Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_339.125.351ON73373339610.0
TPHA0E011205.351ON73373334010.0
Suva_15.2625.351ON73172832850.0
Smik_8.1485.351ON73173332660.0
YHR072W (ERG7)5.351ON73173332600.0
Skud_8.1315.351ON73173332180.0
KAFR0D046705.351ON73173332140.0
KNAG0B045805.351ON72972832030.0
TDEL0E027605.351ON73173331790.0
CAGL0J10824g5.351ON73372531430.0
NDAI0C019705.351ON73173031230.0
NCAS0H016405.351ON72872731200.0
TBLA0A031205.351ON74372830860.0
ZYRO0D10164g5.351ON73273330540.0
SAKL0G08844g5.351ON74673330250.0
KLLA0B10175g5.351ON73173329280.0
KLTH0H14850g5.351ON72672729080.0
Kwal_34.159795.351ON72872528870.0
AGR351W5.351ON72973027540.0
Ecym_81825.351ON73273427410.0
TPHA0A031107.309ON812114840.19
NDAI0D017905.271ON1041108800.68
TBLA0F041106.338ON55880752.2
NCAS0A116003.451ON41588708.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_339.12
         (733 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_339.12 s339 (18976..21177) [2202 bp, 733 aa] {ON} (18976..2...  1530   0.0  
TPHA0E01120 Chr5 complement(230336..232537) [2202 bp, 733 aa] {O...  1314   0.0  
Suva_15.262 Chr15 (440969..443164) [2196 bp, 731 aa] {ON} YHR072...  1269   0.0  
Smik_8.148 Chr8 (215426..217621) [2196 bp, 731 aa] {ON} YHR072W ...  1262   0.0  
YHR072W Chr8 (239098..241293) [2196 bp, 731 aa] {ON}  ERG7Lanost...  1260   0.0  
Skud_8.131 Chr8 (212610..214805) [2196 bp, 731 aa] {ON} YHR072W ...  1244   0.0  
KAFR0D04670 Chr4 (915691..917886) [2196 bp, 731 aa] {ON} Anc_5.3...  1242   0.0  
KNAG0B04580 Chr2 complement(884911..887100) [2190 bp, 729 aa] {O...  1238   0.0  
TDEL0E02760 Chr5 complement(531650..533845) [2196 bp, 731 aa] {O...  1229   0.0  
CAGL0J10824g Chr10 complement(1056204..1058405) [2202 bp, 733 aa...  1215   0.0  
NDAI0C01970 Chr3 complement(442137..444332) [2196 bp, 731 aa] {O...  1207   0.0  
NCAS0H01640 Chr8 complement(313901..316087) [2187 bp, 728 aa] {O...  1206   0.0  
TBLA0A03120 Chr1 (742618..744849) [2232 bp, 743 aa] {ON} Anc_5.3...  1193   0.0  
ZYRO0D10164g Chr4 (854166..856364) [2199 bp, 732 aa] {ON} highly...  1181   0.0  
SAKL0G08844g Chr7 complement(757226..759466) [2241 bp, 746 aa] {...  1169   0.0  
KLLA0B10175g Chr2 (889538..891733) [2196 bp, 731 aa] {ON} highly...  1132   0.0  
KLTH0H14850g Chr8 (1287375..1289555) [2181 bp, 726 aa] {ON} high...  1124   0.0  
Kwal_34.15979 s34 complement(142874..145060) [2187 bp, 728 aa] {...  1116   0.0  
AGR351W Chr7 (1381502..1383691) [2190 bp, 729 aa] {ON} Syntenic ...  1065   0.0  
Ecym_8182 Chr8 complement(379402..381600) [2199 bp, 732 aa] {ON}...  1060   0.0  
TPHA0A03110 Chr1 (684324..686762) [2439 bp, 812 aa] {ON} Anc_7.3...    37   0.19 
NDAI0D01790 Chr4 (415315..418440) [3126 bp, 1041 aa] {ON} Anc_5....    35   0.68 
TBLA0F04110 Chr6 (1018165..1019841) [1677 bp, 558 aa] {ON} Anc_6...    33   2.2  
NCAS0A11600 Chr1 (2302437..2303684) [1248 bp, 415 aa] {ON} Anc_3...    32   8.0  

>Kpol_339.12 s339 (18976..21177) [2202 bp, 733 aa] {ON}
           (18976..21177) [2202 nt, 734 aa]
          Length = 733

 Score = 1530 bits (3961), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 733/733 (100%), Positives = 733/733 (100%)

Query: 1   MVEFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTP 60
           MVEFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTP
Sbjct: 1   MVEFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTP 60

Query: 61  SPLKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGV 120
           SPLKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGV
Sbjct: 61  SPLKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGV 120

Query: 121 KIPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKA 180
           KIPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKA
Sbjct: 121 KIPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKA 180

Query: 181 RDTLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGV 240
           RDTLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGV
Sbjct: 181 RDTLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGV 240

Query: 241 YLPISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVA 300
           YLPISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVA
Sbjct: 241 YLPISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVA 300

Query: 301 NDCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDS 360
           NDCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDS
Sbjct: 301 NDCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDS 360

Query: 361 QAFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAY 420
           QAFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAY
Sbjct: 361 QAFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAY 420

Query: 421 EFLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVH 480
           EFLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVH
Sbjct: 421 EFLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVH 480

Query: 481 DKISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540
           DKISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV
Sbjct: 481 DKISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540

Query: 541 ECTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFA 600
           ECTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFA
Sbjct: 541 ECTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFA 600

Query: 601 MEALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWV 660
           MEALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWV
Sbjct: 601 MEALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWV 660

Query: 661 LVALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 720
           LVALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA
Sbjct: 661 LVALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 720

Query: 721 LGLYTKAYSDNGI 733
           LGLYTKAYSDNGI
Sbjct: 721 LGLYTKAYSDNGI 733

>TPHA0E01120 Chr5 complement(230336..232537) [2202 bp, 733 aa] {ON}
           Anc_5.351 YHR072W
          Length = 733

 Score = 1314 bits (3401), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 614/733 (83%), Positives = 673/733 (91%), Gaps = 3/733 (0%)

Query: 2   VEFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDAD-KDPQSSYTQWLLQVPEFPTP 60
           +EFYSE+IGL KTDPK WRLRTD+LGRESWEYL   + D  D QS+YT+WLLQVP+FP P
Sbjct: 3   IEFYSEQIGLPKTDPKSWRLRTDELGRESWEYLKEGEVDLNDEQSTYTKWLLQVPDFPAP 62

Query: 61  SPLKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGV 120
           +P  NS  ++ N+ A +ACHNGASF+KLLQD  SG+FPCQYKGPMFM IGYIAVNYIAG+
Sbjct: 63  NPAINS--ESANFKAENACHNGASFYKLLQDPTSGMFPCQYKGPMFMAIGYIAVNYIAGI 120

Query: 121 KIPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKA 180
           +IPDHERIE+IRYIVNT+HPVDGGWGLHSVDKSTVFGT LNYVNLRLLGLSKDHPVCVKA
Sbjct: 121 EIPDHERIEMIRYIVNTSHPVDGGWGLHSVDKSTVFGTALNYVNLRLLGLSKDHPVCVKA 180

Query: 181 RDTLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGV 240
           RDTL++LGGAIGAPHWGK WLS LNLYKWEGVNPAPPETWLLPYSL IHPGRWWVHTRGV
Sbjct: 181 RDTLMRLGGAIGAPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGV 240

Query: 241 YLPISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVA 300
           Y+P+SYLSL +Y+CELTPLLAE+R EIYTK F+SIDFS+HRNTVCGVDLYYPHSK+LDVA
Sbjct: 241 YIPVSYLSLTKYTCELTPLLAEIRTEIYTKDFESIDFSKHRNTVCGVDLYYPHSKLLDVA 300

Query: 301 NDCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDS 360
           NDC+VFYE YLRP+WV++KS+++VY+LIKKEIENTDYLCIAPVNQAFCALVTLIEEG++S
Sbjct: 301 NDCLVFYENYLRPEWVYEKSRKSVYELIKKEIENTDYLCIAPVNQAFCALVTLIEEGKNS 360

Query: 361 QAFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAY 420
           + F+RF++R KDALFHGPQGMTVMGTNG QVWDCAF IQY+FVAGLAEKPEFYD I  AY
Sbjct: 361 KQFERFQYRMKDALFHGPQGMTVMGTNGTQVWDCAFFIQYYFVAGLAEKPEFYDAISAAY 420

Query: 421 EFLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVH 480
           +FLCRSQFDTEC PGSFRDKRVGAWGFSTKTQGYTVSDCTAE+IKAIIMVRNS  F  +H
Sbjct: 421 KFLCRSQFDTECEPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPTFAKIH 480

Query: 481 DKISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540
           ++ SDERL KGID+LMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV
Sbjct: 481 NEFSDERLYKGIDILMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540

Query: 541 ECTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFA 600
           ECTDSSVLGLT+FHKH  Y+KEEI+ RIKLAIDYIKSCQQ+DGSWYGCWGICFTYAGMFA
Sbjct: 541 ECTDSSVLGLTYFHKHYDYKKEEISKRIKLAIDYIKSCQQKDGSWYGCWGICFTYAGMFA 600

Query: 601 MEALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWV 660
           MEAL TVGENY NSE VRKGCDFLV KQMEDGGW ESMKSSELH+YV SE+SLVVQTAWV
Sbjct: 601 MEALETVGENYKNSEVVRKGCDFLVKKQMEDGGWSESMKSSELHTYVSSERSLVVQTAWV 660

Query: 661 LVALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 720
           L+ALLLA+YP KDVIDRGIQLLK RQ PSGEWKFE VEGVFNHSCAIEY SYRFLFPIKA
Sbjct: 661 LIALLLAKYPHKDVIDRGIQLLKSRQQPSGEWKFEEVEGVFNHSCAIEYQSYRFLFPIKA 720

Query: 721 LGLYTKAYSDNGI 733
           LGLY K Y ++ I
Sbjct: 721 LGLYVKNYGNDSI 733

>Suva_15.262 Chr15 (440969..443164) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1269 bits (3285), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 597/728 (82%), Positives = 659/728 (90%), Gaps = 2/728 (0%)

Query: 1   MVEFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTP 60
           M EFYSE+IGL KTDP+ WRLRTDKLGRESWEYLTPE A  DP S++TQWLLQ P+FP P
Sbjct: 1   MTEFYSEKIGLPKTDPRRWRLRTDKLGRESWEYLTPEQAANDPPSTFTQWLLQDPDFPQP 60

Query: 61  SPLKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGV 120
            P KN    + +++A+DACHNGASFFKLLQ+ +SGIFPCQYKGPMFMTIGY+AV+YIAG+
Sbjct: 61  HPAKN--KHSPDFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVSYIAGI 118

Query: 121 KIPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKA 180
           +IP+HERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYV LRLLGLSKDHPVCVKA
Sbjct: 119 QIPEHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLSKDHPVCVKA 178

Query: 181 RDTLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGV 240
           RDTL++LGGAIGAPHWGK WLS LNLYKWEGVNPAPPETWLLPYSL IHPGRWWVHTRGV
Sbjct: 179 RDTLLRLGGAIGAPHWGKVWLSALNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGV 238

Query: 241 YLPISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVA 300
           Y+P+SYLSLV++ C +TPLL ELR EIYTKPFD I+FS HRNTVCGVDLYYPHSK+L++A
Sbjct: 239 YIPVSYLSLVKFVCPMTPLLEELRGEIYTKPFDKINFSNHRNTVCGVDLYYPHSKILNIA 298

Query: 301 NDCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDS 360
           N+ +VFYEKYLR ++++  SK  VYDL+KKEIENTD LCIAPVNQAFCALVTLIEEG DS
Sbjct: 299 NNFVVFYEKYLRNRFIYSLSKRKVYDLVKKEIENTDSLCIAPVNQAFCALVTLIEEGVDS 358

Query: 361 QAFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAY 420
           QAFK F++RFKDALFHGPQGMT+MGTNGVQ WDCAFAIQYFF AGLAE+PEF+DTIV AY
Sbjct: 359 QAFKDFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFTAGLAERPEFHDTIVSAY 418

Query: 421 EFLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVH 480
           +FLCRSQFDTECVPGSFRDKR GAWGFSTKTQGYTVSDCTAE+IKAIIMVRNS VF  VH
Sbjct: 419 KFLCRSQFDTECVPGSFRDKRKGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFSDVH 478

Query: 481 DKISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540
             I++ERL +GIDVL++LQN+GSFEYGSFATYEKIKAPL ME LNPAEVFGNIMVEYPYV
Sbjct: 479 HLITNERLFEGIDVLLNLQNVGSFEYGSFATYEKIKAPLAMENLNPAEVFGNIMVEYPYV 538

Query: 541 ECTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFA 600
           ECTDSSVLGLT+FHK   Y+KEEI+  I++AI+YIK  Q  DG WYG WGICFTYAGMFA
Sbjct: 539 ECTDSSVLGLTYFHKFFDYKKEEISTCIRIAIEYIKKSQLPDGGWYGSWGICFTYAGMFA 598

Query: 601 MEALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWV 660
           +EAL+TVGE Y NS TVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSE+SLVVQTAW 
Sbjct: 599 LEALHTVGETYENSSTVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEESLVVQTAWA 658

Query: 661 LVALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 720
           L+ALL AEYP ++VIDRGI+LLK RQ  SGEWKFE VEGVFNHSCAIEYPSYRFLFPIKA
Sbjct: 659 LIALLFAEYPRREVIDRGIELLKHRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKA 718

Query: 721 LGLYTKAY 728
           LG+YTKAY
Sbjct: 719 LGMYTKAY 726

>Smik_8.148 Chr8 (215426..217621) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1262 bits (3266), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 584/733 (79%), Positives = 662/733 (90%), Gaps = 2/733 (0%)

Query: 1   MVEFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTP 60
           M EFYSE IGL KTDP+LWRLRTD++GRESWEYLT E A  +P S++TQWLLQ PEFP P
Sbjct: 1   MTEFYSETIGLPKTDPRLWRLRTDEIGRESWEYLTSEQAANEPPSTFTQWLLQDPEFPHP 60

Query: 61  SPLKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGV 120
            P +N    + N++A+DACHNGASFFKLLQ+ +SGIFPCQYKGPMFMTIGY+AVNYIAG+
Sbjct: 61  QPERN--KHSPNFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGI 118

Query: 121 KIPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKA 180
           +IP+HERIE+IRYIVNTAHPVDGGWGLHSVDKSTVFGT LNYV LRLLGL KDHPVCVK+
Sbjct: 119 QIPEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTALNYVILRLLGLPKDHPVCVKS 178

Query: 181 RDTLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGV 240
           R+TL++LGGA+G+PHWGK WLS LNLY+WEGVNPAPPETWLLPYSL +HPGRWWVHTR V
Sbjct: 179 RNTLLRLGGALGSPHWGKIWLSALNLYRWEGVNPAPPETWLLPYSLPMHPGRWWVHTRAV 238

Query: 241 YLPISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVA 300
           Y+P+SYLSLV+++C +TPLL ELREEIYTKPFD I FS+HRNTVCGVDLYYPHSK L++A
Sbjct: 239 YIPVSYLSLVKFTCPMTPLLEELREEIYTKPFDKIKFSKHRNTVCGVDLYYPHSKTLNIA 298

Query: 301 NDCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDS 360
           N+ +VFYEKYLR ++++  SK  VYDL++KEI+NTD LCIAPVNQAFCALVTLIEEG DS
Sbjct: 299 NNFVVFYEKYLRNRFIYSLSKRKVYDLVRKEIQNTDSLCIAPVNQAFCALVTLIEEGVDS 358

Query: 361 QAFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAY 420
           QAFK+F++RFKDALFHGPQGMT+MGTNGVQ WDCAFAIQY F+AGLAE+ EFY+TIV AY
Sbjct: 359 QAFKKFQYRFKDALFHGPQGMTIMGTNGVQSWDCAFAIQYLFIAGLAERSEFYNTIVSAY 418

Query: 421 EFLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVH 480
           +FLCR+QFDTECVPGSFRDKR GAWGFSTKTQGY VSDCTAEAIKAIIMV+NS VF  VH
Sbjct: 419 KFLCRAQFDTECVPGSFRDKRKGAWGFSTKTQGYVVSDCTAEAIKAIIMVKNSPVFTEVH 478

Query: 481 DKISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540
           + IS+ERL +GIDVL++LQN+GSFEYGSFATYEKIKAPL ME LNPAEVFGNIMVEYPYV
Sbjct: 479 NMISNERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYV 538

Query: 541 ECTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFA 600
           ECTDSSVLGLT+FHK+  Y+KEEI  RI++AI++IK  Q  +GSWYG WGICFTYAGMFA
Sbjct: 539 ECTDSSVLGLTYFHKYFDYKKEEIRARIRIAIEFIKKSQLPNGSWYGSWGICFTYAGMFA 598

Query: 601 MEALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWV 660
           +EAL+TVGE Y NS TVRKGCDFLVSKQM+DGGWGESMKSSELHSYVDSEKSLVVQTAWV
Sbjct: 599 LEALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWV 658

Query: 661 LVALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 720
           L+ALL AEYP KDVIDRGI+LLK+RQ  SGEWKFE VEGVFNHSCAIEYPSYRFLFPIKA
Sbjct: 659 LIALLFAEYPGKDVIDRGIELLKNRQEESGEWKFEGVEGVFNHSCAIEYPSYRFLFPIKA 718

Query: 721 LGLYTKAYSDNGI 733
           LG+Y+KAY  + +
Sbjct: 719 LGMYSKAYEQHAL 731

>YHR072W Chr8 (239098..241293) [2196 bp, 731 aa] {ON}
           ERG7Lanosterol synthase, an essential enzyme that
           catalyzes the cyclization of squalene 2,3-epoxide, a
           step in ergosterol biosynthesis
          Length = 731

 Score = 1260 bits (3260), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 585/733 (79%), Positives = 660/733 (90%), Gaps = 2/733 (0%)

Query: 1   MVEFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTP 60
           M EFYS+ IGL KTDP+LWRLRTD+LGRESWEYLTP+ A  DP S++TQWLLQ P+FP P
Sbjct: 1   MTEFYSDTIGLPKTDPRLWRLRTDELGRESWEYLTPQQAANDPPSTFTQWLLQDPKFPQP 60

Query: 61  SPLKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGV 120
            P +N    + +++A+DACHNGASFFKLLQ+ +SGIFPCQYKGPMFMTIGY+AVNYIAG+
Sbjct: 61  HPERN--KHSPDFSAFDACHNGASFFKLLQEPDSGIFPCQYKGPMFMTIGYVAVNYIAGI 118

Query: 121 KIPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKA 180
           +IP+HERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYV LRLLGL KDHPVC KA
Sbjct: 119 EIPEHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCAKA 178

Query: 181 RDTLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGV 240
           R TL++LGGAIG+PHWGK WLS LNLYKWEGVNPAPPETWLLPYSL +HPGRWWVHTRGV
Sbjct: 179 RSTLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGV 238

Query: 241 YLPISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVA 300
           Y+P+SYLSLV++SC +TPLL ELR EIYTKPFD I+FS++RNTVCGVDLYYPHS  L++A
Sbjct: 239 YIPVSYLSLVKFSCPMTPLLEELRNEIYTKPFDKINFSKNRNTVCGVDLYYPHSTTLNIA 298

Query: 301 NDCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDS 360
           N  +VFYEKYLR ++++  SK+ VYDLIK E++NTD LCIAPVNQAFCALVTLIEEG DS
Sbjct: 299 NSLVVFYEKYLRNRFIYSLSKKKVYDLIKTELQNTDSLCIAPVNQAFCALVTLIEEGVDS 358

Query: 361 QAFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAY 420
           +AF+R ++RFKDALFHGPQGMT+MGTNGVQ WDCAFAIQYFFVAGLAE+PEFY+TIV AY
Sbjct: 359 EAFQRLQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFVAGLAERPEFYNTIVSAY 418

Query: 421 EFLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVH 480
           +FLC +QFDTECVPGS+RDKR GAWGFSTKTQGYTV+DCTAEAIKAIIMV+NS VF  VH
Sbjct: 419 KFLCHAQFDTECVPGSYRDKRKGAWGFSTKTQGYTVADCTAEAIKAIIMVKNSPVFSEVH 478

Query: 481 DKISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540
             IS ERL +GIDVL++LQN+GSFEYGSFATYEKIKAPL ME LNPAEVFGNIMVEYPYV
Sbjct: 479 HMISSERLFEGIDVLLNLQNIGSFEYGSFATYEKIKAPLAMETLNPAEVFGNIMVEYPYV 538

Query: 541 ECTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFA 600
           ECTDSSVLGLT+FHK+  YRKEEI  RI++AI++IK  Q  DGSWYG WGICFTYAGMFA
Sbjct: 539 ECTDSSVLGLTYFHKYFDYRKEEIRTRIRIAIEFIKKSQLPDGSWYGSWGICFTYAGMFA 598

Query: 601 MEALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWV 660
           +EAL+TVGE Y NS TVRKGCDFLVSKQM+DGGWGESMKSSELHSYVDSEKSLVVQTAW 
Sbjct: 599 LEALHTVGETYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSEKSLVVQTAWA 658

Query: 661 LVALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 720
           L+ALL AEYP+K+VIDRGI LLK+RQ  SGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA
Sbjct: 659 LIALLFAEYPNKEVIDRGIDLLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 718

Query: 721 LGLYTKAYSDNGI 733
           LG+Y++AY  + +
Sbjct: 719 LGMYSRAYETHTL 731

>Skud_8.131 Chr8 (212610..214805) [2196 bp, 731 aa] {ON} YHR072W
           (REAL)
          Length = 731

 Score = 1244 bits (3218), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 588/733 (80%), Positives = 657/733 (89%), Gaps = 2/733 (0%)

Query: 1   MVEFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTP 60
           M EFYSE IGL KTDP+LWRLRTD+LGRESWEYLTPE A  +P S++TQWLLQ P F  P
Sbjct: 1   MTEFYSERIGLPKTDPRLWRLRTDELGRESWEYLTPEQAANEPPSTFTQWLLQDPNFSQP 60

Query: 61  SPLKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGV 120
            P +N    + +++A+DACHNGASFF+LLQD  SGIFPCQYKGPMF+TIGY+AVNYIAGV
Sbjct: 61  QPGRN--KHSPDFSAFDACHNGASFFQLLQDPKSGIFPCQYKGPMFLTIGYVAVNYIAGV 118

Query: 121 KIPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKA 180
           +IP+HERIE+IRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYV LRLLGL KDHPVC KA
Sbjct: 119 QIPEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKDHPVCTKA 178

Query: 181 RDTLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGV 240
           R TL++LGGAIG+PHWGK WLS LNLYKWEGVNPAPPETWLLPYSL +HPGRWWVHTRGV
Sbjct: 179 RGTLLRLGGAIGSPHWGKIWLSALNLYKWEGVNPAPPETWLLPYSLPMHPGRWWVHTRGV 238

Query: 241 YLPISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVA 300
           Y+P+SYLSLV++SC +TPLL E+R+EIYTKPFD IDFS HRNTVCGVDLYYPHS+ LD+A
Sbjct: 239 YIPVSYLSLVKFSCPMTPLLEEIRKEIYTKPFDKIDFSNHRNTVCGVDLYYPHSRTLDIA 298

Query: 301 NDCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDS 360
           N+ +VFYEKYLR ++++  SK  VYDLIK EIENTD LCIAPVNQAFCALVT IEEG DS
Sbjct: 299 NNFVVFYEKYLRNRFIYSLSKRKVYDLIKTEIENTDSLCIAPVNQAFCALVTFIEEGVDS 358

Query: 361 QAFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAY 420
           QAFK+F++RFKDALFHGPQGMT+MGTNGVQ WDCAFAIQYFF+AGLAE+PEFY+TIV AY
Sbjct: 359 QAFKKFQYRFKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFIAGLAERPEFYNTIVSAY 418

Query: 421 EFLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVH 480
           +FLCR+QFDTECVPGSFR+KR G+WGFSTKTQGYTV+DCTAE+IKAIIMV+NS VF  VH
Sbjct: 419 KFLCRAQFDTECVPGSFREKRKGSWGFSTKTQGYTVADCTAESIKAIIMVKNSPVFSEVH 478

Query: 481 DKISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540
             I+ ERL +GIDVL+SLQN+GSFEYGSFATYEKIKAPL ME LNPAEVFGNIMVEYPYV
Sbjct: 479 HLITSERLFEGIDVLLSLQNVGSFEYGSFATYEKIKAPLAMEILNPAEVFGNIMVEYPYV 538

Query: 541 ECTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFA 600
           ECTDSSVLGLT+FHK   Y+KEEI  RI++AI+YIK  Q  DGSWYG WGICFTYAGMFA
Sbjct: 539 ECTDSSVLGLTYFHKFFDYKKEEIRRRIRIAIEYIKRAQSPDGSWYGSWGICFTYAGMFA 598

Query: 601 MEALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWV 660
           MEAL+TVGENY NS TVRKGCDFLVSKQM+DGGWGESMKSSELHSYVDS KSLVVQ+AW 
Sbjct: 599 MEALHTVGENYENSSTVRKGCDFLVSKQMKDGGWGESMKSSELHSYVDSGKSLVVQSAWA 658

Query: 661 LVALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 720
           L+AL  AEYP+K+VIDRGI+LLK+RQ  SGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA
Sbjct: 659 LIALFFAEYPNKEVIDRGIELLKNRQEESGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 718

Query: 721 LGLYTKAYSDNGI 733
           LG+Y KAY   G+
Sbjct: 719 LGMYAKAYEQPGL 731

>KAFR0D04670 Chr4 (915691..917886) [2196 bp, 731 aa] {ON} Anc_5.351
           YHR072W
          Length = 731

 Score = 1242 bits (3214), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 573/733 (78%), Positives = 652/733 (88%), Gaps = 2/733 (0%)

Query: 1   MVEFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTP 60
           M  FYS+E+GLEKTDP+LWRLRTD LGR++W+Y+   DA+ DPQ+++ QWLLQ+P FP+P
Sbjct: 1   MTTFYSDEVGLEKTDPRLWRLRTDDLGRQTWDYIDQLDAESDPQTTFVQWLLQLPGFPSP 60

Query: 61  SPLKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGV 120
           +P  +  N ++++TA DAC+NGA+FFKLLQD NSGIFPCQYKGPMFMTIGY+AVNYIAG+
Sbjct: 61  NP--DIKNGDDSFTAKDACYNGATFFKLLQDGNSGIFPCQYKGPMFMTIGYVAVNYIAGI 118

Query: 121 KIPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKA 180
           +IP+HE+IELIRYIVNTAHPVDGGWGLHSVDKST FGT +NYV LRLLGLSK H VCV+A
Sbjct: 119 EIPEHEKIELIRYIVNTAHPVDGGWGLHSVDKSTAFGTAINYVILRLLGLSKHHTVCVRA 178

Query: 181 RDTLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGV 240
           RDTL++LGGAIG PHWGK WLS LNLY WEGVNPAPPETWLLPY L IHPGRWWVHTRGV
Sbjct: 179 RDTLLRLGGAIGVPHWGKIWLSVLNLYSWEGVNPAPPETWLLPYYLPIHPGRWWVHTRGV 238

Query: 241 YLPISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVA 300
           YLPISYLSLVRYS E TPLL E+R+EIY KPFD I+FS+HRNTVCGVDLYYPHS +LD A
Sbjct: 239 YLPISYLSLVRYSTECTPLLEEIRKEIYVKPFDDINFSQHRNTVCGVDLYYPHSTLLDTA 298

Query: 301 NDCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDS 360
           N  IV YEK+LRP W+ +KS++ +Y+LI+KE +NTDYLCIAPVNQAFCAL TLIEEG +S
Sbjct: 299 NKAIVLYEKFLRPTWLAEKSRKAIYELIEKEAQNTDYLCIAPVNQAFCALATLIEEGVES 358

Query: 361 QAFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAY 420
           + F++++ RFKDALFHGPQGMTV GTNGVQ WDCAFAIQY F+AGLAE+PEFYD +  A+
Sbjct: 359 KPFRKYQERFKDALFHGPQGMTVTGTNGVQTWDCAFAIQYLFIAGLAEQPEFYDAVSAAF 418

Query: 421 EFLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVH 480
           +FLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAE+IKAIIMVRNS VF  +H
Sbjct: 419 KFLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSPVFAKIH 478

Query: 481 DKISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540
           D+I+DERL KGID+L+ LQN+GSFE+GSFATYEKIKAPL +E LNPAEVFGNIMVEYPYV
Sbjct: 479 DEITDERLCKGIDILLDLQNMGSFEFGSFATYEKIKAPLILEKLNPAEVFGNIMVEYPYV 538

Query: 541 ECTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFA 600
           ECTDSSVLGLT+FH+H  YR EEI++RI+LAI YIK+ QQ+DGSWYG WGICFTYAGMFA
Sbjct: 539 ECTDSSVLGLTYFHRHYKYRHEEISDRIQLAIRYIKNAQQDDGSWYGSWGICFTYAGMFA 598

Query: 601 MEALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWV 660
           MEAL +VGE Y NS+ V KGCDFLVSKQM DGGW ESMKSSELH+YV +++SLVVQTAWV
Sbjct: 599 MEALQSVGELYENSDAVHKGCDFLVSKQMPDGGWSESMKSSELHTYVSTKESLVVQTAWV 658

Query: 661 LVALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 720
           L+ALLLA+YPDK VIDRGI LLK RQ PSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA
Sbjct: 659 LIALLLAKYPDKQVIDRGISLLKSRQEPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 718

Query: 721 LGLYTKAYSDNGI 733
           LGLY K Y   GI
Sbjct: 719 LGLYVKEYGAQGI 731

>KNAG0B04580 Chr2 complement(884911..887100) [2190 bp, 729 aa] {ON}
           Anc_5.351 YHR072W
          Length = 729

 Score = 1238 bits (3203), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 577/728 (79%), Positives = 648/728 (89%), Gaps = 7/728 (0%)

Query: 2   VEFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTPS 61
           +  YSE++GL +TDPK WRLRTD+LGRE+W+Y+  +  + DPQSS+TQWLLQ+ +  T +
Sbjct: 4   IVLYSEQLGLPRTDPKRWRLRTDELGRETWDYIPEDQCEMDPQSSFTQWLLQIRDTETSA 63

Query: 62  PLKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGVK 121
           P        E  TA+D+C NGA+FFK LQD +SG+FPCQYKGPMFMTIGYIAVNYIAG++
Sbjct: 64  P-------KEPVTAFDSCINGANFFKSLQDPHSGMFPCQYKGPMFMTIGYIAVNYIAGIE 116

Query: 122 IPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKAR 181
           IP HER+E+IRYIVNT+HPVDGGWGLHSVDKSTVFGTVLNYV LRLLGL +DHPVC+KAR
Sbjct: 117 IPKHERLEIIRYIVNTSHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLQRDHPVCLKAR 176

Query: 182 DTLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGVY 241
           DTL++LGGAIGAPHWGK WLS LNLYKWEGVNPAPPETWLLPY L IHPG+WWVHTRGVY
Sbjct: 177 DTLLRLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYELPIHPGKWWVHTRGVY 236

Query: 242 LPISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVAN 301
           LPISYLSLV YSCELTPLL E+R EIYTKPFDSIDFS+HRNTVCGVDLYYPHSKVLD+AN
Sbjct: 237 LPISYLSLVHYSCELTPLLEEIRGEIYTKPFDSIDFSKHRNTVCGVDLYYPHSKVLDMAN 296

Query: 302 DCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDSQ 361
           + I+FYEKYLRP W++ KSK  VY LI+KEI+NTDYLCIAPVNQAFCALVTLIEEG DS+
Sbjct: 297 NAIIFYEKYLRPAWIYKKSKAKVYSLIQKEIQNTDYLCIAPVNQAFCALVTLIEEGVDSE 356

Query: 362 AFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAYE 421
           AF +F  RFKDALFHGPQGMTVMGTNGVQ WDCAFA+QYFFVAGLAE+PEFY+ IV AY 
Sbjct: 357 AFTKFRTRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFVAGLAERPEFYNFIVAAYR 416

Query: 422 FLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVHD 481
           FL RSQFDTECVPGSFRDKR G+WGFSTKTQGYTVSDCTAEAIKAIIMV+N+  F  VHD
Sbjct: 417 FLIRSQFDTECVPGSFRDKRKGSWGFSTKTQGYTVSDCTAEAIKAIIMVKNAPQFSDVHD 476

Query: 482 KISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVE 541
           +I D RL +GIDVL+SLQN GSFEYGSFATYEKIKAPL ME LNPAEVFGNIM+EYPYVE
Sbjct: 477 EIEDSRLYEGIDVLLSLQNTGSFEYGSFATYEKIKAPLIMEKLNPAEVFGNIMIEYPYVE 536

Query: 542 CTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFAM 601
           CTDSSVLGLTFFHK+  YR EEI+ RI++AI+Y+K  Q+ DGSWYGCWGIC+TYAGMFA+
Sbjct: 537 CTDSSVLGLTFFHKYYKYRTEEISERIRIAIEYLKRAQEPDGSWYGCWGICYTYAGMFAL 596

Query: 602 EALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWVL 661
           EAL++V ENY+NS  VRKGCDFLVSKQ+ DGGWGESMKSSELHSYV + +SLVVQTAW +
Sbjct: 597 EALHSVEENYANSAIVRKGCDFLVSKQLIDGGWGESMKSSELHSYVSTPESLVVQTAWAV 656

Query: 662 VALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKAL 721
           +ALLLAEYPDK VI+RGI+LL+ RQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKAL
Sbjct: 657 IALLLAEYPDKKVIERGIELLRSRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKAL 716

Query: 722 GLYTKAYS 729
           GLY K Y+
Sbjct: 717 GLYNKTYA 724

>TDEL0E02760 Chr5 complement(531650..533845) [2196 bp, 731 aa] {ON}
           Anc_5.351 YHR072W
          Length = 731

 Score = 1229 bits (3179), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 575/733 (78%), Positives = 644/733 (87%), Gaps = 2/733 (0%)

Query: 1   MVEFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTP 60
           MV+FYSEE+GLE+TDP LWRLRTD+LGRE+W YLTPE A  D Q ++TQWLLQ  +FP P
Sbjct: 1   MVQFYSEELGLERTDPDLWRLRTDELGRETWVYLTPEQAKNDEQCTFTQWLLQSEKFPKP 60

Query: 61  SPLKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGV 120
           SP  N  +   ++ A DAC NGASFFKLLQD  SGIFPCQYKGPMF+TIGY+AV+YI+G 
Sbjct: 61  SP--NRHSGTTDFKAADACENGASFFKLLQDPRSGIFPCQYKGPMFLTIGYVAVHYISGT 118

Query: 121 KIPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKA 180
            IP+HERIE+IRYIVNTAHPVDGGWGLHSVDKST FGTV+NYV LRLLGL KDHPVC+KA
Sbjct: 119 TIPEHERIEIIRYIVNTAHPVDGGWGLHSVDKSTAFGTVVNYVILRLLGLPKDHPVCLKA 178

Query: 181 RDTLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGV 240
           R  L+KLGGAIGAPHWGK WLS LNLYKWEGVNPAPPE WLLPY+L IHPGRWWVHTR +
Sbjct: 179 RALLMKLGGAIGAPHWGKIWLSVLNLYKWEGVNPAPPEMWLLPYALPIHPGRWWVHTRAI 238

Query: 241 YLPISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVA 300
           YLP+SYLSL+RYSC L  LL ELR EIY KPFDSI+FS +RNTVCG+DLYYPH+ VL++A
Sbjct: 239 YLPVSYLSLIRYSCPLNDLLRELRSEIYVKPFDSINFSSNRNTVCGIDLYYPHTTVLNMA 298

Query: 301 NDCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDS 360
           N+ +VFYEK+LRP W+  K+K+ VY LIKKEI NTDYLCIAPVNQAFCALVT IEEG++S
Sbjct: 299 NNVMVFYEKHLRPNWLGKKAKDRVYGLIKKEIANTDYLCIAPVNQAFCALVTYIEEGKES 358

Query: 361 QAFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAY 420
            AFK+FE R KDALFHGPQGMT+MGTNGVQ WDCAFAIQYFFVAGLAEKPE+YDTI  AY
Sbjct: 359 SAFKKFEDRLKDALFHGPQGMTIMGTNGVQTWDCAFAIQYFFVAGLAEKPEYYDTICAAY 418

Query: 421 EFLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVH 480
           +FLCR+QFDTECV GSFRDKRVGAW FSTK QGYTVSDCTAEAIKAIIMVRNS  F ++ 
Sbjct: 419 KFLCRTQFDTECVEGSFRDKRVGAWPFSTKAQGYTVSDCTAEAIKAIIMVRNSPKFASIR 478

Query: 481 DKISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540
           ++I+DERL KGIDVL+SLQN+ SFEYGSFATYEKIKAPL ME LNPAEVFGNIMVE+PYV
Sbjct: 479 NEITDERLCKGIDVLLSLQNITSFEYGSFATYEKIKAPLSMEKLNPAEVFGNIMVEFPYV 538

Query: 541 ECTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFA 600
           ECTDSSVLGLT+FH    YRKEEI+ RIKLAIDYIK  Q EDGSWYGCWG+C++YAGMFA
Sbjct: 539 ECTDSSVLGLTYFHTFYDYRKEEISKRIKLAIDYIKRDQDEDGSWYGCWGVCYSYAGMFA 598

Query: 601 MEALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWV 660
           MEAL++VGENYSNSE VRKGCDFLVS+Q+ DGGWGESMKSSELHSYV + +SLVVQTAWV
Sbjct: 599 MEALHSVGENYSNSEYVRKGCDFLVSRQISDGGWGESMKSSELHSYVSTRESLVVQTAWV 658

Query: 661 LVALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 720
           L+ALLL +YP+K VID GI+LLK RQL +GEWKFE +EGVFNHSCAIEYPSYRFLFPIKA
Sbjct: 659 LIALLLGKYPNKSVIDAGIKLLKKRQLETGEWKFEGIEGVFNHSCAIEYPSYRFLFPIKA 718

Query: 721 LGLYTKAYSDNGI 733
           LGLYT  Y D+ I
Sbjct: 719 LGLYTATYGDDSI 731

>CAGL0J10824g Chr10 complement(1056204..1058405) [2202 bp, 733 aa]
           {ON} highly similar to uniprot|P38604 Saccharomyces
           cerevisiae YHR072w ERG7 lanosterol synthase
          Length = 733

 Score = 1215 bits (3143), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 579/725 (79%), Positives = 646/725 (89%), Gaps = 4/725 (0%)

Query: 1   MVEFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTP 60
           M +FYS+ +G+ +TDPK WRLRT +LGRE+WEY+  +  D DPQS++ QWLLQ  EFPTP
Sbjct: 1   MTQFYSDTVGIPRTDPKRWRLRTTELGREAWEYIEQDKVDADPQSTFVQWLLQDEEFPTP 60

Query: 61  SPLKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGV 120
           SP K    + ++ ++  AC+ GASF+KLLQD+ SGIFPCQYKGPMFMTIGY+AVNYIAGV
Sbjct: 61  SPRK----EGDDLSSEQACYYGASFYKLLQDQKSGIFPCQYKGPMFMTIGYVAVNYIAGV 116

Query: 121 KIPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKA 180
           K+P+HERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYV LRLLGL KDH VCV+A
Sbjct: 117 KLPEHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVCLRLLGLPKDHIVCVRA 176

Query: 181 RDTLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGV 240
           R TL +LGGA GAPHWGK WLS LNLYKWEGVNPAPPETWLLPYSL IHPGRWWVHTR V
Sbjct: 177 RHTLHRLGGATGAPHWGKIWLSILNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRAV 236

Query: 241 YLPISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVA 300
           YLP+SYLSL++YSC LT LL+E+R+EIYTK FD I+FS+HRNTVCGVDLYYPHSK+LD A
Sbjct: 237 YLPVSYLSLIKYSCPLTDLLSEIRQEIYTKSFDKINFSQHRNTVCGVDLYYPHSKILDTA 296

Query: 301 NDCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDS 360
           ND IVFYEKYLRP+ V   SK+ VY+LIKKEI+NTD LCIAPVNQAFCALVT +EEG+DS
Sbjct: 297 NDVIVFYEKYLRPRLVSMASKKVVYNLIKKEIQNTDSLCIAPVNQAFCALVTYLEEGKDS 356

Query: 361 QAFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAY 420
           +AF+RF++RFKD LFHGPQGMTVMGTNGVQ WDCAF IQYFFVAGLAEKPEF + I+ AY
Sbjct: 357 KAFERFQYRFKDGLFHGPQGMTVMGTNGVQTWDCAFMIQYFFVAGLAEKPEFREMIINAY 416

Query: 421 EFLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVH 480
           +FLCRSQFDTECV GSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNS VF +VH
Sbjct: 417 KFLCRSQFDTECVEGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSPVFSSVH 476

Query: 481 DKISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540
           D+I+DERL KGIDVL+SLQN+G FEYGSFATYEKIKAPL ME LNPAEVFGNIMVEYPYV
Sbjct: 477 DEITDERLCKGIDVLLSLQNIGKFEYGSFATYEKIKAPLSMEKLNPAEVFGNIMVEYPYV 536

Query: 541 ECTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFA 600
           ECTDSSVLGLT+FHK+  YRK+EI++RI++AIDYIK  QQ+DG WYGCWGICFTYAGMFA
Sbjct: 537 ECTDSSVLGLTYFHKYYDYRKDEISHRIRIAIDYIKQAQQDDGGWYGCWGICFTYAGMFA 596

Query: 601 MEALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWV 660
           MEAL++VGE Y NS TVRKGCDFL+SKQM DGGWGESMKSSELH YVDS KSLVVQTAW 
Sbjct: 597 MEALHSVGETYDNSLTVRKGCDFLLSKQMPDGGWGESMKSSELHDYVDSPKSLVVQTAWA 656

Query: 661 LVALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 720
           L+ALLLA+ P++D I+RGI LLK RQ PSGEWKFES EGVFNHSCAIEYPSYRFLFPIKA
Sbjct: 657 LIALLLAKCPNEDAIERGINLLKSRQQPSGEWKFESAEGVFNHSCAIEYPSYRFLFPIKA 716

Query: 721 LGLYT 725
           LGLY 
Sbjct: 717 LGLYN 721

>NDAI0C01970 Chr3 complement(442137..444332) [2196 bp, 731 aa] {ON}
           Anc_5.351 YHR072W
          Length = 731

 Score = 1207 bits (3123), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 564/730 (77%), Positives = 641/730 (87%), Gaps = 4/730 (0%)

Query: 3   EFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTPSP 62
           + YSEE+GLEKTDP LWRLRT+  GR+SWEY+T + +  DPQS++T+WLLQ+P+FPTP  
Sbjct: 4   KLYSEELGLEKTDPLLWRLRTNIDGRQSWEYITKDQSPNDPQSNFTKWLLQLPDFPTPQY 63

Query: 63  LKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGVKI 122
             N     ++ +A   C  GA FF+LLQDE SG FPCQYKGPMFMTIGY+AVNY+A +KI
Sbjct: 64  PDNI----KDVSAEAICLKGAKFFRLLQDETSGTFPCQYKGPMFMTIGYVAVNYVADIKI 119

Query: 123 PDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKARD 182
           P+ ERIE+IRYIVNTAHPVDGGWGLHS DKSTVFGTVLNY+ LRLLGL  +HPVC+KARD
Sbjct: 120 PESERIEIIRYIVNTAHPVDGGWGLHSEDKSTVFGTVLNYIILRLLGLDANHPVCMKARD 179

Query: 183 TLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGVYL 242
           TL++LGGAI APHWGK WLS LNLYKWEGVNPAPPETWLLPY + IHPGRWWVHTRGVYL
Sbjct: 180 TLLRLGGAISAPHWGKVWLSVLNLYKWEGVNPAPPETWLLPYWMPIHPGRWWVHTRGVYL 239

Query: 243 PISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVAND 302
           PISYLSLV Y CELT LL E+R EIY KPFDSIDFS+HRNTVCGVDLYYPHSK LD AN 
Sbjct: 240 PISYLSLVHYQCELTDLLKEIRSEIYVKPFDSIDFSKHRNTVCGVDLYYPHSKTLDFANS 299

Query: 303 CIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDSQA 362
            IV YEKYLRP  + D SK  VYDLIKKEIENTDYLCIAPVNQAFCALVTL+EEG DS+A
Sbjct: 300 LIVPYEKYLRPNALRDYSKHKVYDLIKKEIENTDYLCIAPVNQAFCALVTLLEEGADSKA 359

Query: 363 FKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAYEF 422
           F+RF++RFKDALF GPQGMTVMGTNGVQ WDCAFAIQY FVAGLA++PEFY+TI  AY+F
Sbjct: 360 FERFQYRFKDALFLGPQGMTVMGTNGVQTWDCAFAIQYLFVAGLAKRPEFYNTISNAYKF 419

Query: 423 LCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVHDK 482
           LCRSQFDT+CV GSFRDKR GAWGFSTKTQGYTVSDCTAE+IKAIIMVRNS +F+ +HD+
Sbjct: 420 LCRSQFDTDCVTGSFRDKRDGAWGFSTKTQGYTVSDCTAESIKAIIMVRNSVIFKDIHDE 479

Query: 483 ISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVEC 542
           ISDERL K +D+L+ LQN GSFE+GSFATYEKIKAPLF+EALNPAEVFGNIMVEYPYVEC
Sbjct: 480 ISDERLYKAVDILLDLQNTGSFEFGSFATYEKIKAPLFLEALNPAEVFGNIMVEYPYVEC 539

Query: 543 TDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFAME 602
           TDSSVLGLT FHKH +YRK+EI+ RI +AI+YIK  Q++DGSWYG WGIC+TYAGMFAME
Sbjct: 540 TDSSVLGLTSFHKHYNYRKDEISKRINIAIEYIKKVQEDDGSWYGSWGICYTYAGMFAME 599

Query: 603 ALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWVLV 662
           AL++VGE Y NS  V+KGCDFLV++Q+EDGGWGESMKSSELH+YV +++SLVVQTAWV++
Sbjct: 600 ALHSVGETYGNSFVVKKGCDFLVARQLEDGGWGESMKSSELHTYVSTKESLVVQTAWVVL 659

Query: 663 ALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALG 722
           ALLLA+YP+K++ID+GI LLK RQ  SGEWKFES EGVFNHSCAIEYPSYRFLFPIKALG
Sbjct: 660 ALLLAQYPNKNIIDKGIALLKKRQQVSGEWKFESPEGVFNHSCAIEYPSYRFLFPIKALG 719

Query: 723 LYTKAYSDNG 732
           LY++ Y  N 
Sbjct: 720 LYSQIYEHNA 729

>NCAS0H01640 Chr8 complement(313901..316087) [2187 bp, 728 aa] {ON}
           Anc_5.351 YHR072W
          Length = 728

 Score = 1206 bits (3120), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 562/727 (77%), Positives = 641/727 (88%), Gaps = 6/727 (0%)

Query: 3   EFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTPSP 62
           + YS+E+GL+KTDP  WRLRT+ LGR +WEY+  E    DPQS++T+WLLQ+P+FP P+P
Sbjct: 4   KLYSDELGLQKTDPTRWRLRTNPLGRHTWEYINSEQKTNDPQSTFTKWLLQLPDFPAPTP 63

Query: 63  LKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGVKI 122
                   E  TA +AC++GASFF+LLQD+ SG FPCQYKGPMFMTIGY+AVNYIAG++I
Sbjct: 64  -----TTEEPRTAREACYDGASFFRLLQDKESGTFPCQYKGPMFMTIGYVAVNYIAGLEI 118

Query: 123 PDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKARD 182
           P+HERIE+IRY+VNTAHPVDGGWGLHS DKSTVFGTV+NYV LRLLG+SKDH VC +AR 
Sbjct: 119 PNHERIEIIRYLVNTAHPVDGGWGLHSTDKSTVFGTVINYVILRLLGMSKDHIVCRRARK 178

Query: 183 TLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGVYL 242
           TL+ LGGAIGAPHWGK WLS LNLYKWEGVNPAPPETWLLPY L IHPGRWWVHTRGVYL
Sbjct: 179 TLLSLGGAIGAPHWGKVWLSVLNLYKWEGVNPAPPETWLLPYCLPIHPGRWWVHTRGVYL 238

Query: 243 PISYLSLVRYSCELTPLLAELREEIYT-KPFDSIDFSRHRNTVCGVDLYYPHSKVLDVAN 301
           PISYLSLV +SCELTPLL E+REEIYT +PF++I F+++RN VCGVDLYYPHS+VLDVAN
Sbjct: 239 PISYLSLVHFSCELTPLLKEIREEIYTAQPFEAIKFAQNRNNVCGVDLYYPHSQVLDVAN 298

Query: 302 DCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDSQ 361
            CIV YE+YLRP W+   SK  VY+LIKKEI NTDYLCIAPVNQAFCALVTLIEEG DS 
Sbjct: 299 ACIVKYEEYLRPTWLKKLSKRKVYELIKKEISNTDYLCIAPVNQAFCALVTLIEEGVDSN 358

Query: 362 AFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAYE 421
           AF++F +RFKD+LFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEK EFYDTI  AY 
Sbjct: 359 AFQKFSYRFKDSLFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKSEFYDTIASAYA 418

Query: 422 FLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVHD 481
           FLCRSQFDTECV GSFRDKRVG+WGFSTKTQGYTVSDCTAE+IKAIIMV+NS VF+A+H 
Sbjct: 419 FLCRSQFDTECVRGSFRDKRVGSWGFSTKTQGYTVSDCTAESIKAIIMVKNSPVFKAIHH 478

Query: 482 KISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVE 541
            I+DE++ +GIDVL+SLQN+GSFEYGSFATYEKIKAPLF+E LNPAEVFGNIMVEYPYVE
Sbjct: 479 LITDEKIYQGIDVLLSLQNVGSFEYGSFATYEKIKAPLFLEKLNPAEVFGNIMVEYPYVE 538

Query: 542 CTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFAM 601
           CTDSSVLGLT+FH + +YR  EI+ RIK+A+DYIK  Q  DGSWYG WGIC+TYAGMFAM
Sbjct: 539 CTDSSVLGLTYFHNYYNYRGNEISQRIKVAVDYIKHLQASDGSWYGSWGICYTYAGMFAM 598

Query: 602 EALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWVL 661
           EAL++VGE Y+NS  V+KGCDFLV++QM DGGWGE MKSSELH+YV+SE+S VVQTAWV+
Sbjct: 599 EALHSVGECYANSIVVKKGCDFLVNRQMTDGGWGEPMKSSELHTYVNSERSQVVQTAWVV 658

Query: 662 VALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKAL 721
           +ALLLA+YP KDVI +G++LLK RQ PSGEWKFES EGVFNHSCAIEYPSYR LFPIKAL
Sbjct: 659 IALLLAKYPRKDVIIKGVELLKSRQEPSGEWKFESPEGVFNHSCAIEYPSYRHLFPIKAL 718

Query: 722 GLYTKAY 728
           GLY + Y
Sbjct: 719 GLYAEIY 725

>TBLA0A03120 Chr1 (742618..744849) [2232 bp, 743 aa] {ON} Anc_5.351
           YHR072W
          Length = 743

 Score = 1193 bits (3086), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 552/728 (75%), Positives = 639/728 (87%), Gaps = 5/728 (0%)

Query: 4   FYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTPSPL 63
            YS+E+ L KTDP+ WRL TDKLGRESWEYL+ ED+ K PQS++ +WLLQ+P+FPTP P 
Sbjct: 14  LYSDELKLPKTDPRRWRLITDKLGRESWEYLSEEDSKKIPQSTFVKWLLQIPDFPTPKPK 73

Query: 64  KNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGVKIP 123
               +KN  +T +DA  NGA+FFKLLQD  SGIFPCQYKGPMF+TIGY+AV YIAG+KIP
Sbjct: 74  IKQGDKN--FTTHDALLNGANFFKLLQDPESGIFPCQYKGPMFLTIGYVAVQYIAGIKIP 131

Query: 124 DHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKARDT 183
           +HER+E+IRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYV LRLLGL K HPVCVKAR T
Sbjct: 132 EHERLEIIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVILRLLGLPKTHPVCVKARKT 191

Query: 184 LIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGVYLP 243
           LI+LGGAIG+PHWGK WLS LNLYKWEGVNPAPPETWLLPYSL IHPGRWWVHTRGVYLP
Sbjct: 192 LIRLGGAIGSPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYSLPIHPGRWWVHTRGVYLP 251

Query: 244 ISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVANDC 303
           +SYL L +++C  TPL+ E+R+EIY   +D+IDFS+HRNTVCGVDLYYPHSK+LDVAN+ 
Sbjct: 252 VSYLGLTKFACPPTPLIEEIRKEIYATEYDTIDFSKHRNTVCGVDLYYPHSKILDVANNI 311

Query: 304 IVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDSQAF 363
           +VFYEK++RP ++++KSKE V DLI+KEI NTDYLCIAPVNQAFC+LV L+E+G +S+ F
Sbjct: 312 LVFYEKWIRPNFIYNKSKEKVLDLIEKEIANTDYLCIAPVNQAFCSLVILVEKGVNSKEF 371

Query: 364 KRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAYEFL 423
           +R ++RFKDALFHGPQGMTVMGTNGVQ WDCAFA+QYFF+AGLAE+PEF D I+R+Y+FL
Sbjct: 372 ERCQYRFKDALFHGPQGMTVMGTNGVQTWDCAFAVQYFFMAGLAERPEFKDLIIRSYKFL 431

Query: 424 CRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVHDKI 483
           CRSQFDTECVPGSFRDKR+G WGFSTKTQGYTVSDCTAE+IKAIIMVRNS  F+ VHD+I
Sbjct: 432 CRSQFDTECVPGSFRDKRIGGWGFSTKTQGYTVSDCTAESIKAIIMVRNSPAFKEVHDEI 491

Query: 484 SDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECT 543
           SDERL +GI++LMSLQNLG FEYGSFATYEKIKAPL ME LNPAEVF NIMVEYPYVECT
Sbjct: 492 SDERLYQGIEILMSLQNLGKFEYGSFATYEKIKAPLSMELLNPAEVFCNIMVEYPYVECT 551

Query: 544 DSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFAMEA 603
           DSSVLGLT+FHKH  Y+ +EI  RI+LAIDYIK  Q  DGSWYG WGICFTYA MFA+EA
Sbjct: 552 DSSVLGLTYFHKHYDYKYDEIGKRIRLAIDYIKRAQNNDGSWYGSWGICFTYASMFALEA 611

Query: 604 LYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDS---EKSLVVQTAWV 660
           L T+GE+Y+NSETV+KGCDF+VSKQ +DGGW E+MKSSE+H YVDS   E S VVQT+W 
Sbjct: 612 LETIGEDYNNSETVKKGCDFIVSKQNKDGGWSETMKSSEIHYYVDSGDLEGSYVVQTSWS 671

Query: 661 LVALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 720
           ++ L+LA YPDKDV+ RGI+ +K +QLPSGEW+F++VEGVFNHSC IEYPSYRFLFPIKA
Sbjct: 672 VIGLILANYPDKDVVYRGIEYIKSQQLPSGEWEFQNVEGVFNHSCGIEYPSYRFLFPIKA 731

Query: 721 LGLYTKAY 728
           LGLY   Y
Sbjct: 732 LGLYRTRY 739

>ZYRO0D10164g Chr4 (854166..856364) [2199 bp, 732 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 732

 Score = 1181 bits (3054), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/733 (73%), Positives = 627/733 (85%), Gaps = 1/733 (0%)

Query: 1   MVEFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTP 60
           M + YSEE+ LE+TDP LWRLR DKLGRESWEY++ EDA  DPQS Y QWLLQ+P FP P
Sbjct: 1   MTKLYSEELQLERTDPNLWRLRVDKLGRESWEYISKEDAKNDPQSKYVQWLLQLPSFPKP 60

Query: 61  SPLKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGV 120
           SP  +S N  + + A +AC NGASF++LLQD +SGIFPCQYKGPMFMTIGY+ V+Y+AG+
Sbjct: 61  SPKIHSGNAKK-FNALEACKNGASFYQLLQDPDSGIFPCQYKGPMFMTIGYVVVHYVAGI 119

Query: 121 KIPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKA 180
           +IP  +R+E+IRYIVNT+HPVDGGWGLHS DKSTVFGT +NYVNLRLLGL +DHPVCVKA
Sbjct: 120 EIPKPKRLEMIRYIVNTSHPVDGGWGLHSTDKSTVFGTAINYVNLRLLGLPRDHPVCVKA 179

Query: 181 RDTLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGV 240
           R TL KLGGA+GAPHWGK WLS LNLYKWEGVNPAPPETWLLPY L IHPGRWWVHTR +
Sbjct: 180 RRTLHKLGGALGAPHWGKIWLSVLNLYKWEGVNPAPPETWLLPYFLPIHPGRWWVHTRAI 239

Query: 241 YLPISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVA 300
           YLP+SYLSL+RY C LTPLL ELREE+Y KPF+SIDF  +RNTVCGVDLYYPHSKVLD+ 
Sbjct: 240 YLPVSYLSLIRYQCPLTPLLQELREELYVKPFNSIDFGSNRNTVCGVDLYYPHSKVLDLM 299

Query: 301 NDCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDS 360
           N  +VFYEK+LR  W++  +K  VY LIKKEI NTDYLCIAPVNQAFCALVTLIEEG +S
Sbjct: 300 NSVLVFYEKHLRFNWINTMAKNRVYGLIKKEIANTDYLCIAPVNQAFCALVTLIEEGVNS 359

Query: 361 QAFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAY 420
             FKRF+FRF DALFHGPQGMT+MGTNGVQ WDCAF IQ  F AGLAEK ++Y+T+VRAY
Sbjct: 360 PQFKRFQFRFNDALFHGPQGMTMMGTNGVQTWDCAFTIQSLFTAGLAEKEQYYETVVRAY 419

Query: 421 EFLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVH 480
           EFL R+QF  ECVPGSFRD R GAWGFSTKTQGYTVSDCTAE+IKAIIMV+ S  +  VH
Sbjct: 420 EFLNRAQFQDECVPGSFRDLRKGAWGFSTKTQGYTVSDCTAESIKAIIMVKKSPFYAKVH 479

Query: 481 DKISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540
             I DERL + IDVL+SLQN+G FEYGSFATYE IKAPL ME LNPAEVFGNIMVEYPYV
Sbjct: 480 SLIDDERLCQAIDVLLSLQNVGPFEYGSFATYEMIKAPLLMEKLNPAEVFGNIMVEYPYV 539

Query: 541 ECTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFA 600
           ECTDS+VLGLT FH +  YR++EI++RI +A+DYIK CQ EDGSWYGCWG+CFTYAGMFA
Sbjct: 540 ECTDSAVLGLTSFHDYCDYRRDEISDRINIAVDYIKKCQNEDGSWYGCWGVCFTYAGMFA 599

Query: 601 MEALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWV 660
           +EAL++VGE+Y NS+ V+KGCDFLV +QM DGGWGE+MKS ELH+YV+S++S+VVQT+WV
Sbjct: 600 LEALHSVGEDYHNSKIVQKGCDFLVDRQMADGGWGETMKSCELHTYVESQESMVVQTSWV 659

Query: 661 LVALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 720
           ++ALLL++YP+K VIDR ++ L+ RQ  SGEWKF+ VEGVFNHSCAIEYP+YRF+FPIKA
Sbjct: 660 IIALLLSKYPNKSVIDRAVKFLETRQERSGEWKFDGVEGVFNHSCAIEYPNYRFIFPIKA 719

Query: 721 LGLYTKAYSDNGI 733
           LGLY  A+    I
Sbjct: 720 LGLYVNAFGKEAI 732

>SAKL0G08844g Chr7 complement(757226..759466) [2241 bp, 746 aa] {ON}
           highly similar to uniprot|P38604 Saccharomyces
           cerevisiae YHR072W ERG7 Lanosterol synthase an essential
           enzyme that catalyzes the cyclization of squalene 2 3-
           epoxide a step in ergosterol biosynthesis
          Length = 746

 Score = 1169 bits (3025), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 545/733 (74%), Positives = 626/733 (85%), Gaps = 3/733 (0%)

Query: 1   MVEFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTP 60
           M + YS+++GL KTDP  WRL TD+LGRE+WEYL+ E A K+PQSSY ++LLQ+P+FP P
Sbjct: 17  MTKLYSDQLGLPKTDPTRWRLHTDELGRETWEYLSTEQAAKEPQSSYVKYLLQLPDFPAP 76

Query: 61  SPLKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGV 120
            P + S  ++  +TAYDA +NGA F +LLQ+E SGIFPCQYKGPMF+TIGY+A  Y AG+
Sbjct: 77  KPERTS--EDPEFTAYDAAYNGAQFLQLLQEE-SGIFPCQYKGPMFITIGYVATCYAAGI 133

Query: 121 KIPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKA 180
           +IP+HER E++RYIVN AHPVDGGWGLHS DKST FGT +NYV LRLLGL  DH VC +A
Sbjct: 134 EIPEHERHEIVRYIVNMAHPVDGGWGLHSEDKSTAFGTSINYVILRLLGLPSDHIVCRRA 193

Query: 181 RDTLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGV 240
           R TL+KLGGAIGAPHWGK WLS LNLY WEGVNPAPPE WLLPY+L IHPGRWWVHTR V
Sbjct: 194 RSTLLKLGGAIGAPHWGKIWLSILNLYGWEGVNPAPPELWLLPYALPIHPGRWWVHTRAV 253

Query: 241 YLPISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVA 300
           Y+P+ YLS  ++ CELTPLL E+R EIYTK +D+IDFS+HRNTVCG+DLYYPH+K+LDVA
Sbjct: 254 YMPVGYLSAKKFCCELTPLLKEIRTEIYTKEYDTIDFSKHRNTVCGIDLYYPHTKLLDVA 313

Query: 301 NDCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDS 360
           N  +VFYEKYLRP W  + + + VY+LIKKEI NTDYLCIAPVN AFCA+VTLIEEG DS
Sbjct: 314 NWGMVFYEKYLRPNWFLNYTNKKVYELIKKEITNTDYLCIAPVNMAFCAVVTLIEEGVDS 373

Query: 361 QAFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAY 420
             F RF  RFKD LFHGPQGMT+MGTNGVQVWDCAFA+QY F+A LAE PEF   IV+AY
Sbjct: 374 HEFNRFRDRFKDVLFHGPQGMTLMGTNGVQVWDCAFAVQYLFLAELAELPEFRGIIVKAY 433

Query: 421 EFLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVH 480
           +FLCRSQFDTEC PGSFRDKRVG W FSTKTQGYTVSDCTAEA+KAIIMVRNS  F    
Sbjct: 434 KFLCRSQFDTECEPGSFRDKRVGGWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPAFVEYR 493

Query: 481 DKISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540
           ++ISDERL K +D+L++LQN+GSFEYGSFA+YEKIKA   +E LNPAEVFGNIMVE+PYV
Sbjct: 494 NEISDERLYKAMDILLNLQNVGSFEYGSFASYEKIKASTLIEKLNPAEVFGNIMVEFPYV 553

Query: 541 ECTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFA 600
           ECTDSSVLGLT+FHKH  YRK++IA+ IK+AIDYIK  Q ++GSWYG WG+CFTYAGMFA
Sbjct: 554 ECTDSSVLGLTYFHKHYDYRKDDIAHAIKIAIDYIKRSQAKNGSWYGSWGVCFTYAGMFA 613

Query: 601 MEALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWV 660
           +EALYTVGENY NSE VRKGCDFLVS+QMEDGGWGES KSSELH+YV SE+SLVVQTAW 
Sbjct: 614 LEALYTVGENYENSEVVRKGCDFLVSRQMEDGGWGESPKSSELHNYVSSEQSLVVQTAWS 673

Query: 661 LVALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 720
           ++ LLLAEYPDK VIDRGIQLLK RQLPSGEWKFES+EGVFNHSC IEYPSY+FLFPIKA
Sbjct: 674 VIGLLLAEYPDKKVIDRGIQLLKSRQLPSGEWKFESIEGVFNHSCMIEYPSYKFLFPIKA 733

Query: 721 LGLYTKAYSDNGI 733
           LGLY K Y ++ I
Sbjct: 734 LGLYAKRYGNDAI 746

>KLLA0B10175g Chr2 (889538..891733) [2196 bp, 731 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 731

 Score = 1132 bits (2928), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 526/733 (71%), Positives = 609/733 (83%), Gaps = 2/733 (0%)

Query: 1   MVEFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTP 60
           M E YSE IGL +TDPK WRL TD LGR++WEYL+  D+ K PQS++ +WLL+  +FP P
Sbjct: 1   MPELYSETIGLPRTDPKRWRLITDDLGRQTWEYLSENDSKKVPQSTFARWLLKCEDFPEP 60

Query: 61  SPLKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGV 120
            P  NS  K   +TA++A HNGA FF+LLQD +SG FPCQYKGPMFMTIGY+   YIA +
Sbjct: 61  HPEINS--KTSGFTAWNAAHNGAKFFELLQDPDSGTFPCQYKGPMFMTIGYVVTMYIAKI 118

Query: 121 KIPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKA 180
           +IP+HE+ E+IRY+ N AHPVDGGWGLH VDKSTV GTVLNYV +RLLGL KDH VCV+A
Sbjct: 119 EIPEHEKAEMIRYVANYAHPVDGGWGLHHVDKSTVLGTVLNYVMMRLLGLPKDHEVCVRA 178

Query: 181 RDTLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGV 240
           RDTL++LGGAI +PHW K WLS LNLYKWEGVNPAPPE W+LPY L+IHP RWWVHTRG+
Sbjct: 179 RDTLLRLGGAIASPHWAKIWLSILNLYKWEGVNPAPPELWMLPYGLNIHPARWWVHTRGI 238

Query: 241 YLPISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVA 300
           YLP+SYLS  +YSCEL PLL E+R EIYT+PF++IDF +HRNTVCGVDLYYPH+KVLD  
Sbjct: 239 YLPVSYLSSTQYSCELDPLLEEIRTEIYTQPFETIDFKKHRNTVCGVDLYYPHTKVLDTM 298

Query: 301 NDCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDS 360
           N  I  YE+Y+RP W+  KS   VY+L+KKEI NTDYLCIAPVN AFCA+VTLIEEG+DS
Sbjct: 299 NYFISKYERYVRPNWLLKKSTNRVYELVKKEIANTDYLCIAPVNNAFCAIVTLIEEGKDS 358

Query: 361 QAFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAY 420
           + F RF +RFKD LFHGPQG+TVMGTNGVQVWDCAF IQY F+AGLAE PEF++TIVR++
Sbjct: 359 EEFGRFLYRFKDVLFHGPQGLTVMGTNGVQVWDCAFYIQYMFMAGLAELPEFHETIVRSF 418

Query: 421 EFLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVH 480
           +FLCRSQF  +CV GSFRDKR+GAW FSTKTQGYTVSDCTAEAIKAIIMV NSD +R V 
Sbjct: 419 KFLCRSQFTEDCVEGSFRDKRLGAWPFSTKTQGYTVSDCTAEAIKAIIMVLNSDKYRDVW 478

Query: 481 DKISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540
                E+L  GIDVL+ LQNL SFEYGSFATYEKIKAPL ME LNPAEVFGNIMVE+PYV
Sbjct: 479 GVYDTEKLKNGIDVLLGLQNLSSFEYGSFATYEKIKAPLLMEKLNPAEVFGNIMVEFPYV 538

Query: 541 ECTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFA 600
           ECTDSSVLGLT+F ++ +YRK++I + I  AI YIK  QQ +GSWYGCWGIC+TYAGMFA
Sbjct: 539 ECTDSSVLGLTYFRRYFNYRKKDIDHAIDSAIAYIKKSQQPNGSWYGCWGICYTYAGMFA 598

Query: 601 MEALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWV 660
           +EAL T+GE Y NSE VRKGCDF V+KQ+ DGGW E MKSSELH+YV  ++S VVQTAWV
Sbjct: 599 LEALNTIGETYENSEVVRKGCDFFVTKQLPDGGWSEKMKSSELHTYVSDKESYVVQTAWV 658

Query: 661 LVALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKA 720
           L+ L+LA++PDK VIDR I LLK RQ PSGEWK+E+VEGVFNHSCAIEYPSYRFLFPIKA
Sbjct: 659 LIGLILAKFPDKSVIDRAINLLKQRQQPSGEWKYEAVEGVFNHSCAIEYPSYRFLFPIKA 718

Query: 721 LGLYTKAYSDNGI 733
           LGLY K Y  + I
Sbjct: 719 LGLYVKEYGHSAI 731

>KLTH0H14850g Chr8 (1287375..1289555) [2181 bp, 726 aa] {ON} highly
           similar to uniprot|P38604 Saccharomyces cerevisiae
           YHR072W ERG7 Lanosterol synthase an essential enzyme
           that catalyzes the cyclization of squalene 2 3- epoxide
           a step in ergosterol biosynthesis
          Length = 726

 Score = 1124 bits (2908), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 528/727 (72%), Positives = 607/727 (83%), Gaps = 3/727 (0%)

Query: 2   VEFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTPS 61
           ++ Y++E+GL  TD  LWRLRTD+LG E WEYL+ E+A  DPQSSY ++LLQ P+F  P 
Sbjct: 1   MKLYADELGLPTTDKTLWRLRTDELGSEKWEYLSEEEAKADPQSSYVKYLLQNPDFEAPE 60

Query: 62  PLKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGVK 121
           PL++S  K + +TA DA  NGA FF LLQ E++GIFPCQYKGPMF+TIGY+A  Y A + 
Sbjct: 61  PLRSS--KCDEFTAGDAAFNGAQFFSLLQ-EDTGIFPCQYKGPMFLTIGYVATLYCARIP 117

Query: 122 IPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKAR 181
           +P+H +IE+IRYIVN+AHPVDGGWGLH VDKST FGT +NYV LRLLGL  DH VC +AR
Sbjct: 118 VPEHIKIEIIRYIVNSAHPVDGGWGLHEVDKSTTFGTAINYVILRLLGLEADHIVCQRAR 177

Query: 182 DTLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGVY 241
            TL +LGGAIGAPHWGK WLS LNLY+WEGVNPAPPE WLLPY+L IHPGRWWVHTR VY
Sbjct: 178 KTLHRLGGAIGAPHWGKAWLSILNLYRWEGVNPAPPELWLLPYALPIHPGRWWVHTRAVY 237

Query: 242 LPISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVAN 301
             + YLS  +Y CELTPLL E+R+EIY KPF+SIDFS+H+NTV GVDLYYPH+K+L++AN
Sbjct: 238 QALGYLSAAKYCCELTPLLQEIRKEIYVKPFESIDFSKHKNTVGGVDLYYPHTKLLNIAN 297

Query: 302 DCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDSQ 361
             +  YE YL+P W    S   VY+LIKKEI+NTDYLCIAPV+ AFCA+VTLIEEGRDS 
Sbjct: 298 VALTLYENYLKPNWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAVVTLIEEGRDSY 357

Query: 362 AFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAYE 421
            FKRF   F++ LF GPQGMTVMGTNGVQVWDCAFAIQY+FVAGLAE PEF DTI +AY+
Sbjct: 358 EFKRFVDGFQEVLFMGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFRDTIEKAYK 417

Query: 422 FLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVHD 481
           FLCRSQFDTEC PGSFRDKRVGAW FSTKTQGYTVSDCTAEA+KAIIMVRNS  F  +  
Sbjct: 418 FLCRSQFDTECEPGSFRDKRVGAWPFSTKTQGYTVSDCTAEAVKAIIMVRNSPKFTYLRG 477

Query: 482 KISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVE 541
           +ISDERL K +D+L+ LQN GSFEYGSFATYEKIKA   +E LNPAEVFGNIMVE+PYVE
Sbjct: 478 EISDERLYKAVDILLGLQNTGSFEYGSFATYEKIKATTALEKLNPAEVFGNIMVEFPYVE 537

Query: 542 CTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFAM 601
           CTDSSVLGLT+F K+ +YRK+EI   I++AI YIK  Q  DGSWYGCWG+CFTYAGMFA+
Sbjct: 538 CTDSSVLGLTYFAKYYNYRKDEITKAIEIAIQYIKRVQNPDGSWYGCWGVCFTYAGMFAL 597

Query: 602 EALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWVL 661
           EALYTVGENY NSE VRKGCDF  S+Q  DGGW ESMKSSELH+YV+++ S VVQTAW L
Sbjct: 598 EALYTVGENYENSEVVRKGCDFFASRQRSDGGWSESMKSSELHTYVEADNSQVVQTAWAL 657

Query: 662 VALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKAL 721
           + LLLA+YP++DVIDRGI LLK RQLPSGEWKFE VEGVFNHSCAIEYPSY+FLFPIKAL
Sbjct: 658 IGLLLAKYPNRDVIDRGIALLKKRQLPSGEWKFEDVEGVFNHSCAIEYPSYKFLFPIKAL 717

Query: 722 GLYTKAY 728
           GLY+K Y
Sbjct: 718 GLYSKRY 724

>Kwal_34.15979 s34 complement(142874..145060) [2187 bp, 728 aa] {ON}
           YHR072W (ERG7) - 2,3-oxidosqualene-lanosterol cyclase
           [contig 272] FULL
          Length = 728

 Score = 1116 bits (2887), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 525/725 (72%), Positives = 605/725 (83%), Gaps = 3/725 (0%)

Query: 4   FYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTPSPL 63
            YSEE+GL KTD K WRL+TD LG E WEYL+  +A + PQS+Y ++LLQ+P+F  P P 
Sbjct: 2   LYSEELGLPKTDSKRWRLKTDALGSEKWEYLSEIEAKQQPQSAYVKYLLQLPDFEAPKPA 61

Query: 64  KNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGVKIP 123
            N ++ +  +TA DA  NGA FF LLQ E+SGIFPCQYKGPMFMTIGY+A  Y A V IP
Sbjct: 62  VNKNSAH--FTAKDAAFNGAQFFSLLQ-EDSGIFPCQYKGPMFMTIGYVAALYCAEVPIP 118

Query: 124 DHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKARDT 183
              + E+IRYIVN++HPVDGGWGLH VDKST FGTV+NYV LRLLGL  D+ VC +AR T
Sbjct: 119 TPVKQEIIRYIVNSSHPVDGGWGLHEVDKSTTFGTVINYVILRLLGLKPDNIVCQRARRT 178

Query: 184 LIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGVYLP 243
           L +LGGA+GAPHWGK WLS LNLYKWEGVNPAPPE WLLPY+L IHPGRWWVHTR +Y  
Sbjct: 179 LHRLGGAVGAPHWGKAWLSILNLYKWEGVNPAPPELWLLPYALPIHPGRWWVHTRAIYQA 238

Query: 244 ISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVANDC 303
           + YLS  +YSC +TPLL E+R EIYT+PF+SIDFS+ +N VCGVDLYYPH+++L++AN  
Sbjct: 239 LGYLSAAKYSCPVTPLLEEIRNEIYTQPFESIDFSKQKNNVCGVDLYYPHTRLLNIANAS 298

Query: 304 IVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDSQAF 363
           ++FYEKYL+P W    S   VY+LIKKEI+NTDYLCIAPV+ AFCA+VTLIEEGRDS  F
Sbjct: 299 MIFYEKYLKPDWFLKYSNRKVYELIKKEIKNTDYLCIAPVSMAFCAIVTLIEEGRDSYEF 358

Query: 364 KRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAYEFL 423
           KRF  RF+D LF GPQGMTVMGTNGVQVWDCAFAIQY+FVAGLAE PEF++TI +AY+FL
Sbjct: 359 KRFLERFEDVLFLGPQGMTVMGTNGVQVWDCAFAIQYYFVAGLAELPEFHETIEKAYKFL 418

Query: 424 CRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVHDKI 483
           CRSQFDTEC PGSFRDKR+GAW FSTKTQGYTVSDCTAE++KAIIMVRNS  F  + D+I
Sbjct: 419 CRSQFDTECEPGSFRDKRIGAWPFSTKTQGYTVSDCTAESVKAIIMVRNSPSFANLRDEI 478

Query: 484 SDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECT 543
           SDERL K +DVL++LQN GSFEYGSFATYEKIKA   +E LNPAEVFGNIMVE+PYVECT
Sbjct: 479 SDERLYKAMDVLLALQNTGSFEYGSFATYEKIKATTKLEKLNPAEVFGNIMVEFPYVECT 538

Query: 544 DSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFAMEA 603
           DSSVLGLT+F KH +YR+EEI   I++AI YIK+ Q+ DGSWYGCWGICFTYAGMFA+EA
Sbjct: 539 DSSVLGLTYFSKHYTYRQEEIKKAIEIAIQYIKNAQKPDGSWYGCWGICFTYAGMFALEA 598

Query: 604 LYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWVLVA 663
           L+TV E Y NSE V+KGCDFLVSKQ  DGGW ESMKSSELHSYV+S  S  VQTAW L+ 
Sbjct: 599 LHTVDETYENSEVVQKGCDFLVSKQRPDGGWSESMKSSELHSYVESANSQAVQTAWALIG 658

Query: 664 LLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGL 723
           LLLAEYP+K++ID+GI LLK RQL SGEWKFE VEGVFNHSCAIEYPSY+FLFPIKALGL
Sbjct: 659 LLLAEYPNKEIIDKGINLLKKRQLESGEWKFEEVEGVFNHSCAIEYPSYKFLFPIKALGL 718

Query: 724 YTKAY 728
           Y K Y
Sbjct: 719 YAKKY 723

>AGR351W Chr7 (1381502..1383691) [2190 bp, 729 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR072W (ERG7)
          Length = 729

 Score = 1065 bits (2754), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 484/730 (66%), Positives = 592/730 (81%), Gaps = 2/730 (0%)

Query: 4   FYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTPSPL 63
            YS+E+GL  TD + WRL  D++G E WEY+  ++  K PQ++  QWLL VP FPTP P 
Sbjct: 2   LYSDELGLPTTDSRRWRLFCDEVGAERWEYMDEQETSKVPQTTCVQWLLNVPSFPTPEP- 60

Query: 64  KNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGVKIP 123
              S+K++ +TA +A +NGA F  LLQDE SG FPC Y+GPMFMTIGY+   ++ GV IP
Sbjct: 61  -EVSSKDQGFTAANAAYNGARFLGLLQDEASGTFPCSYRGPMFMTIGYVVAMHVGGVVIP 119

Query: 124 DHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKARDT 183
           + +R EL+RY+VNTAHPVDGGWGLHS DKSTV GT LNYV LRLLG+ ++H V  +AR T
Sbjct: 120 EPQRRELVRYVVNTAHPVDGGWGLHSEDKSTVMGTALNYVLLRLLGMEREHIVMQRARKT 179

Query: 184 LIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGVYLP 243
           L+++GGAIG+P+WGK WLS LNLYKWEGVNPAPPE WLLPY    HP RWWVHTR ++LP
Sbjct: 180 LLRMGGAIGSPYWGKVWLSVLNLYKWEGVNPAPPELWLLPYQFPYHPARWWVHTRAIFLP 239

Query: 244 ISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVANDC 303
           +SYL+ VRY C LTPLL E+R EI+T+PF+ IDF+ +RN VCG+DLYYPH+ VL+  N C
Sbjct: 240 MSYLAGVRYQCALTPLLEEIRSEIFTRPFEEIDFAANRNNVCGIDLYYPHTTVLNTLNKC 299

Query: 304 IVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDSQAF 363
           IV YEKYLRP W+   S   +Y+LIK EI+NTDYLCIAPVN A  A+VT IEEG DS  F
Sbjct: 300 IVGYEKYLRPNWLLKYSLNRIYELIKMEIQNTDYLCIAPVNNALNAIVTCIEEGPDSAEF 359

Query: 364 KRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAYEFL 423
            RF  RFK+ LF GPQGM VMGTNGVQVWDCAF IQ  F A L +KPEFY+ IVRAY FL
Sbjct: 360 GRFLDRFKEVLFLGPQGMLVMGTNGVQVWDCAFYIQSMFAANLQDKPEFYENIVRAYRFL 419

Query: 424 CRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVHDKI 483
           CRSQ   +CVPGS+RD R+GAW FSTKTQGY VSDCTAEA K++++VRNS VF+ V D+I
Sbjct: 420 CRSQITDDCVPGSYRDPRIGAWPFSTKTQGYAVSDCTAEAAKSVLLVRNSPVFKEVRDEI 479

Query: 484 SDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYVECT 543
           S E+L K ID L+ LQNLGSF+YGSFA+YEKI+APL +E+LN AEVF NIMVE+PYVECT
Sbjct: 480 SSEKLQKAIDALLGLQNLGSFKYGSFASYEKIRAPLSIESLNSAEVFANIMVEHPYVECT 539

Query: 544 DSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFAMEA 603
           DSSVLGL+F+ K+  YR++E+ + IK+A+ +IKS Q++DGSWYGCWGIC+TYAGMFA+EA
Sbjct: 540 DSSVLGLSFYRKYHDYRQDEVDHAIKIAVKFIKSAQEKDGSWYGCWGICYTYAGMFALEA 599

Query: 604 LYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEKSLVVQTAWVLVA 663
           L+  GE+Y++SE V+KGC+FLVSKQ+ DGGW E+MKSSELH+YV  ++S VVQTAW L+ 
Sbjct: 600 LHNAGESYADSEVVKKGCEFLVSKQLPDGGWSETMKSSELHTYVSDKRSYVVQTAWALIG 659

Query: 664 LLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIKALGL 723
           LLLA+YPD+ VIDRGIQLLK+RQLPSGEWK+ES+EGVFNHSCAIEYPSYRF+FPIKALG+
Sbjct: 660 LLLADYPDRKVIDRGIQLLKERQLPSGEWKYESIEGVFNHSCAIEYPSYRFVFPIKALGI 719

Query: 724 YTKAYSDNGI 733
           Y+K Y+ + +
Sbjct: 720 YSKKYAKDAL 729

>Ecym_8182 Chr8 complement(379402..381600) [2199 bp, 732 aa] {ON}
           similar to Ashbya gossypii AGR351W
          Length = 732

 Score = 1060 bits (2741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 492/734 (67%), Positives = 586/734 (79%), Gaps = 3/734 (0%)

Query: 1   MVEFYSEEIGLEKTDPKLWRLRTDKLGRESWEYLTPEDADKDPQSSYTQWLLQVPEFPTP 60
           MVE YS+ +GL  TDP  WRL    LG  SW+Y++  D+ K PQ + T+WLL    F TP
Sbjct: 1   MVELYSDYLGLPSTDPSRWRLNCTSLGETSWKYISEADSKKIPQCNCTKWLLNADNFSTP 60

Query: 61  SPLKNSSNKNENYTAYDACHNGASFFKLLQDENSGIFPCQYKGPMFMTIGYIAVNYIAGV 120
            P  +  N + N+ AY+A +NGASF KLLQ+++SG FP QYKGPMFMTI Y+   Y+   
Sbjct: 61  EP--DVGNGDANFKAYNAAYNGASFLKLLQNQDSGTFPNQYKGPMFMTICYVGSMYVGRK 118

Query: 121 KIPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVFGTVLNYVNLRLLGLSKDHPVCVKA 180
           +IP+ E+IE+IRYIVNTAHPVDGGWGLH+  KSTVFGTVLNY+ LRLLG+SKDH VC +A
Sbjct: 119 EIPECEKIEIIRYIVNTAHPVDGGWGLHTTGKSTVFGTVLNYIVLRLLGMSKDHVVCRRA 178

Query: 181 RDTLIKLGGAIGAPHWGKTWLSTLNLYKWEGVNPAPPETWLLPYSLSIHPGRWWVHTRGV 240
           R TL +LGGAIGAPHWGK WLS LNLYKWEGVNPAP E W LPY + IHP RWW+HTR +
Sbjct: 179 RSTLHRLGGAIGAPHWGKIWLSILNLYKWEGVNPAPAEFWTLPYIVPIHPARWWIHTRAI 238

Query: 241 YLPISYLSLVRYSCELTPLLAELREEIYTKPFDSIDFSRHRNTVCGVDLYYPHSKVLDVA 300
           YLP+SYL  + Y+CELTPLL E+R EIYT  FD I FS+HRNTVC VDLY+PHS +L+V 
Sbjct: 239 YLPMSYLCGISYACELTPLLQEIRNEIYTTNFDEIQFSKHRNTVCQVDLYFPHSTILNVI 298

Query: 301 NDCIVFYEKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAPVNQAFCALVTLIEEGRDS 360
           N  IV+Y+ YLRP W+   S + VY+LI+KEI NT+YLC+APV+ AFC++VT IEEG DS
Sbjct: 299 NSAIVWYQNYLRPDWLVKYSNKKVYELIRKEIVNTEYLCVAPVSAAFCSIVTCIEEGADS 358

Query: 361 QAFKRFEFRFKDALFHGPQGMTVMGTNGVQVWDCAFAIQYFFVAGLAEKPEFYDTIVRAY 420
             F+R    F   +FHGPQGMTVMGTNG QVWDC+F +QY F+A LAE PEF D +  AY
Sbjct: 359 PEFERLMEAFAGNVFHGPQGMTVMGTNGSQVWDCSFFVQYLFMANLAELPEFQDAVTNAY 418

Query: 421 EFLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKAIIMVRNSDVFRAVH 480
           +FLCRSQF  ECV GS+RDKRVG W FSTKTQGYTVSDCTAEA+KA+IMV+ S VF A+H
Sbjct: 419 KFLCRSQFTHECVSGSYRDKRVGGWPFSTKTQGYTVSDCTAEALKAVIMVKRSPVFAAIH 478

Query: 481 DKISDERLNKGIDVLMSLQNLGSFEYGSFATYEKIKAPLFMEALNPAEVFGNIMVEYPYV 540
           D+IS+E L K IDVL+SLQN+GS EYGSFATYEKI+APL ME LNPAEVF NIMVEYPYV
Sbjct: 479 DEISEEALQKAIDVLLSLQNVGSIEYGSFATYEKIRAPLIMEKLNPAEVFENIMVEYPYV 538

Query: 541 ECTDSSVLGLTFFHKHSSYRKEEIANRIKLAIDYIKSCQQEDGSWYGCWGICFTYAGMFA 600
           ECTDS +LGLT+F ++  YRK++I + +K+A DYIK  Q +DGSWYGCWGIC+TYAGMFA
Sbjct: 539 ECTDSCILGLTYFSEYYDYRKDDIDHSVKIAADYIKKVQGKDGSWYGCWGICYTYAGMFA 598

Query: 601 MEALYTVGENYSNSETVRKGCDFLVSKQMEDGGWGESMKSSELHSYVDSEK-SLVVQTAW 659
           +EALYT+GENY NSE VR+GCDFLV KQ+ DGGW ES+KS+EL  Y++ +K SLVV T+W
Sbjct: 599 LEALYTIGENYENSEVVRRGCDFLVKKQLSDGGWSESIKSAELMCYINDDKGSLVVPTSW 658

Query: 660 VLVALLLAEYPDKDVIDRGIQLLKDRQLPSGEWKFESVEGVFNHSCAIEYPSYRFLFPIK 719
            L+ LLLA+YPDK+VIDRGIQLLK RQL SGEWKFE +EG+FNHSCAIEYP+YRFLFPIK
Sbjct: 659 ALIGLLLADYPDKEVIDRGIQLLKSRQLRSGEWKFEQIEGIFNHSCAIEYPTYRFLFPIK 718

Query: 720 ALGLYTKAYSDNGI 733
           ALG+Y K Y    I
Sbjct: 719 ALGIYAKKYGKRAI 732

>TPHA0A03110 Chr1 (684324..686762) [2439 bp, 812 aa] {ON} Anc_7.309
           YDL194W
          Length = 812

 Score = 37.0 bits (84), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 36/114 (31%), Positives = 50/114 (43%), Gaps = 8/114 (7%)

Query: 100 QYKGPMFMTIGYIAVNYIAGVKIPDHERIELIRYIVNTAHPVDGGWGLHSVDKSTVF--- 156
           Q+ G  F  I Y  VN+ +   IP+  RI  I Y VN A  V G + +    + T+    
Sbjct: 430 QFSGINF--IFYYGVNFFSRSGIPNSYRISFITYAVNVAFNVPGMFLVDYSGRRTLLIYG 487

Query: 157 GTVLNYVNLRL--LGLSKDHPVCVKARDTLIKLGGAIGAPHWGKT-WLSTLNLY 207
           G V+   N  +  +G + D  V  K     I L  A  A  WG T W+ +  LY
Sbjct: 488 GIVMAVSNFVIAGVGTAVDTIVADKVMVAFICLFIASFACTWGSTVWVISAELY 541

>NDAI0D01790 Chr4 (415315..418440) [3126 bp, 1041 aa] {ON} Anc_5.271
           YHR027C
          Length = 1041

 Score = 35.4 bits (80), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 31/108 (28%), Positives = 49/108 (45%), Gaps = 11/108 (10%)

Query: 401 FFVAGLAEKPEFYDTIVRAYEFLCRSQFDTECVP--GSFRDKRVGAWGFSTKTQGYTVSD 458
           F V  + + P F D     Y+ +C  Q+   CVP      DK      FS     Y    
Sbjct: 228 FEVESVDKLPPFVDE--NTYQRIC--QYMIACVPLLPQPEDKTYLNTAFSI----YLTQS 279

Query: 459 CTAEAIKAIIMVRNSDVFRAVHDKISDERLNKGIDVLMSLQNLGSFEY 506
              EA+   I + N ++ R+V D  SD+ +++ +  ++S Q + SFEY
Sbjct: 280 QLPEALALAIRLGNEELIRSVFDATSDKTMHQQLAYILSTQKI-SFEY 326

>TBLA0F04110 Chr6 (1018165..1019841) [1677 bp, 558 aa] {ON}
           Anc_6.338 YNR030W
          Length = 558

 Score = 33.5 bits (75), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 19/80 (23%), Positives = 35/80 (43%), Gaps = 4/80 (5%)

Query: 407 AEKPEFYDTIVRAYEFLCRSQFDTECVPGSFRDKRVGAWGFSTKTQGYTVSDCTAEAIKA 466
            EKPE    +  ++E+L  S+  ++  P    D   G W     T  ++  D  +  +  
Sbjct: 457 TEKPEQLIELWPSFEYLIMSEPSSDLFPAELNDT--GNWEIINTTTTFSYVD--SSFLMK 512

Query: 467 IIMVRNSDVFRAVHDKISDE 486
           I+   N ++FR + D +  E
Sbjct: 513 ILFTENKNIFRTIKDVVDSE 532

>NCAS0A11600 Chr1 (2302437..2303684) [1248 bp, 415 aa] {ON}
           Anc_3.451 YPR118W
          Length = 415

 Score = 31.6 bits (70), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 23/88 (26%), Positives = 37/88 (42%), Gaps = 10/88 (11%)

Query: 308 EKYLRPQWVHDKSKETVYDLIKKEIENTDYLCIAP------VNQAFCALVTLIEEGRDSQ 361
           E + R QW +D S    Y  +K  ++      ++       ++ A   + TL+EE  D +
Sbjct: 74  EAFTRNQWYYDLSD---YTSVKSRLQERLKFLLSSRPTAVNLSNALVVITTLLEESTDLK 130

Query: 362 AFKRFEFRFKDALFHGPQGMTV-MGTNG 388
            F    F+F  AL        + MG NG
Sbjct: 131 GFSLAVFKFVTALIEEDLANNIKMGANG 158

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.321    0.138    0.434 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 81,964,437
Number of extensions: 3695153
Number of successful extensions: 8340
Number of sequences better than 10.0: 24
Number of HSP's gapped: 8417
Number of HSP's successfully gapped: 24
Length of query: 733
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 616
Effective length of database: 40,065,477
Effective search space: 24680333832
Effective search space used: 24680333832
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 70 (31.6 bits)