Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_322.77.125ON53453424260.0
TPHA0C016107.125ON55149217010.0
Smik_6.4677.125ON54849414840.0
TDEL0H028707.125ON58749314870.0
Suva_16.447.125ON54949314690.0
Skud_16.187.125ON55049414680.0
YPL260W7.125ON55149414650.0
SAKL0F05390g7.125ON59549614530.0
NCAS0E021307.125ON52648614350.0
NDAI0E036707.125ON52248014260.0
KLLA0D14355g7.125ON58849514310.0
CAGL0H09108g7.125ON53248114170.0
TBLA0A009307.125ON58648614160.0
Kwal_55.208327.125ON57548814140.0
KLTH0F12540g7.125ON59549014140.0
KNAG0L009407.125ON54950813750.0
ZYRO0C05192g7.125ON58849413530.0
KAFR0L004607.125ON51148013331e-180
Ecym_83527.125ON57948313331e-179
ADL019W7.125ON52544011881e-158
Kpol_1062.587.125ON4911962772e-25
Skud_12.5034.291ON143697761.2
AGL106C8.408ON47058751.5
CAGL0B03399g1.337ON166459742.5
AER167W4.357ON27242704.5
KNAG0A019208.549ON242115695.9
Kpol_397.118.357ON95888697.4
KLLA0A04884g4.105ON105943699.1
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_322.7
         (534 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON} (16650..18...   939   0.0  
TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.1...   659   0.0  
Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON...   576   0.0  
TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.1...   577   0.0  
Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W (...   570   0.0  
Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W (...   570   0.0  
YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative sub...   568   0.0  
SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {...   564   0.0  
NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.1...   557   0.0  
NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.1...   553   0.0  
KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]...   555   0.0  
CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly...   550   0.0  
TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.1...   550   0.0  
Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260...   549   0.0  
KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} simi...   549   0.0  
KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7....   534   0.0  
ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} simila...   525   0.0  
KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.12...   518   e-180
Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}...   518   e-179
ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic ho...   462   e-158
Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [14...   111   2e-25
Skud_12.503 Chr12 (892705..897015) [4311 bp, 1436 aa] {ON} YLR41...    34   1.2  
AGL106C Chr7 complement(504816..506228) [1413 bp, 470 aa] {ON} S...    33   1.5  
CAGL0B03399g Chr2 (330838..335832) [4995 bp, 1664 aa] {ON} weakl...    33   2.5  
AER167W Chr5 (949269..950087) [819 bp, 272 aa] {ON} Syntenic hom...    32   4.5  
KNAG0A01920 Chr1 complement(146963..147691) [729 bp, 242 aa] {ON...    31   5.9  
Kpol_397.11 s397 (32117..34993) [2877 bp, 958 aa] {ON} (32117..3...    31   7.4  
KLLA0A04884g Chr1 (433581..436760) [3180 bp, 1059 aa] {ON} simil...    31   9.1  

>Kpol_322.7 s322 (16650..18254) [1605 bp, 534 aa] {ON}
           (16650..18254) [1605 nt, 535 aa]
          Length = 534

 Score =  939 bits (2426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 468/534 (87%), Positives = 468/534 (87%)

Query: 1   MSEFHSVASTADLSKYMYGVPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQE 60
           MSEFHSVASTADLSKYMYGVPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQE
Sbjct: 1   MSEFHSVASTADLSKYMYGVPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQE 60

Query: 61  VLTKVRELDDIRKRQAGEDAVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSA 120
           VLTKVRELDDIRKRQAGEDAVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSA
Sbjct: 61  VLTKVRELDDIRKRQAGEDAVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSA 120

Query: 121 PATYSSLSTVQKLLEHLDESNIFTNHDLRPIKDRLDEISTIVENNSYRNYDFDLTNPADE 180
           PATYSSLSTVQKLLEHLDESNIFTNHDLRPIKDRLDEISTIVENNSYRNYDFDLTNPADE
Sbjct: 121 PATYSSLSTVQKLLEHLDESNIFTNHDLRPIKDRLDEISTIVENNSYRNYDFDLTNPADE 180

Query: 181 TEEKRNKNKIEEDLLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIXXXXXXXXX 240
           TEEKRNKNKIEEDLLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHI         
Sbjct: 181 TEEKRNKNKIEEDLLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIRRSLLSLAS 240

Query: 241 XXXKIDTREDFSQFNXXXXXXXXXXXXXXXXXXXXXHRDENGNFKSLETGEVVLKGQNVL 300
              KIDTREDFSQFN                     HRDENGNFKSLETGEVVLKGQNVL
Sbjct: 241 PSRKIDTREDFSQFNSSKESQEALSSLEQELEELESHRDENGNFKSLETGEVVLKGQNVL 300

Query: 301 AGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRDTDLFQ 360
           AGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRDTDLFQ
Sbjct: 301 AGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRDTDLFQ 360

Query: 361 YQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKXXXXXXXXXXXXXXIHN 420
           YQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYK              IHN
Sbjct: 361 YQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKLLESSVPVSESLQSIHN 420

Query: 421 QLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQGTLNAL 480
           QLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQGTLNAL
Sbjct: 421 QLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQGTLNAL 480

Query: 481 LAECFDIMHXXXXXXXXXXXXXXXXXXXNPQPIARTFGDNGDYEVDYDNFEEEE 534
           LAECFDIMH                   NPQPIARTFGDNGDYEVDYDNFEEEE
Sbjct: 481 LAECFDIMHELEIEAEERADNEEEEESENPQPIARTFGDNGDYEVDYDNFEEEE 534

>TPHA0C01610 Chr3 (373462..375117) [1656 bp, 551 aa] {ON} Anc_7.125
           YPL260W
          Length = 551

 Score =  659 bits (1701), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 334/492 (67%), Positives = 385/492 (78%), Gaps = 8/492 (1%)

Query: 6   SVASTADLSKYMYGVPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKV 65
           ++ S  D  +  YGVP+ E  ILKYL+DVR +L +LKTNRS++LNSKEV+ LHQEVLTKV
Sbjct: 3   NITSVTDFKEMSYGVPESEHDILKYLIDVRVRLTQLKTNRSKYLNSKEVRLLHQEVLTKV 62

Query: 66  RELDDIRK---RQAGEDAVYSK---TMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNS 119
           RELDDIRK   +  G+D   ++   T++ N  LHNKVDSL+DDVFQLLSLCFLTVGLKNS
Sbjct: 63  RELDDIRKSKLKDDGQDDSQTQQITTLLCNLTLHNKVDSLVDDVFQLLSLCFLTVGLKNS 122

Query: 120 APATYSSLSTVQKLLEHLDESNIFTNHDLRPIKDRLDEISTIVENNSYRNYDF--DLTNP 177
           APATY+SLSTVQKLLEHLDESNIFTNHDLRPIK+RLDEIS IV+NNSY+NY+F  D  NP
Sbjct: 123 APATYTSLSTVQKLLEHLDESNIFTNHDLRPIKERLDEISKIVQNNSYKNYEFNEDEINP 182

Query: 178 ADETEEKRNKNKIEEDLLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIXXXXXX 237
               +++  +N IEEDLLLRAKLK C DE+ +IHSKLEEI PEL+SIMEKLYHI      
Sbjct: 183 NQVDDDEIKQNLIEEDLLLRAKLKFCNDEFARIHSKLEEIDPELNSIMEKLYHIRRNLLS 242

Query: 238 XXXXXXKIDTREDFSQFNXXXXXXXXXXXXXXXXXXXXXHRDENGNFKSLETGEVVLKGQ 297
                 KIDT E+ S FN                     HRDE+GNFKSLET EV LKGQ
Sbjct: 243 LASPTHKIDTTENISIFNNNEESRKMLKHLSDELTELETHRDEDGNFKSLETNEVKLKGQ 302

Query: 298 NVLAGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRDTD 357
           N LAGLVDNCHDLINDF NS   + ++D  L+PIY+ LINIKTNLANLMITRRWTLR+TD
Sbjct: 303 NALAGLVDNCHDLINDFTNSSGDNQILDKNLQPIYNNLINIKTNLANLMITRRWTLRETD 362

Query: 358 LFQYQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKXXXXXXXXXXXXXX 417
           LFQYQK+L+ ID++RVNGKFP++SG+TKGQ+ILLYLLRRCYAIIYK              
Sbjct: 363 LFQYQKRLKEIDDQRVNGKFPSESGNTKGQSILLYLLRRCYAIIYKLLESSEPVSESLQP 422

Query: 418 IHNQLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQGTL 477
           IHNQLST RRCLL+LKRMGGVNS RELYPYQLKLASLDELRIDGKF+D++GEIPEGQGTL
Sbjct: 423 IHNQLSTTRRCLLALKRMGGVNSPRELYPYQLKLASLDELRIDGKFYDSSGEIPEGQGTL 482

Query: 478 NALLAECFDIMH 489
           NALLAECFD++H
Sbjct: 483 NALLAECFDMLH 494

>Smik_6.467 Chr6 complement(770217..771863) [1647 bp, 548 aa] {ON}
           YPL260W (REAL)
          Length = 548

 Score =  576 bits (1484), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/494 (61%), Positives = 355/494 (71%), Gaps = 24/494 (4%)

Query: 20  VPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRKRQAGED 79
           VPKEEESIL YLL+VR+ LAKLK NR+Q+LNSK+VQ  +Q VLTKVRELDDIRK      
Sbjct: 13  VPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNSHETP 72

Query: 80  AVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKLLEHLDE 139
           A  + T+IHN  LHN+VDS+LDDVFQLLSLCFLTVGLKNSAPATY+SLSTV+ LLEHL+E
Sbjct: 73  AKSAATLIHNTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLEHLNE 132

Query: 140 SNIFTNHDLRPIKDRLDEISTIVEN-NSYRNYDFDLTNPA-DETEEKRNKNKIEEDLLLR 197
           SN+FT+HDL PIK+RLDEIS IVE  NS   Y+ D  +    E + +R KNKIEEDLLLR
Sbjct: 133 SNVFTHHDLSPIKERLDEISKIVEQKNSSSTYNEDGNDDRLREIDNERKKNKIEEDLLLR 192

Query: 198 AKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIXXXXXXXXXXXXKIDTR--------- 248
           AKLKHC DEY+ + SKLEEI P LSS+MEKL+ I            K  ++         
Sbjct: 193 AKLKHCKDEYDTLESKLEEIDPSLSSVMEKLFRIRRGLLSLVASAKKTMSKSSANINSLL 252

Query: 249 --EDFSQFN-----------XXXXXXXXXXXXXXXXXXXXXHRDENGNFKSLETGEVVLK 295
             ++ SQ N                                +RD++G FKSLET +V + 
Sbjct: 253 REQNDSQANNNGLMDDKHLVSQEYVHEKLSVLKDELNELESNRDDSGKFKSLETHQVAVN 312

Query: 296 GQNVLAGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRD 355
           GQ+VL GL+D+CHDLIND ++  NG   +DP L+PIY++LI+IKT L NLMITRRWTLR+
Sbjct: 313 GQSVLNGLLDDCHDLINDLSHQTNGGLSLDPYLQPIYEQLIDIKTTLENLMITRRWTLRE 372

Query: 356 TDLFQYQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKXXXXXXXXXXXX 415
           TDLF YQKKL  IDNKR+NGKFPTKS D+KGQ+ILLYLLRRCYAIIYK            
Sbjct: 373 TDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLLESSEPVSEAL 432

Query: 416 XXIHNQLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQG 475
             IHNQLST RRCLL LKRMGGVN+ERELYPYQ+KLASLD LR DG F+D++G IPEGQG
Sbjct: 433 QPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFYDSDGNIPEGQG 492

Query: 476 TLNALLAECFDIMH 489
            LNALLAECFDI+H
Sbjct: 493 ILNALLAECFDILH 506

 Score = 51.2 bits (121), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 62/111 (55%), Gaps = 7/111 (6%)

Query: 295 KGQNVLAGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLR 354
           KGQ++L  L+  C+ +I     S   S+ V   L+PI+++L  ++  L  L + R   + 
Sbjct: 402 KGQSILLYLLRRCYAIIYKLLES---SEPVSEALQPIHNQLSTVRRCL--LELKRMGGVN 456

Query: 355 -DTDLFQYQKKLQAIDNKRVNGKFPTKSGDT-KGQAILLYLLRRCYAIIYK 403
            + +L+ YQ KL ++DN R +G F    G+  +GQ IL  LL  C+ I+++
Sbjct: 457 NERELYPYQMKLASLDNLRTDGIFYDSDGNIPEGQGILNALLAECFDILHE 507

>TDEL0H02870 Chr8 (477363..479126) [1764 bp, 587 aa] {ON} Anc_7.125
           YPL260W
          Length = 587

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/493 (60%), Positives = 363/493 (73%), Gaps = 10/493 (2%)

Query: 6   SVASTADLSKYMYGVPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKV 65
           S+   A  S++   VPKEEESIL YLL VR  L +LK NR Q+LNSKEVQN++Q+VLTKV
Sbjct: 4   SLPVAASNSQHPQDVPKEEESILNYLLGVRNLLGQLKQNRRQYLNSKEVQNIYQQVLTKV 63

Query: 66  RELDDIRKRQAGEDAVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYS 125
           RELD IRK      +  + T+IH+  LHN+VDS+LDDVFQLLSLCFLTVGLKNSAPATY+
Sbjct: 64  RELDQIRKSNHDTPSNSATTLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYA 123

Query: 126 SLSTVQKLLEHLDESNIFTNHDLRPIKDRLDEISTIVENNSYRNY-------DFDLTNPA 178
           SLSTVQ+LLEHL+ESN+FT HDLRPI++RL EIS IVEN+SY+N        D D   P 
Sbjct: 124 SLSTVQRLLEHLNESNVFTQHDLRPIRERLLEISKIVENSSYKNEVSGDNLEDIDEKLPE 183

Query: 179 DETE--EKRNKNKIEEDLLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIXXXXX 236
            + +  E+RNKNKIEEDLLLRAKL+HCLDEY+   SK+EEI P L++IMEKL+ I     
Sbjct: 184 ADRKFYEERNKNKIEEDLLLRAKLQHCLDEYHSTESKVEEIDPHLTTIMEKLFEIRRGLL 243

Query: 237 XXXXXXXKIDTREDFSQFNXXXXXXXXXXXXXXXXXXXXXHRDENGNFKSLETGEVVLKG 296
                  + +   + S  +                     HRDENG FKSLET +V  KG
Sbjct: 244 SLAASSKRSNPSLEKSPLSQEHVHEQVEKLESQLTELES-HRDENGKFKSLETDKVEDKG 302

Query: 297 QNVLAGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRDT 356
           QNVL GL+D+CHDLI+D ++  NG   +D +L+PIY++LI+IKT+L NL++TRRWTLR+T
Sbjct: 303 QNVLNGLLDDCHDLISDLSHQKNGGIELDAKLQPIYEQLIDIKTSLENLLVTRRWTLRET 362

Query: 357 DLFQYQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKXXXXXXXXXXXXX 416
           DLF +QK+L  ID+ RV+GKFPT SG +KGQ+ILLYLLRRC+AIIYK             
Sbjct: 363 DLFTFQKQLSEIDSLRVHGKFPTDSGTSKGQSILLYLLRRCFAIIYKLLESSEPVSESLQ 422

Query: 417 XIHNQLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQGT 476
            IHNQLST RRCLL LKRMGGVN++RELYPYQ+KLASLD+LR DGKF+D++G IPEGQGT
Sbjct: 423 PIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDDLRTDGKFYDSDGNIPEGQGT 482

Query: 477 LNALLAECFDIMH 489
           LNALLAECFDI+H
Sbjct: 483 LNALLAECFDIVH 495

>Suva_16.44 Chr16 (64828..66477) [1650 bp, 549 aa] {ON} YPL260W
           (REAL)
          Length = 549

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/493 (59%), Positives = 350/493 (70%), Gaps = 23/493 (4%)

Query: 20  VPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRKRQAGED 79
           VPKEEESIL YLL+VR+ LAKLK NR+Q+LNSK+VQ  +Q VLTKVRELDDIRK      
Sbjct: 13  VPKEEESILNYLLEVRSTLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNSHDTP 72

Query: 80  AVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKLLEHLDE 139
           A  + T+IH+  LHN+VDS+LDDVFQL+SLCFLTVGLKNSAPATY+SLSTV+ LLEHL+E
Sbjct: 73  AKSAATLIHSTELHNRVDSVLDDVFQLISLCFLTVGLKNSAPATYASLSTVESLLEHLNE 132

Query: 140 SNIFTNHDLRPIKDRLDEISTIVENNSYRNYDFDLTNPA-DETEEKRNKNKIEEDLLLRA 198
           SN+FT+HDL PIK+RL+EI  IVE N+  NYD D  +    E + +RNKN+IEEDLLLRA
Sbjct: 133 SNVFTHHDLSPIKERLEEIRKIVEKNTGPNYDEDGNDDQLREIDNERNKNRIEEDLLLRA 192

Query: 199 KLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIXXXXXXXXXXXXKIDTRE--------- 249
           KLKHC DEY+ + SKLEEI P LS++MEKL+ I            K  ++          
Sbjct: 193 KLKHCKDEYDTLESKLEEIDPSLSTVMEKLFKIRRGLLSLVASAKKTMSQSNVNISSLLQ 252

Query: 250 -------------DFSQFNXXXXXXXXXXXXXXXXXXXXXHRDENGNFKSLETGEVVLKG 296
                        D                          +RDE+G FKSLE+ +V   G
Sbjct: 253 KHNDLETNNNDLMDDKHLVSQEYVNEKLTALKNELNELESNRDESGKFKSLESHKVAENG 312

Query: 297 QNVLAGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRDT 356
           Q+VL GL+D+CHDL+ND ++  NG   +DP L+PIY++LI+IKT L NLMITRRWTLR+T
Sbjct: 313 QSVLNGLLDDCHDLVNDLSHQTNGGLTLDPTLQPIYEQLIDIKTTLENLMITRRWTLRET 372

Query: 357 DLFQYQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKXXXXXXXXXXXXX 416
           DLF YQKKL  ID+KRV GKFPTK+ D+KGQ+ILLYLLRRCYAIIYK             
Sbjct: 373 DLFSYQKKLNEIDSKRVKGKFPTKTQDSKGQSILLYLLRRCYAIIYKLLESSEPVSEALQ 432

Query: 417 XIHNQLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQGT 476
            +HNQLST RRCLL LKRMGGVN+ERELYPYQ+KLASLD LR DG F+D++G IPEGQG 
Sbjct: 433 PVHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTDGIFYDSDGNIPEGQGI 492

Query: 477 LNALLAECFDIMH 489
           LNALLAECFDIMH
Sbjct: 493 LNALLAECFDIMH 505

>Skud_16.18 Chr16 (28372..30024) [1653 bp, 550 aa] {ON} YPL260W
           (REAL)
          Length = 550

 Score =  570 bits (1468), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/494 (60%), Positives = 351/494 (71%), Gaps = 24/494 (4%)

Query: 20  VPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRKRQAGED 79
           VPKEEESIL YLL+VR+ LAKLK NR+Q+LNSK+VQ  +Q VLTKVRELDDIRK      
Sbjct: 12  VPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNSHDTP 71

Query: 80  AVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKLLEHLDE 139
           A  + T+IH+  LHN+VDS+LDDVFQLLSLCFLTVGLKNSAPATY+SLSTV+ LLEHL+E
Sbjct: 72  AKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLEHLNE 131

Query: 140 SNIFTNHDLRPIKDRLDEISTIVEN-NSYRNYDFDLTNP-ADETEEKRNKNKIEEDLLLR 197
           SN+FT+HDL PIK+RLDEIS IVE  NS   Y+ D  +    E + +R +NKIEEDLLLR
Sbjct: 132 SNVFTHHDLSPIKERLDEISKIVEQKNSSPMYEEDANDARIREIDNERKQNKIEEDLLLR 191

Query: 198 AKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIXXXXXXXXXXXXKIDTRED------F 251
           AKLKHC DEY+ + SKLEEI P LS++MEKL+ I            K  ++         
Sbjct: 192 AKLKHCKDEYDTLESKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKTMSKSSANINSLL 251

Query: 252 SQFNXXXXXXXXXXXXXXXXXXXXXH----------------RDENGNFKSLETGEVVLK 295
            + N                     H                RD++G FKSLET EV  K
Sbjct: 252 QEHNDLQANDNDLMDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKFKSLETHEVTEK 311

Query: 296 GQNVLAGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRD 355
           GQ+VL GL+D+CHDLI+D ++  NG   +DP L+P Y++LI+IKT L NLMITRRWTLR+
Sbjct: 312 GQSVLNGLLDDCHDLISDLSHQTNGGLALDPHLQPTYEQLIDIKTTLENLMITRRWTLRE 371

Query: 356 TDLFQYQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKXXXXXXXXXXXX 415
           TDLF YQKKL  ID+KR+NGKFPTKS D+KGQ+ILLYLLRRCYAIIYK            
Sbjct: 372 TDLFSYQKKLNEIDSKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLLESSEPVSEAL 431

Query: 416 XXIHNQLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQG 475
             IHNQLST RRCLL LKRMGGVN+ERELYPYQ+KLASLD LR +G F+D++G IPEGQG
Sbjct: 432 QPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTNGIFYDSDGNIPEGQG 491

Query: 476 TLNALLAECFDIMH 489
            LNALLAECFDIMH
Sbjct: 492 ILNALLAECFDIMH 505

>YPL260W Chr16 (49303..50958) [1656 bp, 551 aa] {ON} Putative
           substrate of cAMP-dependent protein kinase (PKA); green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; YPL260W is not an essential
           gene
          Length = 551

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/494 (60%), Positives = 353/494 (71%), Gaps = 24/494 (4%)

Query: 20  VPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRKRQAGED 79
           VPKEEESIL YLL+VR+ LAKLK NR+Q+LNSK+VQ  +Q VLTKVRELDDIRK      
Sbjct: 13  VPKEEESILNYLLEVRSSLAKLKQNRTQYLNSKDVQTTYQHVLTKVRELDDIRKNSHETP 72

Query: 80  AVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKLLEHLDE 139
           A  + T+IH+  LHN+VDS+LDDVFQLLSLCFLTVGLKNSAPATY+SLSTV+ LLEHL+E
Sbjct: 73  AKSAATLIHSTELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLEHLNE 132

Query: 140 SNIFTNHDLRPIKDRLDEISTIVEN-NSYRNYDFDLTNPA-DETEEKRNKNKIEEDLLLR 197
           SN+FT+HDL PIK+RL+EIS IVE  NS   YD D  +    E + +R KNKIEEDLLLR
Sbjct: 133 SNVFTHHDLSPIKERLEEISKIVEQKNSSPAYDEDGNDDRLREIDNERKKNKIEEDLLLR 192

Query: 198 AKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIXXXXXXXXXXXXKIDTREDFS----- 252
           AKLKHC DEY+ +  KLEEI P LS++MEKL+ I            K  ++ D +     
Sbjct: 193 AKLKHCKDEYDILEGKLEEIDPSLSTVMEKLFRIRRGLLSLVASAKKTMSKSDINTNSLL 252

Query: 253 -QFNXXXXXXXXXXXXXXXXXXXXXH----------------RDENGNFKSLETGEVVLK 295
            + N                     H                RD++G FKSLE+ +V  K
Sbjct: 253 QEQNDLQTNNESLTDDKHLVSQEYVHEKLSVLKNELSELESNRDDSGKFKSLESHQVAEK 312

Query: 296 GQNVLAGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRD 355
           GQ+VL GL+D+CHDL+ND ++  NG   +DP L+PIY++LI+IKT L NLMITRRWTLR+
Sbjct: 313 GQSVLNGLLDDCHDLVNDLSHQKNGGLTLDPYLQPIYEQLIDIKTTLENLMITRRWTLRE 372

Query: 356 TDLFQYQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKXXXXXXXXXXXX 415
           TDLF YQKKL  IDNKR+NGKFPTKS D+KGQ+ILLYLLRRCYAIIYK            
Sbjct: 373 TDLFSYQKKLNEIDNKRINGKFPTKSQDSKGQSILLYLLRRCYAIIYKLLESSEPVSEAL 432

Query: 416 XXIHNQLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQG 475
             IHNQLST RRCLL LKRMGGVN+ERELYPYQ+KLASLD LR +G F+D++G IPEGQG
Sbjct: 433 QPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRTEGIFYDSDGNIPEGQG 492

Query: 476 TLNALLAECFDIMH 489
            LNALLAECFDI+H
Sbjct: 493 ILNALLAECFDILH 506

 Score = 50.4 bits (119), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 36/111 (32%), Positives = 61/111 (54%), Gaps = 7/111 (6%)

Query: 295 KGQNVLAGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLR 354
           KGQ++L  L+  C+ +I     S   S+ V   L+PI+++L  ++  L  L + R   + 
Sbjct: 402 KGQSILLYLLRRCYAIIYKLLES---SEPVSEALQPIHNQLSTVRRCL--LELKRMGGVN 456

Query: 355 -DTDLFQYQKKLQAIDNKRVNGKFPTKSGDT-KGQAILLYLLRRCYAIIYK 403
            + +L+ YQ KL ++DN R  G F    G+  +GQ IL  LL  C+ I+++
Sbjct: 457 NERELYPYQMKLASLDNLRTEGIFYDSDGNIPEGQGILNALLAECFDILHE 507

>SAKL0F05390g Chr6 complement(416314..418101) [1788 bp, 595 aa] {ON}
           highly similar to gnl|GLV|CAGL0H09108g Candida glabrata
           CAGL0H09108g and similar to Q08977 YPL260W
           uniprot|Q7LGU3 Saccharomyces cerevisiae Hypothetical ORF
          Length = 595

 Score =  564 bits (1453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/496 (59%), Positives = 353/496 (71%), Gaps = 20/496 (4%)

Query: 14  SKYMYGVPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRK 73
           S +   VPKEEE IL Y LDVR+ L+KLK NRSQFLNSK+V   +Q+VLTKVRELDD RK
Sbjct: 3   SNHPQEVPKEEEEILNYFLDVRSFLSKLKQNRSQFLNSKDVMETYQQVLTKVRELDDTRK 62

Query: 74  RQAGEDAVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKL 133
                 A  + T+IH+  LHN+VDS+LDDVFQLLSL FLTVGLKNSAPATY+SLSTVQ+L
Sbjct: 63  SSHNTPASSATTLIHSVDLHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQRL 122

Query: 134 LEHLDESNIFTNHDLRPIKDRLDEISTIVENNSYRNYDFDLTNPADETEEK--------- 184
           LEHL+ESN+FT+HDLRPIK+RLDE+S IVE NSYRN   +      E E +         
Sbjct: 123 LEHLNESNVFTHHDLRPIKERLDEVSEIVEKNSYRNEPENNKGKPQEPEAQEDEQDIELK 182

Query: 185 -----RNKNKIEEDLLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIXXXXXXXX 239
                ++KNK+EEDLLLRAKLKHCL EY  I SKLEEI P L SIMEKL+ I        
Sbjct: 183 KADIEKDKNKVEEDLLLRAKLKHCLQEYFNIESKLEEIDPALQSIMEKLFQIRRGLLSLA 242

Query: 240 XXXXK----IDTREDFSQFNXXXX--XXXXXXXXXXXXXXXXXHRDENGNFKSLETGEVV 293
               +     ++ ED  + +                       HRD +G FKSLET +V 
Sbjct: 243 ASTKRNARSKESLEDKKRTHTVSPNFVNSKLNELQVELSELESHRDPSGKFKSLETDKVE 302

Query: 294 LKGQNVLAGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTL 353
            +GQ+VL GL+D+CHDLIND ++  +    +D +L+PIYD LI+IKT L NL++TRRWTL
Sbjct: 303 ERGQSVLNGLLDDCHDLINDLSHQTSRGISLDHKLQPIYDNLIDIKTTLENLLVTRRWTL 362

Query: 354 RDTDLFQYQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKXXXXXXXXXX 413
           R+TDLF YQK+L  IDN RV+GKFPT+SGD+KGQ+ILLYLLRRCYAIIYK          
Sbjct: 363 RETDLFTYQKRLGEIDNLRVHGKFPTESGDSKGQSILLYLLRRCYAIIYKLLESSEPVSE 422

Query: 414 XXXXIHNQLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEG 473
               IHNQLST RRCLL LKRMGGVN++RELYPYQ+KLASLD +R+DGKF+DA+G IPEG
Sbjct: 423 ALQRIHNQLSTVRRCLLELKRMGGVNNDRELYPYQMKLASLDNMRVDGKFYDADGNIPEG 482

Query: 474 QGTLNALLAECFDIMH 489
           QGTLNALLAECFDI+H
Sbjct: 483 QGTLNALLAECFDILH 498

>NCAS0E02130 Chr5 (408158..409738) [1581 bp, 526 aa] {ON} Anc_7.125
           YPL260W
          Length = 526

 Score =  557 bits (1435), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/486 (60%), Positives = 346/486 (71%), Gaps = 20/486 (4%)

Query: 20  VPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRKRQAGED 79
           VPKEEE IL YLLDVR+ L+KLK NR+Q+LNSK+VQ  +Q VLTKVRELD+IRK      
Sbjct: 14  VPKEEEDILNYLLDVRSFLSKLKQNRTQYLNSKDVQITYQNVLTKVRELDEIRKNSHDTP 73

Query: 80  AVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKLLEHLDE 139
           +  + T+IH+  LHN+VDS+LDDVFQLLSLCFLTVGLKNSAPATY+SLSTVQ LLEHL E
Sbjct: 74  SKSATTLIHSNELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQSLLEHLSE 133

Query: 140 SNIFTNHDLRPIKDRLDEISTIVENNSYRNYDFDLTNPADET----EEKRNKNKIEEDLL 195
           SNIFT+HDL PIKDRL+EIS IVE +  +  D  L +  ++     + +RNKNKIE+DLL
Sbjct: 134 SNIFTHHDLSPIKDRLNEISKIVEKSCGKLPDEQLNDDEEQNLKDIDTERNKNKIEQDLL 193

Query: 196 LRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIXXXXXXXXXXXXK----------- 244
           LRAKL+HCLDEY +I SKLEEI P L+S MEKL+ I            K           
Sbjct: 194 LRAKLQHCLDEYKQIESKLEEIDPSLTSTMEKLFQIRRGLLSLAASTKKNMNQGSLTSEK 253

Query: 245 -IDTREDFSQFNXXXXXXXXXXXXXXXXXXXXXHRDENGNFKSLETGEVVLKGQNVLAGL 303
            ++ +   SQ                       +RDE+G FKSLET EV   GQNVL GL
Sbjct: 254 ELENKHLVSQ----EYVNKKLHALEAEVQALEANRDESGKFKSLETNEVAENGQNVLNGL 309

Query: 304 VDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRDTDLFQYQK 363
           +D+C DLIND ++  NG   +DP L+PIY+ LI+IKT L NLMITRRWTLR+TDLF YQK
Sbjct: 310 LDDCLDLINDLSHQTNGHLNLDPTLQPIYEMLIDIKTTLENLMITRRWTLRETDLFTYQK 369

Query: 364 KLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKXXXXXXXXXXXXXXIHNQLS 423
           +L  IDN RV G+FPTK  D+KGQ ILLYLLRRCYAIIYK              IHNQLS
Sbjct: 370 QLGEIDNMRVEGRFPTKHIDSKGQFILLYLLRRCYAIIYKLLESSEPVSESLQPIHNQLS 429

Query: 424 TARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQGTLNALLAE 483
           T RRCL+ LKRMGGV+++RELYPYQ+KLASLD LR+DGKF+D+ G IPEGQGTLNALLA 
Sbjct: 430 TVRRCLMELKRMGGVDNDRELYPYQMKLASLDNLRVDGKFYDSEGNIPEGQGTLNALLAA 489

Query: 484 CFDIMH 489
           CFDIMH
Sbjct: 490 CFDIMH 495

>NDAI0E03670 Chr5 (792667..794235) [1569 bp, 522 aa] {ON} Anc_7.125
           YPL260W
          Length = 522

 Score =  553 bits (1426), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/480 (60%), Positives = 345/480 (71%), Gaps = 10/480 (2%)

Query: 20  VPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRKRQAGED 79
           VPKEEE ILKYLLDVR  L  LK NR+Q+LNS+ VQ  +QEVLTKVRELD+IRK      
Sbjct: 18  VPKEEEGILKYLLDVRNYLQNLKRNRTQYLNSQAVQKTYQEVLTKVRELDEIRKNNHATP 77

Query: 80  AVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKLLEHLDE 139
           +  + T+IH+  LHN+VDS+LDDVFQLLSLCFLTVGLKNSAPATY+SLSTVQ LLEHL+E
Sbjct: 78  SNSATTLIHSMELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQSLLEHLNE 137

Query: 140 SNIFTNHDLRPIKDRLDEISTIVENNSYRNYDFD------LTNPADETEEKRNKNKIEED 193
           SNIFT+HDL PIK+RLD+IS IVE +  +    D           DETE ++N+NKIE+D
Sbjct: 138 SNIFTHHDLGPIKERLDQISKIVEESCSQEIKLDNEGDDQFNQYLDETELEQNQNKIEQD 197

Query: 194 LLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIXXXXXXXXXXXXK---IDTRE- 249
           LLLRAKL+HCLDEY++I SKLEEI P L+SI+EKL+ I            K   +  +E 
Sbjct: 198 LLLRAKLQHCLDEYHEIESKLEEIDPSLNSILEKLFQIRRGLLSLVASAKKNSLLSQKEL 257

Query: 250 DFSQFNXXXXXXXXXXXXXXXXXXXXXHRDENGNFKSLETGEVVLKGQNVLAGLVDNCHD 309
           D                          +RDE G FKSLETGE+   GQNVL GL D+C+D
Sbjct: 258 DEKHLISPEYLNKKLLELEKEFKDLESNRDEFGKFKSLETGEIPENGQNVLKGLEDDCND 317

Query: 310 LINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRDTDLFQYQKKLQAID 369
           LIND ++  NG   +DP+L+P+Y++LI IKT L  LMITRRWTLR+TDLF YQKKL  ID
Sbjct: 318 LINDLSHQTNGRLTLDPDLQPVYEQLIEIKTTLEKLMITRRWTLRETDLFTYQKKLGEID 377

Query: 370 NKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKXXXXXXXXXXXXXXIHNQLSTARRCL 429
           N RV GKFP+KS D+KGQ I+LYLLRRCYAIIYK              IHNQLST RRCL
Sbjct: 378 NLRVKGKFPSKSSDSKGQFIILYLLRRCYAIIYKLLECSEPVSESLQPIHNQLSTVRRCL 437

Query: 430 LSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQGTLNALLAECFDIMH 489
           L +KR+GGV++ERELYPYQ+KLASLD LR DG F+D++G IPEGQGTLNALLA CFDI+H
Sbjct: 438 LDIKRLGGVSNERELYPYQMKLASLDNLRKDGIFYDSDGNIPEGQGTLNALLAACFDIVH 497

>KLLA0D14355g Chr4 complement(1219658..1221424) [1767 bp, 588 aa]
           {ON} similar to uniprot|Q08977 YPL260W Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/495 (57%), Positives = 349/495 (70%), Gaps = 24/495 (4%)

Query: 19  GVPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRKRQAGE 78
            VP EEE IL Y LDVR+ L+K+K NRSQFLNSK+V + +Q+VLTKVRELD++RK     
Sbjct: 9   AVPHEEEEILTYFLDVRSFLSKMKQNRSQFLNSKDVMDTYQKVLTKVRELDELRKNSHAT 68

Query: 79  DAVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKLLEHLD 138
            +  + T+IH+  LHN+VDS++DDVFQLLSL FLTVGLKNSAPATY+SLSTVQ LLEHL+
Sbjct: 69  PSNSATTLIHSSELHNRVDSVIDDVFQLLSLSFLTVGLKNSAPATYASLSTVQSLLEHLN 128

Query: 139 ESNIFTNHDLRPIKDRLDEISTIVENNSY-RNYDFDLTNP--------ADETEEKRNKNK 189
           ESN++T+HDLRPIK+RL+E+S IVE N Y  N D    N         A + +E+ NKNK
Sbjct: 129 ESNVYTHHDLRPIKERLNEVSAIVEQNKYVSNSDTQSVNADADDIGEFALQKDEELNKNK 188

Query: 190 IEEDLLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIXXXXXXXXXXXXKIDTRE 249
           IEEDLLLRAKLKHC+DEYN I SKLEEI P+L S ME L+ I            +   ++
Sbjct: 189 IEEDLLLRAKLKHCIDEYNAIESKLEEIHPDLQSTMEALFQIRRGLLSLASSTKRPHQKQ 248

Query: 250 ---DFSQFNXXXXXXXXX------------XXXXXXXXXXXXHRDENGNFKSLETGEVVL 294
              D +  +                                 HRD NG FKSLET +V  
Sbjct: 249 LVPDPAVLSVESEASEKKNVLPDQVIDEKLKQLQEQLEKLESHRDINGKFKSLETDKVEE 308

Query: 295 KGQNVLAGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLR 354
           KGQNVL GL+D+CHDL+ND ++  +G   +D +L+PIYD+L++IKT L NL++TRRWTLR
Sbjct: 309 KGQNVLNGLLDDCHDLVNDLSHQKDGGISLDTKLQPIYDQLVDIKTTLENLLVTRRWTLR 368

Query: 355 DTDLFQYQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKXXXXXXXXXXX 414
           +TDLF YQKKL  IDN RVNGKFPT   D+KGQ+ILLYLLRRCYAIIYK           
Sbjct: 369 ETDLFTYQKKLGEIDNLRVNGKFPTDHPDSKGQSILLYLLRRCYAIIYKLLESSEPVSES 428

Query: 415 XXXIHNQLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQ 474
              +HNQLST RRCLL LKRMGGV+++RELYPYQ+KLASLD +R+DGKF+D +G IPEGQ
Sbjct: 429 LQRVHNQLSTVRRCLLELKRMGGVDNDRELYPYQMKLASLDNMRVDGKFYDTDGNIPEGQ 488

Query: 475 GTLNALLAECFDIMH 489
           GTLNALLAECFDI+H
Sbjct: 489 GTLNALLAECFDIIH 503

>CAGL0H09108g Chr8 (889038..890636) [1599 bp, 532 aa] {ON} highly
           similar to uniprot|Q08977 Saccharomyces cerevisiae
           YPL260w
          Length = 532

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/481 (59%), Positives = 345/481 (71%), Gaps = 12/481 (2%)

Query: 20  VPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRKRQ--AG 77
           VPKEEE IL YLL+VR+ L+KLK NR+Q+LNSK+V N +QEVLT+VRELD IRK      
Sbjct: 17  VPKEEEGILNYLLEVRSFLSKLKKNRTQYLNSKDVLNTYQEVLTRVRELDGIRKSSTDVT 76

Query: 78  EDAVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKLLEHL 137
                + T+IH+  +HN+VDS+LDDVFQLLSLCFLTVGLKNSAPATY+SLSTVQ LLEHL
Sbjct: 77  RRPTCATTLIHDTDMHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVQCLLEHL 136

Query: 138 DESNIFTNHDLRPIKDRLDEISTIVENNSYRNYDFDLTNPADETEEKRNKNKIEEDLLLR 197
            ESN+FT+HDLRPIK+RLDEIS IVE  S  +   D      E + +RNKN+IE+DLLL+
Sbjct: 137 CESNVFTHHDLRPIKERLDEISKIVEK-SVESRPEDEVAEFKEIDTERNKNRIEQDLLLK 195

Query: 198 AKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIXXXXXXXXXXXXKIDTREDFSQ---- 253
           AKL+HC+DEYNK+ SKLEEI P+LS IME+L+ +            K    E++ +    
Sbjct: 196 AKLQHCIDEYNKLESKLEEIPPDLSDIMERLFKVRRGLLSLAASSKKNIPDENYKEPAKL 255

Query: 254 -----FNXXXXXXXXXXXXXXXXXXXXXHRDENGNFKSLETGEVVLKGQNVLAGLVDNCH 308
                                        RDENG F S  TG+   +GQN+L GL+D+C+
Sbjct: 256 DDSKHVLSQEYLSNSLEKYKKEVAKMEAMRDENGQFVSKSTGKAEQRGQNILNGLLDDCN 315

Query: 309 DLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRDTDLFQYQKKLQAI 368
           DLIND ++  NG   +DP L+PIY++LI+IKT L NLMITRRWTLR+TDLF YQK+L  I
Sbjct: 316 DLINDLSHQTNGGLTLDPYLQPIYEKLIDIKTTLENLMITRRWTLRETDLFTYQKQLTEI 375

Query: 369 DNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKXXXXXXXXXXXXXXIHNQLSTARRC 428
           DN RV+GKFPTKS D+KGQ+I+LYLLRRCYAIIYK              +HNQLST RRC
Sbjct: 376 DNMRVHGKFPTKSPDSKGQSIILYLLRRCYAIIYKLLESSEPVSESLQPVHNQLSTVRRC 435

Query: 429 LLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQGTLNALLAECFDIM 488
           LL LKRMGGVN+ERELYPYQ+KLASLD LR DGKF+D++G IPEGQG LNALLA CFDI+
Sbjct: 436 LLELKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSDGNIPEGQGILNALLAGCFDIL 495

Query: 489 H 489
           H
Sbjct: 496 H 496

>TBLA0A00930 Chr1 (206453..208213) [1761 bp, 586 aa] {ON} Anc_7.125
           YPL260W
          Length = 586

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/486 (57%), Positives = 351/486 (72%), Gaps = 16/486 (3%)

Query: 20  VPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRKRQAGED 79
           VP EEE IL +LL+VRA+LAKLK NR+QFLN+K+VQ  +Q VLTKVRELD+IRK      
Sbjct: 18  VPNEEEDILNFLLEVRAELAKLKQNRTQFLNAKQVQITYQSVLTKVRELDEIRKNSLTTP 77

Query: 80  AVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKLLEHLDE 139
           A  + T+IH+  LHN+VDS+LDDVFQLLSLCFLTVG+KNSAPATYSSLSTVQ LLEHL+E
Sbjct: 78  AKTATTLIHDSQLHNRVDSVLDDVFQLLSLCFLTVGMKNSAPATYSSLSTVQCLLEHLNE 137

Query: 140 SNIFTNHDLRPIKDRLDEISTIVENNSYRNYDFDLTNPAD---------ETEEKRNKNKI 190
           S +FT HDLRPIK+RLDEI  IVE +SYRN +F+ +             E E +R +N+I
Sbjct: 138 SRMFTMHDLRPIKERLDEIQEIVEKSSYRNDEFNDSALVGLSKQEHELIEIENERTRNRI 197

Query: 191 EEDLLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIXXXXXXXXXXXXKIDTRED 250
           EEDLL+RAKL+ C++++N++ S+LE+I+P LSSI++KLYHI               ++ D
Sbjct: 198 EEDLLVRAKLQFCIEQFNQMESRLEKINPNLSSIVDKLYHIRRGLLSLASPTNDTLSKSD 257

Query: 251 FSQF-------NXXXXXXXXXXXXXXXXXXXXXHRDENGNFKSLETGEVVLKGQNVLAGL 303
            +         +                      RDENG +KSLET +V ++GQ ++  L
Sbjct: 258 NNHIASTNHNVSDKSHKELVLLKMKKQLVEIESQRDENGYYKSLETNKVEMEGQGIVNKL 317

Query: 304 VDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRDTDLFQYQK 363
           VD+C+DLIND +++ NG+ + DP L+ IY  LI+IKTNLANLM+TRRWTLR+TDLF YQK
Sbjct: 318 VDDCNDLINDLSHTQNGNIITDPYLQQIYKNLIDIKTNLANLMVTRRWTLRETDLFSYQK 377

Query: 364 KLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKXXXXXXXXXXXXXXIHNQLS 423
           KL  ID+ RVNGKF + + D KGQ+I+LYLLRRCYAIIYK              IH QLS
Sbjct: 378 KLAEIDSLRVNGKFKSATSDAKGQSIILYLLRRCYAIIYKLLESSEPISESLQSIHTQLS 437

Query: 424 TARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQGTLNALLAE 483
           T RRCL++LKR+GGV   +ELYPYQ+KLASLDELRIDGKF+DANG+IPEGQG LNA+LAE
Sbjct: 438 TVRRCLMTLKRLGGVTDIKELYPYQMKLASLDELRIDGKFYDANGDIPEGQGILNAMLAE 497

Query: 484 CFDIMH 489
           CFD++H
Sbjct: 498 CFDMVH 503

>Kwal_55.20832 s55 (577146..578873) [1728 bp, 575 aa] {ON} YPL260W -
           Hypothetical ORF [contig 138] FULL
          Length = 575

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/488 (58%), Positives = 341/488 (69%), Gaps = 15/488 (3%)

Query: 13  LSKYMYGVPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIR 72
           + K+   VP EEE+ L Y L+VR  L++LK NRSQ+LNSKEV + +Q+VLTKVRELD+IR
Sbjct: 1   MHKHPQEVPAEEEASLAYFLEVRNYLSRLKQNRSQYLNSKEVMSAYQQVLTKVRELDEIR 60

Query: 73  KRQAGEDAVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQK 132
           KR        + T+IHN  LHN+VDS+LDDVFQLLSL FLTVGLKNSAPATY+SLSTVQ+
Sbjct: 61  KRSHSAPRNSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQR 120

Query: 133 LLEHLDESNIFTNHDLRPIKDRLDEISTIVENNSY-------RNYDFDLTNPADETEEKR 185
           LLEHLDESN+FT+HDLRPIK+RLDEIS IV  +S+        N   D T  +DE    +
Sbjct: 121 LLEHLDESNVFTHHDLRPIKERLDEISEIVTQSSFFKEGGEINNGSIDFTKISDE----K 176

Query: 186 NKNKIEEDLLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIXXXXXXXXXXXXKI 245
           ++NKIEEDLLLRAKLKHCL EY  I SKLEEI P L   MEKL+ +            + 
Sbjct: 177 DRNKIEEDLLLRAKLKHCLQEYAHIESKLEEIDPRLQKTMEKLFELRRGLLSLAASTKRN 236

Query: 246 DTREDFSQFNXXXXXXXXXXXX----XXXXXXXXXHRDENGNFKSLETGEVVLKGQNVLA 301
              +D  +                            R+ +G F S +TGE+V +GQ+VL 
Sbjct: 237 AMLKDGHKAPESPLSQESVKEKLHSLEAKLTQIESQRNASGYFVSADTGEIVERGQSVLN 296

Query: 302 GLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRDTDLFQY 361
           GL+D+CHDLIND ++  N    +D +L+PIYD LI IKT L NL++TRRWTLR+TDLF Y
Sbjct: 297 GLLDDCHDLINDLSHHANNVVTLDSKLQPIYDNLIEIKTTLENLLVTRRWTLRETDLFAY 356

Query: 362 QKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKXXXXXXXXXXXXXXIHNQ 421
           QK+L  ID  RV GKFPT+SGD KGQAILLYLLRRCYAIIYK              IHNQ
Sbjct: 357 QKRLSEIDKLRVGGKFPTESGDAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIHNQ 416

Query: 422 LSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQGTLNALL 481
           LST RRCLL LKRMGGV ++RELYPYQ+KLASLD +R+DGKF+D +G IPEGQGTLNALL
Sbjct: 417 LSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNALL 476

Query: 482 AECFDIMH 489
           AECFDI+H
Sbjct: 477 AECFDILH 484

>KLTH0F12540g Chr6 (1050879..1052666) [1788 bp, 595 aa] {ON} similar
           to uniprot|Q08977 YPL260W Saccharomyces cerevisiae
           Hypothetical ORF
          Length = 595

 Score =  549 bits (1414), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 286/490 (58%), Positives = 344/490 (70%), Gaps = 20/490 (4%)

Query: 13  LSKYMYGVPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIR 72
           + K+   VP EEES L Y L+VR  L++LK NRSQ+LNSK+V + +Q+VLTKVRELD IR
Sbjct: 1   MPKHPQEVPPEEESSLVYFLEVRNFLSRLKQNRSQYLNSKDVMSTYQQVLTKVRELDAIR 60

Query: 73  KRQAGEDAVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQK 132
           K      A  + T+IHN  LHN+VDS+LDDVFQLLSL FLTVGLKNSAPATY+SLSTVQ+
Sbjct: 61  KSSHHRPANSATTLIHNVELHNRVDSVLDDVFQLLSLSFLTVGLKNSAPATYASLSTVQR 120

Query: 133 LLEHLDESNIFTNHDLRPIKDRLDEISTIVENNSYRNYDFDLTNPAD------ETEEKRN 186
           LLEHLDESN+FT+HDLRPIK+RLDEIS IV  +SY     D T  +D      + +++++
Sbjct: 121 LLEHLDESNVFTHHDLRPIKERLDEISEIVSQSSY----LDGTEISDGRIDFAKIQDEKD 176

Query: 187 KNKIEEDLLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIXXXXXXXXXXXXK-- 244
           +NKIEEDLLLRAKL+HCL EY  I SKLEEI P L S MEKL+ +            +  
Sbjct: 177 RNKIEEDLLLRAKLQHCLQEYEHIESKLEEIDPRLQSTMEKLFQLRRGLLSLAASTKRNA 236

Query: 245 -----IDTREDFSQFNXXXXXXXXXXXXXXXXXXXXXHRDENGNFKSLETGEVVLKGQNV 299
                + T +                           HRD +G F SLETGE+  KGQNV
Sbjct: 237 MSKQGVKTPDSLLP---QEGIKQRLHELEAELTEIESHRDSSGKFVSLETGEIAGKGQNV 293

Query: 300 LAGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRDTDLF 359
           L GL+D+CHDLIND ++  N    +D +L+PIYD LI+IKT L NL++TRRWTLR+TDLF
Sbjct: 294 LNGLLDDCHDLINDLSHHANNFVSLDSKLQPIYDNLIDIKTTLENLLVTRRWTLRETDLF 353

Query: 360 QYQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKXXXXXXXXXXXXXXIH 419
            YQK+L  ID  RV GKFPT++ D KGQAILLYLLRRCYAIIYK              IH
Sbjct: 354 SYQKRLSEIDKLRVGGKFPTENADAKGQAILLYLLRRCYAIIYKLLECSEPVSEALQKIH 413

Query: 420 NQLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQGTLNA 479
           NQLST RRCLL LKRMGGV ++RELYPYQ+KLASLD +R+DGKF+D +G IPEGQGTLNA
Sbjct: 414 NQLSTVRRCLLELKRMGGVENDRELYPYQMKLASLDNVRVDGKFYDEDGNIPEGQGTLNA 473

Query: 480 LLAECFDIMH 489
           LLAECFDI+H
Sbjct: 474 LLAECFDILH 483

>KNAG0L00940 Chr12 (172417..174066) [1650 bp, 549 aa] {ON} Anc_7.125
           YPL260W
          Length = 549

 Score =  534 bits (1375), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/508 (55%), Positives = 348/508 (68%), Gaps = 38/508 (7%)

Query: 20  VPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRKRQAGED 79
           VPKEEE IL Y LDVR  L++LK NR+Q+LNS EVQ  +QEVLTKVRELD IRK+     
Sbjct: 15  VPKEEEGILNYFLDVRTALSQLKKNRTQYLNSGEVQKTYQEVLTKVRELDAIRKKNHDAV 74

Query: 80  AVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKLLEHLDE 139
           A    T+IHN  LHN+VDS+LDDVFQLLSLCFLTVGLKNSAPATY+SLSTV+ LL+HL+E
Sbjct: 75  ATNVPTLIHNADLHNRVDSVLDDVFQLLSLCFLTVGLKNSAPATYASLSTVESLLQHLEE 134

Query: 140 SNIFTNHDLRPIKDRLDEISTIVENNSYRN------YDFDLTNPADETEEKRNKNKIEED 193
           + I+T+HDL+PIKDRL+EIS IVE +  +        + D      + + +R +NK+E++
Sbjct: 135 AKIYTHHDLKPIKDRLNEISKIVEESCAQTNAIQDALENDEEQAIKDIDAERTRNKLEQN 194

Query: 194 LLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIXXXXXXXXXXXXKIDTR---ED 250
           LLL+AKLKHC+D YN++ SKLE+I P L+S+MEKL+ I             +D++   ED
Sbjct: 195 LLLKAKLKHCVDSYNEVESKLEDIDPTLTSVMEKLFQIRRGLLSLVASSRNMDSQISEED 254

Query: 251 F-------SQFNXXXXXXXXXXXXXXXXXXX------------------XXHRDENGNFK 285
                   SQ N                                       HRDE+G FK
Sbjct: 255 LDTSSRTSSQSNIANPLGNELGSEQKKNAISHKLVREKFEVLRNDLKNLEAHRDEDGKFK 314

Query: 286 SLETGEVVLKGQNVLAGLVDNCHDLINDFNN---SGNGSDL-VDPELEPIYDELINIKTN 341
           SLET +V   GQ VL GL+D+C+DL++D ++   +GNG  L +DP L+P+Y+ L+ IKT 
Sbjct: 315 SLETDKVAENGQLVLNGLLDDCNDLVSDLSHQIETGNGLKLSMDPSLQPVYERLLEIKTT 374

Query: 342 LANLMITRRWTLRDTDLFQYQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAII 401
           L NLMITRRWTLR+TDLF YQKKL  IDN RVNG+FPT++ D++GQ+ILLYLLRRCYAII
Sbjct: 375 LENLMITRRWTLRETDLFSYQKKLNEIDNLRVNGRFPTETADSRGQSILLYLLRRCYAII 434

Query: 402 YKXXXXXXXXXXXXXXIHNQLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDG 461
           YK              IHNQLST RRCLL LKRMGGVN+ERELYPYQ+KLASLD LR DG
Sbjct: 435 YKLLESSEPVSEALQPIHNQLSTVRRCLLELKRMGGVNNERELYPYQMKLASLDNLRQDG 494

Query: 462 KFFDANGEIPEGQGTLNALLAECFDIMH 489
            F+D++G IPEGQG LNALLA CFDI+H
Sbjct: 495 IFYDSDGNIPEGQGILNALLAGCFDIIH 522

>ZYRO0C05192g Chr3 (405401..407167) [1767 bp, 588 aa] {ON} similar
           to Q08977 YPL260W uniprot|Q7LGU3 Saccharomyces
           cerevisiae Hypothetical ORF
          Length = 588

 Score =  525 bits (1353), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/494 (55%), Positives = 338/494 (68%), Gaps = 18/494 (3%)

Query: 14  SKYMYGVPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRK 73
           S++   VP+EEE +L Y L++R  L++LK NR+++L+SK+VQ  +++VLT+VRELDD+RK
Sbjct: 13  SQHPQHVPQEEEGVLNYFLEIRTLLSQLKQNRTKYLDSKKVQATYEQVLTRVRELDDVRK 72

Query: 74  RQAGEDAVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKL 133
                 +  + T+IHN  LHN+VDS+LDDVFQLLSLCFLTVGLKNSAPA YSSLSTVQ+L
Sbjct: 73  SNHETPSSSATTLIHNAELHNRVDSVLDDVFQLLSLCFLTVGLKNSAPAAYSSLSTVQRL 132

Query: 134 LEHLDESNIFTNHDLRPIKDRLDEISTIVENNSYRNYDFD------LTNPADETEEKRN- 186
           LEHL+ESN+FT HDLRPIK+RL EI  IVE +  +N +        L N  D  E  RN 
Sbjct: 133 LEHLNESNVFTMHDLRPIKERLIEIKKIVEKSCEKNKEAAKEEEEYLKNAPDLDEADRNL 192

Query: 187 -----KNKIEEDLLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIXXXXXXXXXX 241
                +NKIEEDLLLRAKL+HCLDEY    +K+E + P LS+IM+KL+ I          
Sbjct: 193 SEETRRNKIEEDLLLRAKLQHCLDEYYSTEAKVETVDPSLSNIMDKLFQIRRELLSLAAS 252

Query: 242 XXKIDTREDFSQ------FNXXXXXXXXXXXXXXXXXXXXXHRDENGNFKSLETGEVVLK 295
             K  +     +                             +RDE G FKS E+ +   K
Sbjct: 253 AKKTTSSASAEKELENKHVLAPESVNTRVELLQKELNEIESYRDETGKFKSPESEQSAEK 312

Query: 296 GQNVLAGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRD 355
           GQNVL GL+ +C+DL+ D ++  NG   +DP L+PIY +LI+IKT L NL+ITRRWTLR+
Sbjct: 313 GQNVLNGLLSDCYDLLGDLSHQKNGGIELDPRLQPIYAKLIDIKTTLENLLITRRWTLRE 372

Query: 356 TDLFQYQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKXXXXXXXXXXXX 415
           TDLF YQK+L  ID+ RVN KFPT SGD KGQ ILLYLLRRCYAIIYK            
Sbjct: 373 TDLFTYQKELGEIDSLRVNSKFPTDSGDNKGQTILLYLLRRCYAIIYKLLESSEPVSESL 432

Query: 416 XXIHNQLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQG 475
             +HNQLST RRCLLSL+RMGG+N+ RELYPYQ+KLASLD LR+DGKF+D +G IPEGQ 
Sbjct: 433 QPLHNQLSTVRRCLLSLQRMGGINNSRELYPYQMKLASLDGLRVDGKFYDLDGNIPEGQA 492

Query: 476 TLNALLAECFDIMH 489
           TLNALLAECFDI+H
Sbjct: 493 TLNALLAECFDIIH 506

 Score = 53.9 bits (128), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 37/111 (33%), Positives = 63/111 (56%), Gaps = 7/111 (6%)

Query: 295 KGQNVLAGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLR 354
           KGQ +L  L+  C+ +I     S   S+ V   L+P++++L  ++  L  L + R   + 
Sbjct: 402 KGQTILLYLLRRCYAIIYKLLES---SEPVSESLQPLHNQLSTVRRCL--LSLQRMGGIN 456

Query: 355 DT-DLFQYQKKLQAIDNKRVNGKFPTKSGDT-KGQAILLYLLRRCYAIIYK 403
           ++ +L+ YQ KL ++D  RV+GKF    G+  +GQA L  LL  C+ II++
Sbjct: 457 NSRELYPYQMKLASLDGLRVDGKFYDLDGNIPEGQATLNALLAECFDIIHE 507

>KAFR0L00460 Chr12 (84023..85558) [1536 bp, 511 aa] {ON} Anc_7.125
           YPL260W
          Length = 511

 Score =  518 bits (1333), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 272/480 (56%), Positives = 332/480 (69%), Gaps = 17/480 (3%)

Query: 17  MYGVPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRKRQA 76
           +  VPKEEE  L YLL VR  L+ LK NRSQFLNSK++Q  +Q VLTKVRELD+IR+++ 
Sbjct: 9   LQAVPKEEEVFLDYLLKVRQNLSDLKQNRSQFLNSKDIQFTYQRVLTKVRELDEIRRQKH 68

Query: 77  G-EDAVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKLLE 135
           G       KT +H+  LHN+VD++LDDVFQLLSLCF+T GLKNSAPATY+SLSTVQ LLE
Sbjct: 69  GNSQETEIKTFVHSPELHNRVDNVLDDVFQLLSLCFITCGLKNSAPATYASLSTVQSLLE 128

Query: 136 HLDESNIFTNHDLRPIKDRLDEISTIVENNSYRNYDFDLTNPADETEE------KRNKNK 189
           HL ES I+T+HDL+PIK+RLDEI+ IV+ N   N   D +   D+  E      +RNKNK
Sbjct: 129 HLIESKIYTHHDLKPIKERLDEIAKIVDQNCESNTYQDASTLDDDDNEVSRIDNERNKNK 188

Query: 190 IEEDLLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIXXXXXXXXXXXXKIDTRE 249
           IE++LLL+AKL HCL EYN I S+LEE+ P  +S++EKL+ I                  
Sbjct: 189 IEQNLLLQAKLNHCLHEYNYIESQLEEVDPSSNSLVEKLFQIRRNLVSLVEISK------ 242

Query: 250 DFSQFNXXXXXXXXXXXXXXXXXXXXXHRDENGNFKSLETGEVVLKGQNVLAGLVDNCHD 309
             S                        +RD +GNF S+E+G  ++KG NVL GL D+CHD
Sbjct: 243 --SNTGVQDQIDKKLKHLQLQLNEIENNRDPDGNFVSIESGNPIIKGSNVLNGLSDDCHD 300

Query: 310 LINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRDTDLFQYQKKLQAID 369
           LI+D   + +    +DP+L+ +YD LI++K +L NLM+TRRWTLR+TDLF Y KKL  ID
Sbjct: 301 LISDL--THHTKTFLDPDLQNVYDNLIDVKGSLENLMVTRRWTLRETDLFSYLKKLNEID 358

Query: 370 NKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKXXXXXXXXXXXXXXIHNQLSTARRCL 429
           N RV+GKFPTKSG TKGQAILLYLLRRCY +IYK              IHNQLST RRCL
Sbjct: 359 NLRVDGKFPTKSGSTKGQAILLYLLRRCYTLIYKLLESSEPVSEALQPIHNQLSTVRRCL 418

Query: 430 LSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQGTLNALLAECFDIMH 489
           L LKRMGGVN+ERELYPYQ+KLASLD LR DGKF+D+ G IPEGQG LNALLA CFDI+H
Sbjct: 419 LDLKRMGGVNNERELYPYQMKLASLDNLRKDGKFYDSKGNIPEGQGILNALLAGCFDILH 478

>Ecym_8352 Chr8 complement(703563..705302) [1740 bp, 579 aa] {ON}
           similar to Ashbya gossypii ADL019W
          Length = 579

 Score =  518 bits (1333), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 271/483 (56%), Positives = 342/483 (70%), Gaps = 12/483 (2%)

Query: 19  GVPKEEESILKYLLDVRAQLAKLKTNRSQFLNSKEVQNLHQEVLTKVRELDDIRK--RQA 76
           G+PKEEE IL Y L++R  L++LK NR+QFL SK+V   +QEVLTKVRELD IRK   ++
Sbjct: 10  GIPKEEEDILSYFLELRNYLSRLKQNRNQFLTSKDVVMTYQEVLTKVRELDKIRKTTHES 69

Query: 77  GEDAVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGLKNSAPATYSSLSTVQKLLEH 136
             +     T+IH+  LHN+VDS++DDVFQLLSLCFLTVGLKNSAPATY+SLSTVQ LL+H
Sbjct: 70  SPNLGPETTLIHSVDLHNRVDSVIDDVFQLLSLCFLTVGLKNSAPATYASLSTVQSLLDH 129

Query: 137 LDESNIFTNHDLRPIKDRLDEISTIVENNSYRNYDFDLTNP---ADETEEKRNKNKIEED 193
           L+ESN++T++DL+PIK+RLDEIS IVE NSY N   D  +    AD+ E+KR +N IEE+
Sbjct: 130 LNESNVYTHNDLKPIKERLDEISEIVEKNSYWNIPTDGGDGNAFADDLEDKRKENNIEEN 189

Query: 194 LLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIX------XXXXXXXXXXXKIDT 247
           LLLRAKL++CL  YN+I +KLE I  +L   ME+L+ I                  + D 
Sbjct: 190 LLLRAKLEYCLKGYNQIEAKLEAIPEDLQPFMERLFQIRRGLLSLAASAKSRVEQEEQDE 249

Query: 248 REDFSQFNXXXXXXXXXXXXXXXXXXXXXHRDENGNFKSL-ETGEVVLKGQNVLAGLVDN 306
            +D                          HR+E+G F S+ +  +V  KGQ VL GL+D+
Sbjct: 250 NDDELCILSHEKINERLKALETELADVRSHRNESGKFVSVNDPNDVPEKGQFVLNGLLDD 309

Query: 307 CHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITRRWTLRDTDLFQYQKKLQ 366
           CHDLI D ++  +    +DP ++PIYD+L++IKT L NL++TRRWTLR+TDLF YQKKL 
Sbjct: 310 CHDLIRDLSHQTSAGLDLDPHIQPIYDDLVSIKTILENLLVTRRWTLRETDLFTYQKKLA 369

Query: 367 AIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKXXXXXXXXXXXXXXIHNQLSTAR 426
            +D+ RVNGKFP++S D+KGQAILLYLLRRCYAIIYK              IHNQLST R
Sbjct: 370 ELDSLRVNGKFPSESSDSKGQAILLYLLRRCYAIIYKLLESSEPVSESLERIHNQLSTVR 429

Query: 427 RCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPEGQGTLNALLAECFD 486
            CLL LKRMGGV++ERELYPYQ+KLASLD +R+DGKF+D +G IPEGQGTLNALLAECFD
Sbjct: 430 HCLLELKRMGGVDNERELYPYQMKLASLDNMRVDGKFYDPDGNIPEGQGTLNALLAECFD 489

Query: 487 IMH 489
           I+H
Sbjct: 490 ILH 492

>ADL019W Chr4 (675941..677518) [1578 bp, 525 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL260W
          Length = 525

 Score =  462 bits (1188), Expect = e-158,   Method: Compositional matrix adjust.
 Identities = 241/440 (54%), Positives = 302/440 (68%), Gaps = 10/440 (2%)

Query: 58  HQEVLTKVRELDDIRK-RQAGEDAVYSKTMIHNEALHNKVDSLLDDVFQLLSLCFLTVGL 116
           +Q VLTKVR LD +RK R   ED     T+IH+ ALHN+VDS+LDDVFQLLSL FLTVGL
Sbjct: 4   YQAVLTKVRLLDQVRKQRHGAEDTTGGFTLIHSAALHNRVDSVLDDVFQLLSLSFLTVGL 63

Query: 117 KNSAPATYSSLSTVQKLLEHLDESNIFTNHDLRPIKDRLDEISTIVENNSYRNYDFDLTN 176
           KN+APATY+SLSTVQ+LLEH++E+N++T  DLRPIK+RLDEI  IVE NSY +   D   
Sbjct: 64  KNTAPATYASLSTVQRLLEHMEEANVYTYSDLRPIKERLDEIGEIVEKNSYMSMVED-EA 122

Query: 177 PADETEEKRNKNKIEEDLLLRAKLKHCLDEYNKIHSKLEEISPELSSIMEKLYHIXXXXX 236
           P DE  E++  NK+EEDLL+RAKL+HC+D Y K+ SK   I PEL  + +KL+HI     
Sbjct: 123 PLDELAEEKRLNKLEEDLLVRAKLQHCVDSYQKVKSKPATIPPELQPLSDKLFHIRRELL 182

Query: 237 XXXXXXXKID------TREDFSQFNXXXXXXXXXXXXXXXXXXXXXHRDENGNFKSLETG 290
                  K D      + E  +                        HRD++G F S +  
Sbjct: 183 SLAASA-KTDRAAGEGSTERSTTPASPNTLASRLKDLESMILEVESHRDDSGKFISPDDP 241

Query: 291 EVVL-KGQNVLAGLVDNCHDLINDFNNSGNGSDLVDPELEPIYDELINIKTNLANLMITR 349
           + V  KGQ+ L GL+D+C +L  D ++  +G   +DP+L+PIY+EL+ IKT L NL++TR
Sbjct: 242 DTVPQKGQSALNGLLDDCRNLFGDLSHQTSGVLHLDPQLQPIYEELLEIKTTLENLLVTR 301

Query: 350 RWTLRDTDLFQYQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKXXXXXX 409
           RWTLR+TDLF YQK+L  +DN RVN K P+ S  +KGQA++LYLLRRCYA IYK      
Sbjct: 302 RWTLRETDLFAYQKRLAELDNLRVNRKSPSSSSASKGQALILYLLRRCYATIYKLLESSE 361

Query: 410 XXXXXXXXIHNQLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGE 469
                   IHNQLST RRCL  LKRMGGV+SER+LYPYQ+KLASLD +R+DGKF+DA+G 
Sbjct: 362 PVSESLQKIHNQLSTVRRCLFELKRMGGVDSERDLYPYQMKLASLDNMRVDGKFYDADGN 421

Query: 470 IPEGQGTLNALLAECFDIMH 489
           IPEGQGTLNALLAECFDI+H
Sbjct: 422 IPEGQGTLNALLAECFDILH 441

>Kpol_1062.58 s1062 complement(129362..129739,129741..130838) [1476
           bp, 491 aa] {ON}
           complement(129362..129739,129741..130838) [1476 nt, 492
           aa]
          Length = 491

 Score =  111 bits (277), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 66/196 (33%), Positives = 109/196 (55%), Gaps = 5/196 (2%)

Query: 294 LKGQNVLAGLVDNCHDLINDFNNSGNGSDLVDPELEP-IYDELINIKTNLANLMITRRWT 352
           + GQ +L GLVD C ++I+D        D +D E +  ++++ + +K  L  +++T R +
Sbjct: 283 INGQRILNGLVDYCQEVIHDVKLLA--IDKIDDEKKANLFEKSLLLKIKLETILVTNRHS 340

Query: 353 LRDTDLFQYQKKLQAIDNKRVNGKFPTKSGDTKGQAILLYLLRRCYAIIYKXXXXXXXXX 412
           L+  DLF   K+L  ++ + +  +        + ++I+++ LRRC+ IIYK         
Sbjct: 341 LKSLDLFNLHKELSKLEKRTI--RHYNIEDSFQAKSIIIFFLRRCHCIIYKILESSEPVP 398

Query: 413 XXXXXIHNQLSTARRCLLSLKRMGGVNSERELYPYQLKLASLDELRIDGKFFDANGEIPE 472
                ++NQLST  R LL LK  GGV    +L P +LKL ++ + RI+  F D +G IP 
Sbjct: 399 HCLRPLYNQLSTLARYLLKLKIAGGVEKMDDLLPVELKLNNIIDRRINENFPDESGNIPG 458

Query: 473 GQGTLNALLAECFDIM 488
           GQ  LNALL EC +++
Sbjct: 459 GQRALNALLHECMELL 474

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 21/42 (50%), Positives = 31/42 (73%)

Query: 122 ATYSSLSTVQKLLEHLDESNIFTNHDLRPIKDRLDEISTIVE 163
           + YSS+  ++ LL  L++SN+FT +DL P+K RLDEI  I+E
Sbjct: 73  SIYSSIVEIKILLNQLNDSNLFTCYDLSPLKRRLDEIDDILE 114

>Skud_12.503 Chr12 (892705..897015) [4311 bp, 1436 aa] {ON} YLR419W
           (REAL)
          Length = 1436

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 32/97 (32%), Positives = 44/97 (45%), Gaps = 14/97 (14%)

Query: 117 KNSAPATYSSLSTVQKLLEHLDESNIFTNHDLRPIKDRL-DEISTIVENN---------- 165
           KN     Y    T+ KLL +L E+N+  +  +  I + L D ISTI++N           
Sbjct: 487 KNYKLPDYIKKQTLTKLLHYLKEANLIGDMLVYHIYEWLKDNISTIIDNPGPLVSESDLK 546

Query: 166 ---SYRNYDFDLTNPADETEEKRNKNKIEEDLLLRAK 199
              S RN   D TN  +    +  KN I ED+L R K
Sbjct: 547 GTISQRNRPNDRTNRNNANSRRFAKNTISEDMLCRLK 583

>AGL106C Chr7 complement(504816..506228) [1413 bp, 470 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR238W
           (FAR10) and YDR200C (VPS64)
          Length = 470

 Score = 33.5 bits (75), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 19/58 (32%), Positives = 32/58 (55%), Gaps = 4/58 (6%)

Query: 132 KLLEHLDESNIFTNHDLRPIKDRLDEISTIVENNSYRNYDF----DLTNPADETEEKR 185
           +L + LD+ N   NH+L  ++  LD+++T +E   Y+N  F    +  +P  E  EKR
Sbjct: 372 QLKKSLDQKNQEANHELENLRRELDDVNTRLEVEKYKNTQFSKKSEKADPVKEAHEKR 429

>CAGL0B03399g Chr2 (330838..335832) [4995 bp, 1664 aa] {ON} weakly
            similar to uniprot|P29539 Saccharomyces cerevisiae
            YBR275c RIF1 RAP1-interacting factor 1
          Length = 1664

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 34/59 (57%), Gaps = 4/59 (6%)

Query: 13   LSKYMYGVPKEEESILKYLLDVRAQLAKLKT-NRSQFLNSKEVQNLHQEVLTKVRELDD 70
            LS+Y+  +P+      +YL+D+  +L   K+ NRS+F NS    +LH  V T   +LD+
Sbjct: 1247 LSQYIARLPERPS---RYLVDLSEKLILNKSFNRSKFRNSSSFNDLHTHVRTWCNQLDN 1302

>AER167W Chr5 (949269..950087) [819 bp, 272 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YHR192W
          Length = 272

 Score = 31.6 bits (70), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/42 (42%), Positives = 25/42 (59%), Gaps = 4/42 (9%)

Query: 308 HDLINDFNN----SGNGSDLVDPELEPIYDELINIKTNLANL 345
           H LI  F++    S + S L+D EL+  YDEL N++  LA L
Sbjct: 135 HSLIQRFSSGPLQSQDASTLMDEELQSKYDELQNLQKELAQL 176

>KNAG0A01920 Chr1 complement(146963..147691) [729 bp, 242 aa] {ON}
           Anc_8.549 YPL078C
          Length = 242

 Score = 31.2 bits (69), Expect = 5.9,   Method: Compositional matrix adjust.
 Identities = 30/115 (26%), Positives = 55/115 (47%), Gaps = 7/115 (6%)

Query: 106 LLSLCFLTVGL---KNSAPATYSSLSTVQKLLEHLDESNIFTNHDLRPIKDRLDEISTIV 162
           +L L FLTVG    K +APA Y++ +   ++ +  D  N      +  +K+R+D +S + 
Sbjct: 90  ILLLSFLTVGALMAKFAAPA-YNTFAEA-RMKKVADVLNASRERHVSAVKERIDSVSELT 147

Query: 163 ENNSYRNYDFDLTNPADETEEKRNKNKIEEDLLLRAKLKHCLDEYNKIHSKLEEI 217
             +      FD++    E E K  + K + DL   A  +  LD + +  + L ++
Sbjct: 148 NVSQITKVLFDVSKETVELEAKAFELKQKVDLAQHA--RSVLDSWVRYEASLRQL 200

>Kpol_397.11 s397 (32117..34993) [2877 bp, 958 aa] {ON}
           (32117..34993) [2877 nt, 959 aa]
          Length = 958

 Score = 31.2 bits (69), Expect = 7.4,   Method: Compositional matrix adjust.
 Identities = 28/88 (31%), Positives = 43/88 (48%), Gaps = 10/88 (11%)

Query: 130 VQKLLEHLDESNIFTNHDLRPIKDRLDEISTIVENNSYRNYDFDLTNPADETEEKRNKNK 189
           ++ L E +D+   FTN  L+P+ DR  +IS         NY    T   +E +E  N  K
Sbjct: 192 IEHLSEKIDDQVKFTNLKLKPLLDRSTKIS---------NYQLTKT-FIEENKEFINSTK 241

Query: 190 IEEDLLLRAKLKHCLDEYNKIHSKLEEI 217
           I  + L +   K+ + EY+KI +   EI
Sbjct: 242 ILRNYLHKKDYKNLMIEYSKILNNYNEI 269

>KLLA0A04884g Chr1 (433581..436760) [3180 bp, 1059 aa] {ON} similar
           to uniprot|P32767 Saccharomyces cerevisiae YGL016W
           KAP122 Karyopherin beta responsible for import of the
           Toa1p-Toa2p complex into the nucleus binds to
           nucleoporins Nup1p and Nup2p may play a role in
           regulation of pleiotropic drug resistance
          Length = 1059

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 18/43 (41%), Positives = 25/43 (58%), Gaps = 6/43 (13%)

Query: 107 LSLCFLTVGL------KNSAPATYSSLSTVQKLLEHLDESNIF 143
           LSL FLT+         N  PA  + ++T  KLL+H +ESN+F
Sbjct: 116 LSLIFLTINSDAIGADSNKIPAWRNPVNTCIKLLQHCNESNLF 158

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.135    0.379 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 53,561,373
Number of extensions: 2352676
Number of successful extensions: 11002
Number of sequences better than 10.0: 196
Number of HSP's gapped: 11424
Number of HSP's successfully gapped: 233
Length of query: 534
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 420
Effective length of database: 40,409,475
Effective search space: 16971979500
Effective search space used: 16971979500
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)