHAIPISSWFSDSHDNELLDILPLLEDL 431

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 95.5 bits (236), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 74/237 (31%), Positives = 107/237 (45%), Gaps = 63/237 (26%)

Query: 181 LIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKF--PISGISTLY--Y 236
           L+P    H   KK LVLDLDETL+HS  +          +L    F  P+     ++  Y
Sbjct: 301 LLPPQSKHLSGKKCLVLDLDETLVHSSFK----------YLKGADFVLPVDIDDQIHNVY 350

Query: 237 VHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDG 296
           V KRP  D FL KV   ++++IFTAS+  Y DP++D L+     S   R +R  C   +G
Sbjct: 351 VMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILDK--HKSVHHRLFREACYNYEG 408

Query: 297 VGYIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSE 356
             YIK+LS +                                               LSE
Sbjct: 409 -NYIKNLSQI--------------------------------------------GRPLSE 423

Query: 357 VILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNILSL 411
           +I++DNSP SY  +  +AI +  W SD  D +LL+++P LE L  ++  DV  +L +
Sbjct: 424 IIILDNSPASYIFHPQHAIPISSWFSDTHDNELLDIIPLLEDLSEQSVPDVGKVLDI 480

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 93.6 bits (231), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 66/215 (30%), Positives = 99/215 (46%), Gaps = 67/215 (31%)

Query: 192 KKKLVLDLDETLIHSISRST-------PNSNNAQAHLVEVKFPISGISTLYYVHKRPYCD 244
           KK LVLDLDETL+HS  +         P + + Q H V             YV KRP  D
Sbjct: 307 KKCLVLDLDETLVHSSFKYIDTADFVLPVTIDDQTHQV-------------YVIKRPGVD 353

Query: 245 LFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLS 304
            FL +V + +++++FTAS+  Y DP++D L++S   S   R +R  C + DG  Y+K+LS
Sbjct: 354 EFLKRVGKIFEVVVFTASVSRYGDPLLDILDSS--KSIHHRLFRESCYIYDG-NYVKNLS 410

Query: 305 IVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILIDNSP 364
            +                                               LS++I++DNSP
Sbjct: 411 QIGR--------------------------------------------PLSDIIILDNSP 426

Query: 365 VSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL 399
            SY  +  +AI +  W SD  D +LL+++P LE +
Sbjct: 427 ASYIFHPQHAIPISSWFSDTHDNELLDIIPILEDI 461

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 92.8 bits (229), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 70/233 (30%), Positives = 109/233 (46%), Gaps = 56/233 (24%)

Query: 181 LIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKR 240
           L+P++ +  G KK LVLDLDETL+HS  +    ++      VE+   +  +    YV KR
Sbjct: 234 LLPKADMFKG-KKCLVLDLDETLVHSSFKYLRTADFVIP--VEIDNQVHNV----YVIKR 286

Query: 241 PYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYI 300
           P  D FL ++   Y++++FTAS+  Y DP++D L+     +   R +R+ C   +G  YI
Sbjct: 287 PGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDKD--KTIHHRLFRDSCYNYEG-NYI 343

Query: 301 KDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILI 360
           K+LS +                                               LS++I++
Sbjct: 344 KNLSQI--------------------------------------------GRPLSDMIIL 359

Query: 361 DNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNILSL 411
           DNSP SY  +  +AI +  W SD  D +LL+++P LE L      DV  IL +
Sbjct: 360 DNSPASYIFHPQHAIPISSWFSDAHDNELLDIIPLLEDLAEERVPDVGEILDV 412

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 93.2 bits (230), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 71/237 (29%), Positives = 107/237 (45%), Gaps = 59/237 (24%)

Query: 179 KKLIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLY--Y 236
           + L+P       R+K LVLDLDETL+HS  +          H  +   P+   + ++  Y
Sbjct: 309 RTLLPPQFPQFYRRKCLVLDLDETLVHSSFK--------YLHTADFVIPVEIDNQVHNVY 360

Query: 237 VHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDG 296
           V KRP  D FL +V   Y++++FTAS+  Y DP++D L+         R +R+ C   +G
Sbjct: 361 VIKRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILDK--HNVVHHRLFRDSCYNYEG 418

Query: 297 VGYIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSE 356
             YIK+LS +                                               LS+
Sbjct: 419 -NYIKNLSQI--------------------------------------------GRPLSD 433

Query: 357 VILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRN--TTDVRNILSL 411
           +I++DNSP SY  +  +AI +  W SD  D +LL++LP LE L +    DV  IL +
Sbjct: 434 LIILDNSPASYIFHPHHAIPISSWFSDAHDNELLDILPLLEDLASDKVPDVGRILDV 490

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 92.4 bits (228), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 72/237 (30%), Positives = 109/237 (45%), Gaps = 64/237 (27%)

Query: 181 LIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKF--PISGISTLY--Y 236
           L PR+   +G KK LVLDLDETL+HS  +          +L    F  P+     ++  Y
Sbjct: 273 LPPRAPAFNG-KKCLVLDLDETLVHSSFK----------YLRTADFVLPVDIDDQIHNVY 321

Query: 237 VHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDG 296
           V KRP  D FL +V   Y++++FTAS+  Y DP++D L+     +   R +R  C   +G
Sbjct: 322 VIKRPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILDK--HKTIHHRLFRESCYNYEG 379

Query: 297 VGYIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSE 356
             YIK+LS +                                               LS+
Sbjct: 380 -NYIKNLSQI--------------------------------------------GRPLSD 394

Query: 357 VILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNILSL 411
           +I++DNSP SY  +  +AI +  W SD  D +LL+++P LE L  ++  DV  +L +
Sbjct: 395 IIILDNSPASYIFHPQHAIPISSWFSDTHDNELLDIIPLLEDLSEKSVPDVGKVLDV 451

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score = 91.7 bits (226), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 73/233 (31%), Positives = 106/233 (45%), Gaps = 55/233 (23%)

Query: 181 LIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKR 240
           L+P        KK LVLDLDETL+HS  +    ++      VE+   +  +    YV KR
Sbjct: 228 LLPVKTEQFSGKKCLVLDLDETLVHSSFKFLRTADFVIP--VEIDNQVHNV----YVIKR 281

Query: 241 PYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYI 300
           P  D FL  V + Y++++FTAS+  Y DP++D L+ +       R +R+ C   DG  YI
Sbjct: 282 PGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLDQNH--CIHHRLFRDSCYNYDG-NYI 338

Query: 301 KDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILI 360
           K+LS +                                               LS++I++
Sbjct: 339 KNLSQI--------------------------------------------GRPLSDLIIL 354

Query: 361 DNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNILSL 411
           DNSP SY  +  +AI +  W SD  D +LL++LP LE L   N  DV  IL +
Sbjct: 355 DNSPASYIFHPQHAIPISSWFSDVHDNELLDILPLLEDLAEENVPDVGKILDV 407

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 91.7 bits (226), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 69/222 (31%), Positives = 105/222 (47%), Gaps = 55/222 (24%)

Query: 192 KKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKRPYCDLFLSKVC 251
           KK LVLDLDETL+HS  +    ++      VE++  I  +    YV KRP  D FL +V 
Sbjct: 228 KKCLVLDLDETLVHSSFKYVRTADFVLP--VEIEDQIHNV----YVIKRPGVDEFLKRVG 281

Query: 252 RWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLSIVNAIPG 311
             Y++++FTAS+  Y DP+++ L+ S   S   R +R  C   +G  YIK+L+ +     
Sbjct: 282 ELYEVVVFTASVSRYGDPLLNILDQS--NSVHHRLFREACYNYEG-NYIKNLAQIGR--- 335

Query: 312 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILIDNSPVSYAMNV 371
                                                     LS++I++DNSP SY  + 
Sbjct: 336 -----------------------------------------PLSDIIILDNSPASYMFHP 354

Query: 372 DNAIQVQGWISDPTDQDLLNLLPFLESLRNTT--DVRNILSL 411
            +AI +  W SD  D +LL+++P LE L + +  DV  IL +
Sbjct: 355 QHAIPISSWFSDTHDNELLDIIPLLEDLSHDSVLDVGKILDV 396

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 91.7 bits (226), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/243 (28%), Positives = 115/243 (47%), Gaps = 57/243 (23%)

Query: 173 GRFLFP--KKLIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISG 230
           G++  P  K L+P    ++  KK L+LDLDETL+HS  +   +++      VE+   +  
Sbjct: 223 GQYHAPGYKTLLPPQDENTKGKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHN 280

Query: 231 ISTLYYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRND 290
           +    YV KRP  + FL +V + +++++FTAS+  Y DP++D L+         R +R  
Sbjct: 281 V----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDAD--KVIHHRLFREA 334

Query: 291 CILRDGVGYIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQ 350
           C   +G  YIK+LS +                                            
Sbjct: 335 CYNYEG-NYIKNLSQI-------------------------------------------- 349

Query: 351 NNLLSEVILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLE--SLRNTTDVRNI 408
              LS++I++DNSP SY  +  +AI +  W SD  D +LL+++P LE  S++ + DV  I
Sbjct: 350 GRPLSDIIILDNSPASYIFHPQHAIPISSWFSDTHDNELLDIIPLLEDLSVKTSLDVGKI 409

Query: 409 LSL 411
           L +
Sbjct: 410 LDV 412

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 72/237 (30%), Positives = 107/237 (45%), Gaps = 63/237 (26%)

Query: 181 LIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKF--PISGISTLY--Y 236
           L+P        KK LVLDLDETL+HS  +          +L    F  P++    ++  Y
Sbjct: 229 LLPPQTEQFKGKKCLVLDLDETLVHSSFK----------YLRTADFVLPVNIDDQVHNVY 278

Query: 237 VHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDG 296
           V KRP  D FL +V   Y++++FTAS+  Y DP++D L+     S   R +R  C   +G
Sbjct: 279 VIKRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILDQ--HKSIHHRLFREACYNYEG 336

Query: 297 VGYIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSE 356
             YIK+LS +                                               LSE
Sbjct: 337 -NYIKNLSQI--------------------------------------------GRPLSE 351

Query: 357 VILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTT--DVRNILSL 411
           +I++DNSP SY  +  +AI V  W SD  D +L++++P LE L + +  DV  +L +
Sbjct: 352 IIILDNSPASYIFHPQHAIPVSSWFSDSHDNELIDIVPLLEDLSSNSVLDVGKVLDV 408

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 70/243 (28%), Positives = 115/243 (47%), Gaps = 57/243 (23%)

Query: 173 GRFLFP--KKLIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISG 230
           G++  P    L+P     +  KK L+LDLDETL+HS  +   +++   +  VE+   +  
Sbjct: 236 GQYHAPGYNTLLPPQDESTKGKKCLILDLDETLVHSSFKYLRSADFVLS--VEIDDQVHN 293

Query: 231 ISTLYYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRND 290
           +    YV KRP  + FL +V + +++++FTAS+  Y DP++D L+T        R +R  
Sbjct: 294 V----YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTD--KVIHHRLFREA 347

Query: 291 CILRDGVGYIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQ 350
           C   +G  YIK+LS +                                            
Sbjct: 348 CYNYEG-NYIKNLSQI-------------------------------------------- 362

Query: 351 NNLLSEVILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLE--SLRNTTDVRNI 408
              LS++I++DNSP SY  +  +AI +  W SD  D +LL+++P LE  S++ + DV  I
Sbjct: 363 GRPLSDIIILDNSPASYIFHPQHAIPISSWFSDTHDNELLDIIPLLEDLSVKTSLDVGKI 422

Query: 409 LSL 411
           L +
Sbjct: 423 LDV 425

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 91.3 bits (225), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 67/222 (30%), Positives = 106/222 (47%), Gaps = 55/222 (24%)

Query: 192 KKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKRPYCDLFLSKVC 251
           KK L+LDLDETL+HS  +   +++      VE+   +  +    YV KRP  + FL +V 
Sbjct: 245 KKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHNV----YVIKRPGVEEFLERVG 298

Query: 252 RWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLSIVNAIPG 311
           + +++++FTAS+  Y DP++D L+T        R +R  C   +G  YIK+LS +     
Sbjct: 299 KLFEVVVFTASVSRYGDPLLDILDTD--KVIHHRLFREACYNYEG-NYIKNLSQI----- 350

Query: 312 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILIDNSPVSYAMNV 371
                                                     LSE+I++DNSP SY  + 
Sbjct: 351 ---------------------------------------GRPLSEIIILDNSPASYIFHP 371

Query: 372 DNAIQVQGWISDPTDQDLLNLLPFLE--SLRNTTDVRNILSL 411
            +AI +  W SD  D +LL+++P LE  S++ + DV  IL +
Sbjct: 372 QHAIPISSWFSDTHDNELLDIIPLLEDLSVKTSLDVGKILDV 413

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 91.7 bits (226), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 67/224 (29%), Positives = 103/224 (45%), Gaps = 59/224 (26%)

Query: 192 KKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLY--YVHKRPYCDLFLSK 249
           +K LVLDLDETL+HS  +          H  +   P+   + ++  YV KRP  D FL +
Sbjct: 308 RKCLVLDLDETLVHSSFK--------YLHTADFVIPVEIDNQVHNVYVIKRPGVDEFLKR 359

Query: 250 VCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLSIVNAI 309
           V   +++++FTAS+  Y DP++D L+     +   R +R+ C   +G  YIK+LS +   
Sbjct: 360 VGELFEVVVFTASVSRYGDPLLDILDQ--YKAVHHRLFRDSCYNYEG-NYIKNLSQI--- 413

Query: 310 PGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILIDNSPVSYAM 369
                                                       LS++I++DNSP SY  
Sbjct: 414 -----------------------------------------GRPLSDLIILDNSPASYIF 432

Query: 370 NVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNILSL 411
           +  +A+ +  W SD  D +LL++LP LE L  R   DV  IL +
Sbjct: 433 HPQHAVPISSWFSDAHDNELLDILPLLEDLSSRKVPDVARILDV 476

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 90.1 bits (222), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 68/233 (29%), Positives = 111/233 (47%), Gaps = 55/233 (23%)

Query: 181 LIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKR 240
           L+P     +  KK L+LDLDETL+HS  +   +++      VE+   +  +    YV KR
Sbjct: 234 LLPPQGESTKGKKCLILDLDETLVHSSFKYLRSADFVLP--VEIDDQVHNV----YVIKR 287

Query: 241 PYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYI 300
           P  + FL +V + +++++FTAS+  Y DP++D L+T+       R +R  C   +G  YI
Sbjct: 288 PGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTN--KVIHHRLFREACYNYEG-NYI 344

Query: 301 KDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILI 360
           K+LS +                                               LS++I++
Sbjct: 345 KNLSQI--------------------------------------------GRPLSDIIIL 360

Query: 361 DNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLE--SLRNTTDVRNILSL 411
           DNSP SY  +  +AI +  W SD  D +LL+++P LE  S++ + DV  IL +
Sbjct: 361 DNSPASYIFHPQHAIPISSWFSDTHDNELLDIIPLLEDLSVKTSLDVGKILDV 413

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 90.5 bits (223), Expect = 7e-19,   Method: Compositional matrix adjust.
 Identities = 71/237 (29%), Positives = 105/237 (44%), Gaps = 63/237 (26%)

Query: 181 LIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKF--PISGISTLY--Y 236
           L+P        +K LVLDLDETL+HS  +          +L    F  P+     ++  Y
Sbjct: 300 LLPPPSKAVSHRKCLVLDLDETLVHSSFK----------YLKSADFVLPVDIDDQIHNVY 349

Query: 237 VHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDG 296
           V KRP  D FL +V + Y++++FTAS+  Y DP++D L+     S   R +R  C   +G
Sbjct: 350 VIKRPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILDKD--KSIHHRLFREACYNYEG 407

Query: 297 VGYIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSE 356
             YIK+LS +                                               LS 
Sbjct: 408 -NYIKNLSQI--------------------------------------------GRPLSN 422

Query: 357 VILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLR--NTTDVRNILSL 411
           +I++DNSP SY  +  +AI +  W SD  D +LL+++P LE L   N  DV  +L +
Sbjct: 423 IIILDNSPASYIFHPQHAIPISSWFSDTHDNELLDIIPLLEDLAMDNVLDVGKVLDV 479

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 90.1 bits (222), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 68/214 (31%), Positives = 98/214 (45%), Gaps = 61/214 (28%)

Query: 190 GRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKF--PISGISTLY--YVHKRPYCDL 245
            RKK LVLDLDETL+HS          +  +L    F  P+     ++  YV KRP  D 
Sbjct: 311 SRKKCLVLDLDETLVHS----------SFKYLKSADFVLPVDIDDQIHNVYVIKRPGVDE 360

Query: 246 FLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLSI 305
           FL +V   +++++FTAS+  Y DP++D L+     S   R +R  C   +G  YIK+LS 
Sbjct: 361 FLKRVGEIFEVVVFTASVSRYGDPLLDVLDKG--KSIHHRLFREACYNYEG-NYIKNLS- 416

Query: 306 VNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILIDNSPV 365
                                                     QL    LS++I++DNSP 
Sbjct: 417 ------------------------------------------QL-GRPLSDIIILDNSPA 433

Query: 366 SYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL 399
           SY  +  +AI +  W SD  D +LL+++P LE L
Sbjct: 434 SYIFHPQHAIPISSWFSDTHDNELLDIIPLLEDL 467

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 89.4 bits (220), Expect = 9e-19,   Method: Compositional matrix adjust.
 Identities = 70/222 (31%), Positives = 102/222 (45%), Gaps = 55/222 (24%)

Query: 192 KKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKRPYCDLFLSKVC 251
           KK LVLDLDETL+HS  +    ++      VE+   I  +    YV KRP  D FL  V 
Sbjct: 240 KKCLVLDLDETLVHSSFKFLRTADFVIP--VEIDNQIHNV----YVIKRPGVDEFLKLVG 293

Query: 252 RWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLSIVNAIPG 311
           + Y++++FTAS+  Y DP++D L+ +       R +R+ C   DG  YIK+LS +     
Sbjct: 294 QLYEVVVFTASVSRYGDPLLDVLDQT--QCIHHRLFRDSCYNYDG-NYIKNLSQI----- 345

Query: 312 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILIDNSPVSYAMNV 371
                                                     LS++I++DNSP SY  + 
Sbjct: 346 ---------------------------------------GRPLSDLIILDNSPASYIFHP 366

Query: 372 DNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNILSL 411
            +AI +  W SD  D +LL+++P LE L      DV  IL +
Sbjct: 367 QHAIPISSWFSDVHDNELLDIMPLLEDLAQEQVPDVGKILDV 408

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 89.7 bits (221), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 66/233 (28%), Positives = 109/233 (46%), Gaps = 53/233 (22%)

Query: 181 LIPRSILHSGRKKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKR 240
           L+P        KK L+LDLDETL+HS  +   N +     ++ ++     I  +Y + KR
Sbjct: 301 LLPPKDSKDKHKKCLILDLDETLVHSSFKFINNPD----FILPIEIEDGQIHNVYVI-KR 355

Query: 241 PYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYI 300
           P  D FL +V +WY+++IFTAS+  YA+P++D L+       + R +R+ C   +   +I
Sbjct: 356 PGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKD-HNLINHRLFRDACYNYEN-NFI 413

Query: 301 KDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILI 360
           K+LS +                                               L ++I++
Sbjct: 414 KNLSQIGRP--------------------------------------------LHDIIIL 429

Query: 361 DNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTT--DVRNILSL 411
           DNSP SY  +  +AI +  W SD  D +L+++LP L+ L + +  DV  IL +
Sbjct: 430 DNSPASYIFHPQHAIPISSWFSDTHDNELIDILPLLKDLSHVSVDDVGKILDV 482

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 89.4 bits (220), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 70/226 (30%), Positives = 104/226 (46%), Gaps = 62/226 (27%)

Query: 192 KKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKF--PISGISTLY--YVHKRPYCDLFL 247
           KK LVLDLDETL+HS  +          +L    F  P++    ++  YV KRP  + FL
Sbjct: 302 KKCLVLDLDETLVHSSFK----------YLQTADFVLPVNIDEQIHNVYVIKRPGVEEFL 351

Query: 248 SKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLSIVN 307
            +V   +++++FTAS+  Y DP++D L+   R     R +R  C   +G  YIK+LS + 
Sbjct: 352 KRVGELFEVVVFTASVARYGDPLLDILDPG-RQLIHHRLFREACYNYEG-NYIKNLSQM- 408

Query: 308 AIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILIDNSPVSY 367
                                                         LSE+I++DNSP SY
Sbjct: 409 -------------------------------------------GRPLSEIIILDNSPASY 425

Query: 368 AMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRN--TTDVRNILSL 411
             +  +AI +  W SD  D +LL+++P LE L N  + DV  IL +
Sbjct: 426 IFHPQHAIPISSWFSDSHDNELLDIIPLLEDLANIKSLDVGKILDV 471

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 85.1 bits (209), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 66/222 (29%), Positives = 106/222 (47%), Gaps = 54/222 (24%)

Query: 192 KKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKRPYCDLFLSKVC 251
           +K LVLDLDETL+HS  +    ++      ++ +F         YV KRP  D FL    
Sbjct: 179 RKCLVLDLDETLVHSSFKYVSTADFVLPVDIDDQF------QNVYVIKRPGVDAFLQYTS 232

Query: 252 RWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLSIVNAIPG 311
           + ++++IFTAS+++Y +P++D L+++       R +R+ C   +G  YIK+L+       
Sbjct: 233 KLFEVVIFTASVEKYGNPLLDILDST-NDLVHHRLFRDACYNYNG-NYIKNLA------- 283

Query: 312 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILIDNSPVSYAMNV 371
                                               QL    LS++I++DNSP SY  + 
Sbjct: 284 ------------------------------------QL-GRPLSDIIILDNSPTSYLFHP 306

Query: 372 DNAIQVQGWISDPTDQDLLNLLPFLESLRNT--TDVRNILSL 411
           ++AI +  W SD  D +LL++LP L  L N+   DV  IL +
Sbjct: 307 NHAIPISSWFSDAHDNELLSILPLLTDLANSKVIDVSKILDV 348

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 85.5 bits (210), Expect = 3e-17,   Method: Compositional matrix adjust.
 Identities = 65/224 (29%), Positives = 102/224 (45%), Gaps = 59/224 (26%)

Query: 192 KKKLVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLY--YVHKRPYCDLFLSK 249
           +K LVLDLDETL+HS  +          ++ +   P+   + +   YV KRP  D FL  
Sbjct: 282 RKCLVLDLDETLVHSSFK--------YLNIADFVLPVDIDNQVQNVYVSKRPGVDEFLKI 333

Query: 250 VCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLSIVNAI 309
           V   Y++I+FTAS+  Y +P++D L+         R +R+ C + +G  Y+K+LS +   
Sbjct: 334 VGDLYEVIVFTASVSRYGNPLMDILDP--HKYIHHRLFRDSCYVYEG-NYVKNLSQI--- 387

Query: 310 PGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILIDNSPVSYAM 369
                                                       L ++I++DNSP SY  
Sbjct: 388 -----------------------------------------GRPLGDIIILDNSPASYIF 406

Query: 370 NVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNILSL 411
           +  +AI +  W SD  D +LLN++P LE L  ++  DV  IL +
Sbjct: 407 HPQHAIPISSWFSDSHDSELLNIIPLLEDLSKKSVLDVGKILDV 450

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 67.0 bits (162), Expect = 3e-11,   Method: Compositional matrix adjust.
 Identities = 49/173 (28%), Positives = 80/173 (46%), Gaps = 49/173 (28%)

Query: 239 KRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVG 298
           KRP  D FL  + ++Y++++F+++   Y+D + + L+       S   ++  C+ +DGV 
Sbjct: 217 KRPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLD-PIHAFVSYNLFKEHCVYKDGV- 274

Query: 299 YIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVI 358
           +IKDLS +N                                              LS+VI
Sbjct: 275 HIKDLSKLNRD--------------------------------------------LSKVI 290

Query: 359 LIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNIL 409
           +ID  P SY +  +NAI ++ W  +  D+ L+ L+PFLE L  + T DVR IL
Sbjct: 291 IIDTDPNSYKLQPENAIPMEPWNGEADDK-LVRLIPFLEYLATQQTKDVRPIL 342

>ZYRO0F09130g Chr6 complement(741490..742959) [1470 bp, 489 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 489

 Score = 65.5 bits (158), Expect = 8e-11,   Method: Compositional matrix adjust.
 Identities = 47/174 (27%), Positives = 76/174 (43%), Gaps = 49/174 (28%)

Query: 239 KRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVG 298
           KRP CD FL  + ++Y++++F+++   Y+D + + L+       S   ++  C+ +DG+ 
Sbjct: 221 KRPGCDYFLGYLSQYYEIVLFSSNYMMYSDRICEKLD-PIHAFISYNLFKEHCVYKDGI- 278

Query: 299 YIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVI 358
           +IKD+S +N   G                                            +V+
Sbjct: 279 HIKDISKMNRDVG--------------------------------------------KVV 294

Query: 359 LIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNILS 410
           +ID  P  Y    +NAI  + W   P D  LL L+PFLE L  +   DVR ILS
Sbjct: 295 MIDTDPNCYKSQPENAIPAKPWDGTPDD-GLLQLIPFLEYLATQQVNDVRPILS 347

>TDEL0B03190 Chr2 (562435..563868) [1434 bp, 477 aa] {ON} Anc_8.527
           YPL063W
          Length = 477

 Score = 64.7 bits (156), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 46/173 (26%), Positives = 77/173 (44%), Gaps = 49/173 (28%)

Query: 239 KRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVG 298
           KRP CD FL  + ++Y++++F+++   YA+ + + L+       S   ++  C+ +DGV 
Sbjct: 208 KRPGCDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLD-PIHAFVSYNLFKEHCVYKDGV- 265

Query: 299 YIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVI 358
           +IKD+S +                                            N  L +V+
Sbjct: 266 HIKDISKL--------------------------------------------NRDLGKVV 281

Query: 359 LIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNIL 409
            ID  P +Y +  +NAI +  W  +  D+ LL L+PFLE L  +   DVR IL
Sbjct: 282 TIDTDPNTYKLQPENAIPMDPWTGEADDK-LLRLIPFLEYLATQQVNDVRPIL 333

>Smik_16.172 Chr16 (313129..314562) [1434 bp, 477 aa] {ON} YPL063W
           (REAL)
          Length = 477

 Score = 63.9 bits (154), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 48/174 (27%), Positives = 80/174 (45%), Gaps = 49/174 (28%)

Query: 239 KRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVG 298
           KRP  D FL  + +++++++F+++   Y+D + + L+       S   ++  C+ +DGV 
Sbjct: 217 KRPGADYFLGYLSQYFEIVLFSSNYMMYSDKIAEKLD-PIHAFVSYNLFKEHCVYKDGV- 274

Query: 299 YIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVI 358
           +IKDLS +N                                              LS+VI
Sbjct: 275 HIKDLSKLNRD--------------------------------------------LSKVI 290

Query: 359 LIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNILS 410
           +ID  P SY +  +NAI +  W  +  D+ L+ L+PFLE L  + T DVR IL+
Sbjct: 291 IIDTEPNSYKLQPENAIPMDPWNGEADDK-LVRLIPFLEYLATQQTKDVRPILN 343

>Suva_16.249 Chr16 (440525..441967) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 80/173 (46%), Gaps = 49/173 (28%)

Query: 239 KRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVG 298
           KRP  D FL  + +++++++F+++   Y++ + + L+       S   ++  C+ +DGV 
Sbjct: 222 KRPGADYFLGYLSQYFEIVLFSSNYMMYSEKIAEKLD-PIHAFVSYNLFKEHCVYKDGV- 279

Query: 299 YIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVI 358
           +IKDLS +N                                              LS+VI
Sbjct: 280 HIKDLSKLNRD--------------------------------------------LSKVI 295

Query: 359 LIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNIL 409
           +ID  P SY +  +NAI ++ W  +  D+ L+ L+PFLE L  + T DVR IL
Sbjct: 296 IIDTDPNSYKLQPENAIPMEPWNGEADDK-LVRLIPFLEYLATQQTKDVRPIL 347

>SAKL0H10296g Chr8 complement(880969..882405) [1437 bp, 478 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 478

 Score = 63.2 bits (152), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 76/173 (43%), Gaps = 49/173 (28%)

Query: 239 KRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVG 298
           KRP  D FL  + ++Y++++F+++   YA+ V + ++       +   Y+  C+ +DGV 
Sbjct: 216 KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKVAEKMD-PIHAFVTYNLYKEHCLYKDGV- 273

Query: 299 YIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVI 358
           +IKDLS +                                            N  L + +
Sbjct: 274 HIKDLSKL--------------------------------------------NRDLGKTM 289

Query: 359 LIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNIL 409
           +ID  P SY +  +NAI V+ W     D  LL L+PFLE L  +  +DVR IL
Sbjct: 290 IIDTDPNSYKLQPENAIPVKPW-EGTADDGLLKLIPFLEYLATQQVSDVRPIL 341

>Kpol_457.5 s457 complement(11098..12567) [1470 bp, 489 aa] {ON}
           complement(11098..12567) [1470 nt, 490 aa]
          Length = 489

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 77/173 (44%), Gaps = 49/173 (28%)

Query: 239 KRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVG 298
           KRP  D FL  + ++Y++++F+++   Y++ + + L+       S   Y+  C+ ++G  
Sbjct: 226 KRPGVDYFLGYLSQYYEVVLFSSNYMMYSEKIAEKLDP-IHAFISYNLYKEHCVYKEG-D 283

Query: 299 YIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVI 358
           +IKDLS +N                                              L +VI
Sbjct: 284 HIKDLSKLN--------------------------------------------RDLGKVI 299

Query: 359 LIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNIL 409
           ++D  P SY +  +NAI +Q W     D+ L+ L+PFLE L  +  +DVR IL
Sbjct: 300 IVDTDPASYKLQPENAIPMQPWDGKADDK-LMRLIPFLEYLATQQVSDVRPIL 351

>NCAS0C02210 Chr3 (411245..412720) [1476 bp, 491 aa] {ON} Anc_8.527
          Length = 491

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 45/174 (25%), Positives = 79/174 (45%), Gaps = 49/174 (28%)

Query: 239 KRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVG 298
           KRP  D FL  + ++Y++++F+++   Y + + + L+       S   ++  C+ +DGV 
Sbjct: 228 KRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLD-PLHAFISYNLFKEHCVYKDGV- 285

Query: 299 YIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVI 358
           +IKDLS +N                                              +++V+
Sbjct: 286 HIKDLSKLN--------------------------------------------RDVNKVL 301

Query: 359 LIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNILS 410
           +ID  P +Y +  +NAI V+ W     D +LL L+PFLE L  + T DV+ IL+
Sbjct: 302 IIDTEPNNYKLQPENAIPVKPW-DGKADDELLRLIPFLEYLATQQTEDVKPILN 354

>Kwal_27.11990 s27 complement(1034942..1036366) [1425 bp, 474 aa]
           {ON} YPL063W - Protein required for cell viability
           [contig 26] FULL
          Length = 474

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 45/173 (26%), Positives = 76/173 (43%), Gaps = 49/173 (28%)

Query: 239 KRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVG 298
           KRP  D FL  + ++Y++++F+++   Y+D V + L+       +   ++  C+ +DGV 
Sbjct: 212 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLD-PIHAFITYNLFKEHCLYKDGV- 269

Query: 299 YIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVI 358
           +IKDLS +                                            N  L + +
Sbjct: 270 HIKDLSKL--------------------------------------------NRDLGKTV 285

Query: 359 LIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNIL 409
           +ID  P +Y +  +NAI ++ W     D  LL L+PFLE L  + T DVR +L
Sbjct: 286 IIDCDPNAYKLQPENAIPMKPW-DGKADDGLLKLIPFLEYLATQQTEDVRPVL 337

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 60.1 bits (144), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 47/173 (27%), Positives = 80/173 (46%), Gaps = 49/173 (28%)

Query: 239 KRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVG 298
           KRP  + FL  + ++Y++++F+++   Y++   + L+       S   ++  C+ +DGV 
Sbjct: 220 KRPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKLD-PIHAFVSYNLFKEHCVYKDGV- 277

Query: 299 YIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVI 358
           +IKDLS                                           +L+ +L S+VI
Sbjct: 278 HIKDLS-------------------------------------------KLKRDL-SKVI 293

Query: 359 LIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNIL 409
           +ID  P SY +  +NAI +  W  +  D+ L+ L+PFLE L  + T DVR IL
Sbjct: 294 IIDTDPNSYKLQPENAIPMDPWNGEADDK-LVRLIPFLEYLATQQTKDVRPIL 345

>TBLA0A00540 Chr1 complement(104887..106344) [1458 bp, 485 aa] {ON}
           Anc_8.527 YPL063W
          Length = 485

 Score = 58.2 bits (139), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 56/218 (25%), Positives = 92/218 (42%), Gaps = 70/218 (32%)

Query: 195 LVLDLDETLIHSISRSTPNSNNAQAHLVEVKFPISGISTLYYVHKRPYCDLFLSKVCRWY 254
           LVL L++ L+HS          +Q H         G  T     KRP  D FL  + ++Y
Sbjct: 198 LVLTLEDLLVHS--------EWSQKH---------GWRTA----KRPGVDYFLGYLSQYY 236

Query: 255 DLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGYIKDLSIVNAIPGXXX 314
           ++++F+++   Y+D + + L+       S   ++  C+ +DGV +IKDLS +N       
Sbjct: 237 EIVLFSSNYMMYSDRIAEKLDP-IHAFVSYNLFKEHCLYKDGV-HIKDLSKLNRDE---- 290

Query: 315 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVILIDNSPVSYAMNVDNA 374
                                                    +V++ID  P SY +  +NA
Sbjct: 291 ----------------------------------------KKVLIIDVDPNSYKLQPENA 310

Query: 375 IQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNILS 410
           I ++ W     D  L+ L+PFLE L  +  +DVR +LS
Sbjct: 311 IPMKPW-DGQMDDKLIRLIPFLEYLATQQVSDVRPVLS 347

>NDAI0E02910 Chr5 complement(615208..616533) [1326 bp, 441 aa] {ON} 
          Length = 441

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 43/174 (24%), Positives = 79/174 (45%), Gaps = 49/174 (28%)

Query: 239 KRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVG 298
           KRP  D FL  + ++Y++++F+++   Y + + + L+       S   ++  C+ +DGV 
Sbjct: 236 KRPGVDYFLGYLSQYYEIVLFSSNYMMYGEKIAEKLD-PLHAFISYSLFKEHCVYKDGV- 293

Query: 299 YIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVI 358
           +IKDLS +N                                              +++V+
Sbjct: 294 HIKDLSKLNRD--------------------------------------------VNKVL 309

Query: 359 LIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNILS 410
           +ID  P +Y +  +NAI ++ W  +  D+ LL L+PFLE L  +   DV+ IL+
Sbjct: 310 IIDTDPNNYKLQPENAIPMEPWKGEADDK-LLRLIPFLEYLATQQVDDVKPILN 362

>KLTH0E12254g Chr5 complement(1089636..1091066) [1431 bp, 476 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 476

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 75/173 (43%), Gaps = 49/173 (28%)

Query: 239 KRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVG 298
           KRP  D FL  + ++Y++++F+++   Y+D V + L+       +   ++  C+ +DGV 
Sbjct: 213 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSDKVAEKLDP-IHAFITYNLFKEHCLYKDGV- 270

Query: 299 YIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVI 358
           +IKDLS +                                            N  L + I
Sbjct: 271 HIKDLSKL--------------------------------------------NRDLGKTI 286

Query: 359 LIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNIL 409
           ++D  P +Y +  +NAI ++ W     D  LL L+PFLE L  +   DVR +L
Sbjct: 287 IVDCDPNAYKLQPENAIPMRPW-DGKADDGLLRLIPFLEYLATQQMDDVRPVL 338

>TPHA0I02000 Chr9 (448172..449608) [1437 bp, 478 aa] {ON} Anc_8.527
           YPL063W
          Length = 478

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 44/173 (25%), Positives = 77/173 (44%), Gaps = 49/173 (28%)

Query: 239 KRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVG 298
           KRP  D FL  + ++Y++++F+++   Y++ + + L+       S   Y+  C+ ++G  
Sbjct: 217 KRPGTDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLD-PIHAFVSYNLYKEHCVYKEGT- 274

Query: 299 YIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVI 358
           +IKDLS +N                                              L +V+
Sbjct: 275 HIKDLSKLNRD--------------------------------------------LDKVL 290

Query: 359 LIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNIL 409
           +ID  P +Y    +NAI V+ W +   D +LL L+PFLE L  +  +DV+ IL
Sbjct: 291 IIDCDPNNYKFQPENAIPVKPW-NGQADDELLKLIPFLEYLATQQVSDVKPIL 342

>CAGL0H05159g Chr8 complement(501094..502551) [1458 bp, 485 aa] {ON}
           similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063w
          Length = 485

 Score = 57.4 bits (137), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 45/180 (25%), Positives = 78/180 (43%), Gaps = 49/180 (27%)

Query: 239 KRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVG 298
           KRP  D FL  + ++Y++++F+++   YA+ + + ++       S   ++  C+ +DGV 
Sbjct: 223 KRPGADYFLGYLSQYYEIVLFSSNYMMYAEKIAEKMD-PIHAFISYNLFKEHCVYKDGV- 280

Query: 299 YIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVI 358
           +IKDLS +N                                              L +V+
Sbjct: 281 HIKDLSKLNRD--------------------------------------------LKKVM 296

Query: 359 LIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNILSLKNGER 416
           +ID    SY +  +NAI +  W     D+ LL L+PFLE +  +   DVR IL   + +R
Sbjct: 297 IIDTDENSYKLQPENAIPMDPWDGKADDK-LLRLIPFLEYMATQQVEDVRPILKSYHNKR 355

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 56.6 bits (135), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 44/177 (24%), Positives = 78/177 (44%), Gaps = 49/177 (27%)

Query: 235 YYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILR 294
           +   KRP  D FL  + ++Y++++F+++   YA+ + + L+       +   ++  C+ +
Sbjct: 216 WRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLDP-IHAFITYNLFKEHCLYK 274

Query: 295 DGVGYIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLL 354
           DGV +IKDLS +                                            N  L
Sbjct: 275 DGV-HIKDLSKL--------------------------------------------NRDL 289

Query: 355 SEVILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNIL 409
            +V++ID    S+ +  +NAI ++ W     D+ LL L+PFLE L  +  +DVR IL
Sbjct: 290 GKVLIIDTDENSFKLQPENAIYLEPWDGKADDR-LLRLIPFLEYLATQQVSDVRPIL 345

>Ecym_1177 Chr1 (358495..359967) [1473 bp, 490 aa] {ON} similar to
           Ashbya gossypii ADR045W
          Length = 490

 Score = 53.1 bits (126), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 39/174 (22%), Positives = 75/174 (43%), Gaps = 49/174 (28%)

Query: 239 KRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVG 298
           KRP  D FL  + ++Y++++F+++   +++ + + L+       +   ++  C+ +DG+ 
Sbjct: 227 KRPGADYFLGYLSQYYEIVLFSSNYMMHSEKIAEKLD-PIHAFITYNLFKEHCVYKDGI- 284

Query: 299 YIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVI 358
           +IKDLS +                                            N  L + I
Sbjct: 285 HIKDLSHL--------------------------------------------NRDLGKTI 300

Query: 359 LIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNILS 410
           +ID    ++ +  +NAI  + W     D +LL  +PFLE L  + T D+R IL+
Sbjct: 301 IIDTDANAFKLQPENAIHAEPW-DGKADHELLTYIPFLEYLVTQPTEDIRPILN 353

>KNAG0A02060 Chr1 (168328..169680) [1353 bp, 450 aa] {ON} Anc_8.527
           YPL063W
          Length = 450

 Score = 50.4 bits (119), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 40/180 (22%), Positives = 77/180 (42%), Gaps = 49/180 (27%)

Query: 233 TLYYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCI 292
           T +   KRP  D FL  + ++Y++++F+++   Y++ + + L+       S   ++  C+
Sbjct: 205 TGWRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYSERIAEKLDP-LHAFISYNLFKEHCV 263

Query: 293 LRDGVGYIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNN 352
            +D V +IKDLS +                                            N 
Sbjct: 264 YKDHV-HIKDLSKL--------------------------------------------NR 278

Query: 353 LLSEVILIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNILS 410
            + +V+++D    SY +  +NA+ +  W   P D+ L+ ++PFLE L  +   DVR +L 
Sbjct: 279 DVRKVVIMDTDANSYKLQPENALPMAPWDGKPDDK-LIQMIPFLEYLATQQVDDVRPVLG 337

>KAFR0E01020 Chr5 (210125..211471) [1347 bp, 448 aa] {ON} Anc_8.527
           YPL063W
          Length = 448

 Score = 49.3 bits (116), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/170 (23%), Positives = 74/170 (43%), Gaps = 48/170 (28%)

Query: 239 KRPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVG 298
           KRP  D FL  + ++Y++++F+++   Y++ + + L+       S   ++  C+ + G  
Sbjct: 191 KRPGVDYFLGYLSQYYEIVLFSSNYMMYSEKIAEKLD-PIHAFISYNLFKEHCVYKKG-K 248

Query: 299 YIKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVI 358
           +IKDLS +N                                              +++VI
Sbjct: 249 HIKDLSKLNRD--------------------------------------------VNKVI 264

Query: 359 LIDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESLRNTTDVRNI 408
           +ID    +Y +  +NAI ++ W S   D +L+ L+PFLE L  T  V N+
Sbjct: 265 IIDTDKNNYKLQPENAIPMKPW-SGTADDELIKLIPFLEYLA-TQQVNNV 312

>ADR045W Chr4 (784057..785487) [1431 bp, 476 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL063W
          Length = 476

 Score = 47.8 bits (112), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 41/173 (23%), Positives = 71/173 (41%), Gaps = 49/173 (28%)

Query: 240 RPYCDLFLSKVCRWYDLIIFTASMKEYADPVIDWLETSFRGSFSKRFYRNDCILRDGVGY 299
           RP  D  L  +  +Y+ ++F ++   Y+  V++ L+   R   +   +++ C+ +DG+ +
Sbjct: 217 RPGADYLLGYLSDYYENVLFPSNYMVYSKKVVEKLD-PIRAFITYNLFKDHCVYKDGI-H 274

Query: 300 IKDLSIVNAIPGXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXQLQNNLLSEVIL 359
           IKDLS +                                            N  L + ++
Sbjct: 275 IKDLSHL--------------------------------------------NRDLGKTLI 290

Query: 360 IDNSPVSYAMNVDNAIQVQGWISDPTDQDLLNLLPFLESL--RNTTDVRNILS 410
           ID  P S  + ++NAI  + W     D  LL  +PFLE L  +   DVR IL+
Sbjct: 291 IDTDPNSVKLQMENAILAEPWDGK-ADDALLRYIPFLEYLVTQPINDVRPILN 342

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score = 37.4 bits (85), Expect = 0.077,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 50/106 (47%), Gaps = 28/106 (26%)

Query: 191 RKKKLVL--DLDETLIH-----SISR-----STPNSN---NAQAHLVEV----------- 224
           R KKL+L  DLD+T+IH     +IS      S PN     N ++ ++E            
Sbjct: 164 RSKKLILVVDLDQTVIHCGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGP 223

Query: 225 KFPISGISTLYYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYADPV 270
           K P+   S  YYV  RP    F  KV   Y++ I+T + + YA+ +
Sbjct: 224 KPPVHKCS--YYVKVRPGLKEFFEKVAPIYEMHIYTMATRAYAEEI 267

>ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR277W (FCP1)
          Length = 728

 Score = 36.6 bits (83), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 30/103 (29%), Positives = 43/103 (41%), Gaps = 22/103 (21%)

Query: 187 LHSGRKKKLVLDLDETLIHSISRST-------PNSNNAQAHLVEVKFPISGISTL----- 234
           L   RK  LV+DLD+T+IH     T       PN+ N +A      F +     L     
Sbjct: 160 LREARKLVLVVDLDQTVIHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYM 219

Query: 235 ----------YYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYA 267
                     YYV  RP    F +K+   ++L I+T + + YA
Sbjct: 220 GPKPPTRKCWYYVKLRPGLKEFFAKIAPHFELHIYTMATRAYA 262

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score = 32.7 bits (73), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 47/107 (43%), Gaps = 24/107 (22%)

Query: 184 RSILHSGRKKKLVLDLDETLIHSISRST-------PNSNNAQAHLVEVK-FPISGISTL- 234
           R+ L   +K  LV+DLD+T+IH     T       P + N +  L +VK F +     L 
Sbjct: 160 RTRLRKEKKLVLVVDLDQTVIHCGVDPTIGEWKNDPKNPNFET-LKDVKQFSLEEEPILP 218

Query: 235 --------------YYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYA 267
                         YYV  RP    FL K+   +++ I+T + + YA
Sbjct: 219 TLYMGPKPPLRKCWYYVKVRPGLKEFLEKIAPLFEMHIYTMATRAYA 265

>Kpol_1018.141 s1018 complement(374392..376686) [2295 bp, 764 aa]
           {ON} complement(374392..376686) [2295 nt, 765 aa]
          Length = 764

 Score = 32.3 bits (72), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 26/96 (27%), Positives = 45/96 (46%), Gaps = 4/96 (4%)

Query: 22  SGSQSEDVQTYTNDVSDTCVSSQTQIISKVEDVLNEDNQRSTLVLVLLFFPKYLLVKPIF 81
           S S +E+  T+ N   +  V+S     +++  V+ E +     +  L  + K  L+ P  
Sbjct: 259 SNSMNEETNTWKNKFFELLVTSDDHKENEIAGVITETSNLENFIRHLFQWKKNYLISP-- 316

Query: 82  FLW-FLITFPITLFEQKNKKLPKSSANLDTMSKSKN 116
            LW   +T   T FE+K  K   ++ NL+T S + N
Sbjct: 317 -LWSMFVTLKATNFEKKYLKEVTTAKNLNTGSTTSN 351

>KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.839
           YMR277W
          Length = 724

 Score = 32.0 bits (71), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 29/104 (27%), Positives = 46/104 (44%), Gaps = 24/104 (23%)

Query: 187 LHSGRKKKLVLDLDETLIH-------SISRSTPNSNNAQAHLVEVKF------PI----- 228
           L + +K  LV+DLD+T+IH          +S PN+ N    L +V+       P+     
Sbjct: 164 LRNEKKLVLVVDLDQTVIHCGVDPTIGEWKSDPNNPNYDT-LKDVQMFALEEEPVLPFMY 222

Query: 229 -----SGISTLYYVHKRPYCDLFLSKVCRWYDLIIFTASMKEYA 267
                +     YYV  RP    F  KV   +++ I+T + + YA
Sbjct: 223 MGPKPTPRKCWYYVKVRPGLKEFFKKVAPLFEMHIYTMATRAYA 266

>Suva_13.26 Chr13 (34036..37404) [3369 bp, 1122 aa] {ON} YML117W
           (REAL)
          Length = 1122

 Score = 31.6 bits (70), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 25/63 (39%), Positives = 37/63 (58%), Gaps = 10/63 (15%)

Query: 3   ALSYISSNLITPIEEEELPSGSQSEDVQTYTNDVSDTCVSSQTQIISKVEDVLNEDNQRS 62
            L+Y S +L TP+E+EEL   S+SE+ Q  T+D S T +S+         DV N+D  RS
Sbjct: 305 CLNYDSKSLPTPVEDEEL---SRSEE-QAATDDAS-TMISASLH-----HDVENKDATRS 354

Query: 63  TLV 65
            ++
Sbjct: 355 III 357

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.389 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 40,670,643
Number of extensions: 1659022
Number of successful extensions: 6065
Number of sequences better than 10.0: 83
Number of HSP's gapped: 6119
Number of HSP's successfully gapped: 155
Length of query: 422
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 310
Effective length of database: 40,638,807
Effective search space: 12598030170
Effective search space used: 12598030170
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)