Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_304.65.712ON56256228190.0
TPHA0D046605.712ON104550410351e-128
NCAS0G001705.712ON10304878961e-108
TDEL0B020805.712ON10254828731e-105
Smik_9.135.712ON10604758711e-104
ZYRO0B16544g5.712ON10445148611e-103
Skud_9.125.712ON10644778471e-101
Suva_9.305.712ON10624768411e-100
YIL156W (UBP7)5.712ON10714758231e-97
NDAI0F002005.712ON11055318153e-96
SAKL0E15136g5.712ON10374918044e-95
KLTH0E00814g5.712ON9744597462e-87
Kwal_55.196455.712ON9704566571e-74
KLLA0A00396g5.712ON10124735752e-63
Ecym_40095.712ON15174765712e-62
CAGL0H06721g5.712ON10812985674e-62
TBLA0E017605.712ON12122015314e-57
KNAG0L022005.712ON11612055145e-55
AFR296C5.712ON11692073435e-33
KAFR0D021605.712ON8464483337e-32
YKR098C (UBP11)5.712ON7171282661e-23
Skud_11.3385.712ON7121282562e-22
Smik_11.3625.712ON7211282511e-21
Suva_11.3355.712ON7241672358e-20
KAFR0H001505.712ON6561802322e-19
CAGL0G02563gsingletonON631981082e-04
KLLA0F19338g8.271ON891103870.072
CAGL0I06765g8.188ON88789810.30
NCAS0G00320singletonON39484732.8
KLLA0E14213g8.93ON53251714.9
ZYRO0E00594g2.653ON168552706.8
NOTE: 1 genes in the same pillar as Kpol_304.6 were not hit in these BLAST results
LIST: Kpol_2001.78

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_304.6
         (562 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON} (18386..20...  1090   0.0  
TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]...   403   e-128
NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712     349   e-108
TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5....   340   e-105
Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W (R...   340   e-104
ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa...   336   e-103
Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W (R...   330   e-101
Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {O...   328   e-100
YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}  UBP7Ubiquit...   321   1e-97
NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712     318   3e-96
SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa...   314   4e-95
KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar ...   291   2e-87
Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W ...   257   1e-74
KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar...   226   2e-63
Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to...   224   2e-62
CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa] ...   223   4e-62
TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {...   209   4e-57
KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa] ...   202   5e-55
AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON} ...   136   5e-33
KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.7...   132   7e-32
YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON} ...   107   1e-23
Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {...   103   2e-22
Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {...   101   1e-21
Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {...    95   8e-20
KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712...    94   2e-19
CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {...    46   2e-04
KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} simi...    38   0.072
CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} simila...    36   0.30 
NCAS0G00320 Chr7 complement(55420..56604) [1185 bp, 394 aa] {ON}       33   2.8  
KLLA0E14213g Chr5 complement(1257304..1258902) [1599 bp, 532 aa]...    32   4.9  
ZYRO0E00594g Chr5 complement(38569..43626) [5058 bp, 1685 aa] {O...    32   6.8  

>Kpol_304.6 s304 (18386..20071) [1686 bp, 562 aa] {ON}
           (18386..20071) [1686 nt, 562 aa]
          Length = 562

 Score = 1090 bits (2819), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 536/562 (95%), Positives = 536/562 (95%)

Query: 1   MVIQTDFSSTFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHF 60
           MVIQTDFSSTFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHF
Sbjct: 1   MVIQTDFSSTFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHF 60

Query: 61  LPSGRYDDALSAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMV 120
           LPSGRYDDALSAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMV
Sbjct: 61  LPSGRYDDALSAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMV 120

Query: 121 RNEVDSILDKSYQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMA 180
           RNEVDSILDKSYQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMA
Sbjct: 121 RNEVDSILDKSYQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMA 180

Query: 181 KPYDSLPMELDDSTPLWTAPSLNPNDQLKLALEQPELTLDEQLSDKTQHNLIDDKYNNFT 240
           KPYDSLPMELDDSTPLWTAPSLNPNDQLKLALEQPELTLDEQLSDKTQHNLIDDKYNNFT
Sbjct: 181 KPYDSLPMELDDSTPLWTAPSLNPNDQLKLALEQPELTLDEQLSDKTQHNLIDDKYNNFT 240

Query: 241 IPLPHQIPLPVKVTDFNHDKKIQKIYPVDRSETHRKDSYHSVYMDNDNSAGYVRKNDEAN 300
           IPLPHQIPLPVKVTDFNHDKKIQKIYPVDRSETHRKDSYHSVYMDNDNSAGYVRKNDEAN
Sbjct: 241 IPLPHQIPLPVKVTDFNHDKKIQKIYPVDRSETHRKDSYHSVYMDNDNSAGYVRKNDEAN 300

Query: 301 NYIQTLERLQKQNVITCPELFSILSDPTTKDDILLIYLGLPERTKSNYIVAKNTINIDPN 360
           NYIQTLERLQKQNVITCPELFSILSDPTTKDDILLIYLGLPERTKSNYIVAKNTINIDPN
Sbjct: 301 NYIQTLERLQKQNVITCPELFSILSDPTTKDDILLIYLGLPERTKSNYIVAKNTINIDPN 360

Query: 361 VLWDFENNCPISEDTKLEKILNDQLFNIRKSFAYVVYYTDLKTYMKINFDYNFTLFYLLT 420
           VLWDFENNCPISEDTKLEKILNDQLFNIRKSFAYVVYYTDLKTYMKINFDYNFTLFYLLT
Sbjct: 361 VLWDFENNCPISEDTKLEKILNDQLFNIRKSFAYVVYYTDLKTYMKINFDYNFTLFYLLT 420

Query: 421 SSRTSVLKTFPTSLLGGLEKWKKVIRTYYHENGINALNYLHKFHVHNIDQKEGDRSNIGV 480
           SSRTSVLKTFPTSLLGGLEKWKKVIRTYYHENGINALNYLHKFHVHNIDQKEGDRSNIGV
Sbjct: 421 SSRTSVLKTFPTSLLGGLEKWKKVIRTYYHENGINALNYLHKFHVHNIDQKEGDRSNIGV 480

Query: 481 EHYFWNAXXXXXXXXXXXXXXXXXXXXXXXXXXKIGLIDSTLEGPNQNDTILASSKVDYS 540
           EHYFWNA                          KIGLIDSTLEGPNQNDTILASSKVDYS
Sbjct: 481 EHYFWNAPEIPMRIRQRPPPPIPSTIIHPPLPPKIGLIDSTLEGPNQNDTILASSKVDYS 540

Query: 541 SSNNFIRTENYQVNLLPNGPTK 562
           SSNNFIRTENYQVNLLPNGPTK
Sbjct: 541 SSNNFIRTENYQVNLLPNGPTK 562

>TPHA0D04660 Chr4 complement(1017401..1020538) [3138 bp, 1045 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1045

 Score =  403 bits (1035), Expect = e-128,   Method: Compositional matrix adjust.
 Identities = 228/504 (45%), Positives = 311/504 (61%), Gaps = 48/504 (9%)

Query: 9   STFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDD 68
           STFTPEYS EL +RV D Y N+IK   PQLRL+KLI++LEHTAYLLE++   L   +YD+
Sbjct: 5   STFTPEYSNELLKRVSDTYNNEIKGHFPQLRLTKLIEMLEHTAYLLESYLDLLHEQKYDE 64

Query: 69  ALSAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSIL 128
            LSAYIVGC+YLYLIIP STQFQ +NKS+ +YN+ KILYQN+ANMTNV ++V+NEVDSIL
Sbjct: 65  CLSAYIVGCFYLYLIIPNSTQFQIRNKSFRIYNELKILYQNQANMTNVLAIVKNEVDSIL 124

Query: 129 DKSYQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPI-----RERKSSTTQRPLSMAKPY 183
           D+S  E E  ++VI R RA+S     PK  N  +F             T      +   +
Sbjct: 125 DESILELEGIEKVIKRDRAYS--SPAPKVNNISKFSKLSINDNHHNGETISTDNKLQSHF 182

Query: 184 DSLP----------------------MELDDSTPLWTAPSLNPNDQLKLALEQPELTLDE 221
              P                       E +D+ P+W  PSL PNDQLKLALEQP    DE
Sbjct: 183 PQTPNYSNSNNSTGSFNNVKSNSNSSEEAEDTAPIWHIPSLEPNDQLKLALEQPVEFSDE 242

Query: 222 QLSDKTQHNLIDDKYN---------NFTIPLPHQIPLPVKVTDFNHDKKIQ-KIYPVDRS 271
           ++   +    +  +Y+         N +I     +P P    D  HD  +  +  PVDRS
Sbjct: 243 EIDASSISEPLGRRYSPLSPYQKKRNSSISSAFLVPFPHNENDKVHDNSMLIEDLPVDRS 302

Query: 272 ETHRKDSYHSVYMDN-----DNSAGYVRKNDEANNYIQTLERLQKQNVITCPELFSILSD 326
            THRKDSYHSVYM+N     D+ A Y      +N+YIQ+++RLQKQNVITC EL+SILS 
Sbjct: 303 VTHRKDSYHSVYMNNQDEESDSGAHY----GLSNSYIQSMDRLQKQNVITCSELYSILSS 358

Query: 327 PTTKDDILLIYLGLPERTKSNYIVAKNTINIDPNVLWDFENNCPISEDTKLEKILNDQLF 386
           PT +  +LL+ L +P+ +++N+I+A + I IDPN+LW+ E   PI    +L K +N+ L 
Sbjct: 359 PTERQKLLLVDLRIPKASRTNHIIAPHIIKIDPNLLWNEETQTPIYSFEELVKRINNPLI 418

Query: 387 NIRKSFAYVVYYTDLKTYMKINFDYNFTLFYLLTSSRTSVLKTFPTSLLGGLEKWKKVIR 446
           +    F Y+VYY+D++T+M  ++D+ FT FYLL S+++  LK  PT+LLGG EKWKKV++
Sbjct: 419 SEVNKFDYIVYYSDIRTFMVTDYDFCFTFFYLLLSTKSLNLKQVPTNLLGGFEKWKKVLK 478

Query: 447 TYYHENGINALNYLHKFHVHNIDQ 470
           TY  E GI+   ++ K H   +++
Sbjct: 479 TYNKEYGIDITPFIKKLHATELNK 502

>NCAS0G00170 Chr7 (22237..25329) [3093 bp, 1030 aa] {ON} Anc_5.712
          Length = 1030

 Score =  349 bits (896), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 219/487 (44%), Positives = 301/487 (61%), Gaps = 40/487 (8%)

Query: 9   STFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDD 68
           STFTPEYS EL  R+Q +Y+ DIK   PQL+L KL+DLLEHT YL E F HF   G   D
Sbjct: 8   STFTPEYSNELLRRIQSVYKEDIKHYYPQLKLEKLLDLLEHTEYLFELFLHFGHEGNNKD 67

Query: 69  ALSAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSIL 128
           AL+++IVGCYYL+LI+PQS QFQ++NKSY +Y+D K LY+N+A+MTNV  MV++E+++IL
Sbjct: 68  ALTSFIVGCYYLFLIMPQSIQFQSRNKSYGIYSDLKKLYENQASMTNVLLMVKDEIETIL 127

Query: 129 DKSYQ-EPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMAKPY---- 183
           +K+ + E   T   I R RA+SV D            + +R   +  R + M   +    
Sbjct: 128 EKTAEREINETNNRIVRQRAYSVPDSNDLTEQLHSLSVSDRNLKSPPRKILMNNSFEHSD 187

Query: 184 -DSLPMELDDSTPLWTAPSLNPNDQLKLA------------------------LEQPELT 218
            D +  E D S+PLWTAP L P DQLKLA                        L+QP + 
Sbjct: 188 SDVINEENDMSSPLWTAPPLEPTDQLKLAVLGNETLPPPVIPYEADIQERTDLLKQPSIP 247

Query: 219 LDEQLSDKTQHNLIDDKYNN---FTIPLPHQIPLPVKVTDFNHDKKIQKIYPVDRSETHR 275
              +LS  T        +N+     I L + IPL   V + ++++  ++    DRS+THR
Sbjct: 248 ---ELSPTTTSLKNSKDFNSPFQSVISLDNDIPL---VREPSNNRSFRETN-ADRSQTHR 300

Query: 276 KDSYHSVYMDNDNSAGYVRKNDEANNYIQTLERLQKQNVITCPELFSILSDPTTKDDILL 335
           KDSYHSVYM ++ S   + +  ++ +YIQ L+RLQKQ++IT  EL SILS P  +  +LL
Sbjct: 301 KDSYHSVYMIDEESTDKLNQFYDSTDYIQDLQRLQKQSIITAQELLSILSCPPERIKLLL 360

Query: 336 IYLGLPERTKSNYIVAKNTINIDPNVLWDFENNCPISEDTKLEKILNDQLFNIRKSFAYV 395
           I L   +RT  N+IVA N ++IDP++LWD   + PI     LEK+L+++LFN R  F YV
Sbjct: 361 IDLRWSKRTALNHIVAPNVVSIDPHLLWDSATSTPIYNMETLEKLLDNELFNRRHEFEYV 420

Query: 396 VYYTDLKTYMKINFDYNFTLFYLLTSSRTSVLKTFPTSLLGGLEKWKKVIRTYYHENGIN 455
           VYYTD+KTYM  +FDYNFTLFYLLT+  T++L++ PT LLGG +KWK  +  Y  E  IN
Sbjct: 421 VYYTDMKTYMHSDFDYNFTLFYLLTTETTNILRSTPTYLLGGYDKWKVFLHHYAKEYDIN 480

Query: 456 ALNYLHK 462
             +YL++
Sbjct: 481 IPDYLYR 487

>TDEL0B02080 Chr2 (369534..372611) [3078 bp, 1025 aa] {ON} Anc_5.712
           YIL156W
          Length = 1025

 Score =  340 bits (873), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 209/482 (43%), Positives = 299/482 (62%), Gaps = 30/482 (6%)

Query: 5   TDFSSTFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSG 64
            D   +FTPEYS EL   VQ++Y++DIK    Q +L KL+DLLEHT YL E++  FL   
Sbjct: 2   ADTEVSFTPEYSNELLRCVQNLYEDDIKHYFTQSKLEKLLDLLEHTEYLFESYLQFLHEK 61

Query: 65  RYDDALSAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEV 124
              DAL+A+I+GCYYLYLI+PQS +FQT+NKSYS++ND   +YQN+ANMTNV  MV++EV
Sbjct: 62  NNQDALTAFIIGCYYLYLIVPQSIEFQTRNKSYSIFNDLMKMYQNQANMTNVLLMVKDEV 121

Query: 125 DSILDKSYQEPEPTKRVIPRGRAFSVKDDTPKD-------YNTIEFPIRERKSSTTQRPL 177
           DSILD++ +E +  +    R RA+SV D   +        +N    P+ + ++++     
Sbjct: 122 DSILDRNAREFKEFEHQKARTRAYSVPDRNFESRLTNLNIHNENPLPLGDHQAASKSE-- 179

Query: 178 SMAKPYDSLPMELDDSTPLWTAPSLNPNDQLKLALEQPELT-----LDEQLSDK-----T 227
              +  ++L  + +DS+P+WTAP L PNDQL++AL+   L+     LD+ ++ K     T
Sbjct: 180 QGREDMNNLQND-EDSSPVWTAPPLEPNDQLRIALDATPLSPSIMALDQPMATKELAIST 238

Query: 228 QHNLIDDKYNNFTIPLPHQIP-LPVKVTDFNHD------KKIQKIYPVDRSETHRKDSYH 280
               +  + +    P P+ I  L +   D N         K      VDR  THRKDSYH
Sbjct: 239 SRKALSRRASAMG-PTPYPIEELDISGQDGNSHYDELGFNKTLWNANVDRQTTHRKDSYH 297

Query: 281 SVYMDNDNSAGYVRKNDEANNYIQTLERLQKQNVITCPELFSILSDPTTKDDILLIYLGL 340
           SVYM    S  ++     + ++ Q LERLQKQ++IT PELF+ILS     + +LLI   L
Sbjct: 298 SVYMFEGGSDDHMPSI--SKDFTQGLERLQKQSIITAPELFTILSSSEESEKLLLIDFRL 355

Query: 341 PERTKSNYIVAKNTINIDPNVLWDFENNCPISEDTKLEKILNDQLFNIRKSFAYVVYYTD 400
            +R+K N+I+A  T+ IDP  LWD + N PIS    L++I+    F  R S+ Y+VYYTD
Sbjct: 356 SKRSKVNHIIAPTTVEIDPRQLWDPKTNTPISNAATLDEIIKKPAFLERGSYDYIVYYTD 415

Query: 401 LKTYMKINFDYNFTLFYLLTSSRTSVLKTFPTSLLGGLEKWKKVIRTYYHENGINALNYL 460
           +KTYM I++DY FTLFYLLT+S T  L++ PT LLGG EKWKK+++ Y  ++G+N  NY+
Sbjct: 416 MKTYMTIDYDYMFTLFYLLTASPTVNLRSLPTHLLGGYEKWKKIMKNYSVDHGVNMDNYI 475

Query: 461 HK 462
           ++
Sbjct: 476 YR 477

>Smik_9.13 Chr9 (25877..29059) [3183 bp, 1060 aa] {ON} YIL156W
           (REAL)
          Length = 1060

 Score =  340 bits (871), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 211/475 (44%), Positives = 291/475 (61%), Gaps = 46/475 (9%)

Query: 8   SSTFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYD 67
           ++ FTPEYS EL  RVQD+Y  DIK   PQL+L KL+DLLEHT YL E +   +  GR +
Sbjct: 5   TTLFTPEYSDELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMHHGRPN 64

Query: 68  DALSAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSI 127
           DAL+A+++GCYY++LIIPQS QFQT+NKSYS+Y D K +Y+NE NMTNV  MV+ E+  +
Sbjct: 65  DALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVV 124

Query: 128 LDKSYQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMAKPYD--- 184
           LD+S +     +  I + RAFSV             P  +         L  A P     
Sbjct: 125 LDESVKHVVGIEHRINKKRAFSV-------------PANDLSGQVASLSLDTAGPQQHNI 171

Query: 185 SLPM---ELDDSTPLWTAPSLNPNDQLKLALEQPELTLDEQLSDKTQHNLIDDKYNNFTI 241
            +P+   ++D S+P+WTAP+L PNDQLKLAL  PE+      ++  + +         T 
Sbjct: 172 KVPLTEDDMDQSSPVWTAPNLEPNDQLKLAL-LPEVIPTSTFNEPERKS---------TS 221

Query: 242 PL-PHQIPLPVKVTDFNHDKKIQKIYP------VDRSETHRKDSYHSVYM-DNDNSAGYV 293
           P  P  +   V  T  ++D     + P       DRS THRKDSYHSVYM D+DN     
Sbjct: 222 PARPSVLLEDVPCTYHDNDASTASLNPPFRDITADRSVTHRKDSYHSVYMVDSDNLK--- 278

Query: 294 RKNDEANN-----YIQTLERLQKQNVITCPELFSILSDPTTKDDILLIYLGLPERTKSNY 348
             NDE  N     +IQ+L+ LQKQ++IT PELFSILS+   ++ +LLI L +P+R+  N+
Sbjct: 279 EDNDEFLNVENDGFIQSLDILQKQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAVNH 338

Query: 349 IVAKNTINIDPNVLWDFENNCPISEDTKLEKILND-QLFNIRKSFAYVVYYTDLKTYMKI 407
           IVA N + +DPN+LWD + N P+ +D  LE +L + + F  R  F Y+VYY+D+KT+M I
Sbjct: 339 IVAPNLVKVDPNLLWDKKTNTPVYQDDILEHLLKENENFANRDKFDYIVYYSDVKTFMTI 398

Query: 408 NFDYNFTLFYLLTSSRTSVLKTFPTSLLGGLEKWKKVIRTYYHENGINALNYLHK 462
           NFDY F  FYL+ +S+ + L T PT+LLGG EKWKK + +Y  E  I+  +YL++
Sbjct: 399 NFDYVFIFFYLMLTSQKTPLTTVPTALLGGYEKWKKTLHSYAQEYHISVEDYLYR 453

>ZYRO0B16544g Chr2 complement(1342476..1345610) [3135 bp, 1044 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156W UBP7 Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1044

 Score =  336 bits (861), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 205/514 (39%), Positives = 302/514 (58%), Gaps = 55/514 (10%)

Query: 8   SSTFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYD 67
           ++ FTPEYS+EL   V+DIY++DIKP    L+L  L DL++HT YL E+F   + +    
Sbjct: 5   TTWFTPEYSSELLRLVEDIYEDDIKPHYAVLKLEDLDDLMDHTRYLYESFSDEMKNRNKQ 64

Query: 68  DALSAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSI 127
           DAL+AYI+GCY+LYLIIPQSTQFQ +NK++ ++N  K LY+N+ NMTNV  MV++EVDS+
Sbjct: 65  DALTAYIIGCYFLYLIIPQSTQFQARNKTFQVHNALKKLYENQVNMTNVLLMVKDEVDSV 124

Query: 128 LDKSYQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPL-SMAKPYDSL 186
           LD+ +++     + + R RAFS  D      N ++  I     +     L  M K +D +
Sbjct: 125 LDRDFRK----LKDVERKRAFSSPD------NGLDSEISRLTLAGNGSTLPKMHKKWDFI 174

Query: 187 PMELD------DSTPLWTAPSLNPNDQLKLAL---------------EQPELTLD----- 220
             + +       + PLW AP+L PNDQLKLAL               E PEL+L      
Sbjct: 175 RSDSNFHSHDTGNVPLWKAPNLEPNDQLKLALDSAVPSSLSVDTVGKEAPELSLSPLGYP 234

Query: 221 ------EQLSDKTQHNLIDDKYNNFTIPLPHQIPLPVKVTDFNH--DKKIQKIYPVDRSE 272
                 E   ++ +H   D ++++      HQ+    K  D  H  D K      VDR+ 
Sbjct: 235 KHKSKSELTVEEKEHPQQDHRHHHGVQQETHQLG---KDDDEQHFWDAK------VDRAV 285

Query: 273 THRKDSYHSVYMDN-DNSAGYVRKNDEANNYIQTLERLQKQNVITCPELFSILSDPTTKD 331
            HRKDSYHSVYMD+ D+  G  +      + +Q ++RLQKQ++IT PELFSILS+   ++
Sbjct: 286 AHRKDSYHSVYMDDGDHDFGENKGATFPESEVQAMKRLQKQSIITSPELFSILSNKKERN 345

Query: 332 DILLIYLGLPERTKSNYIVAKNTINIDPNVLWDFENNCPISEDTKLEKILNDQLFNIRKS 391
            +LLI L L  R K NYI+A N + IDP +LWD     P+++ + L++ L + +FN R S
Sbjct: 346 RLLLIDLRLQSRYKFNYILAPNMVFIDPRMLWDVNTKTPVTDISVLDERLKNSIFNKRGS 405

Query: 392 FAYVVYYTDLKTYMKINFDYNFTLFYLLTSSRTSVLKTFPTSLLGGLEKWKKVIRTYYHE 451
           F ++VYYTD+KTYM+++FDY F  + L+ +S+   L++ P+ LLGG EKWK V++ Y  +
Sbjct: 406 FDFIVYYTDMKTYMEMDFDYLFVFYNLVVASQEVSLRSLPSYLLGGYEKWKAVLKKYLTQ 465

Query: 452 NGINALNYLHKFHVHNIDQKEGDRSNIGVEHYFW 485
            GI   +YL++ +  N + KE   +   +E   W
Sbjct: 466 FGIRVDDYLYRPYSSNKEGKEKSANAKHIEPVPW 499

>Skud_9.12 Chr9 (25211..28402) [3192 bp, 1064 aa] {ON} YIL156W
           (REAL)
          Length = 1064

 Score =  330 bits (847), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 205/477 (42%), Positives = 284/477 (59%), Gaps = 50/477 (10%)

Query: 8   SSTFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYD 67
           ++ FTPEYS EL  RVQD+Y  DIK   PQL+L KL+DLLEHT YL E +   +   R +
Sbjct: 5   TTLFTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLYELYLDSMRHNRPN 64

Query: 68  DALSAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSI 127
           DAL+A+I+GCYY++LIIPQS QFQT+NKSYS+Y D K +Y+NE NMTNV  MV+ E+  +
Sbjct: 65  DALTAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVV 124

Query: 128 LDKSYQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMAKPYDS-- 185
           LD+S +     +  I + RAFSV             P  +         L  A P+    
Sbjct: 125 LDESVKHAVGIEHRITKKRAFSV-------------PANDLSGQVASLSLENAGPHGHGF 171

Query: 186 ----LPMELDDSTPLWTAPSLNPNDQLKLALEQPELTLDEQLSDKTQHNLIDDKYNNFTI 241
                  + + S+P+WTAP+L PNDQLKLAL          L +     +  +     + 
Sbjct: 172 KASFTEEDAEQSSPVWTAPNLEPNDQLKLAL----------LPEVIPTPIYPESGRKTSS 221

Query: 242 PLPHQIPLP-VKVTDFNHDKKIQKIYP------VDRSETHRKDSYHSVYM--------DN 286
           P+   + L  V    ++       + P      VDRS THRKDSYHS+YM        DN
Sbjct: 222 PVRPSVLLEDVPYNCYDGGASSASLNPSFGEITVDRSITHRKDSYHSIYMVDSDTLKEDN 281

Query: 287 DNSAGYVRKNDEANNYIQTLERLQKQNVITCPELFSILSDPTTKDDILLIYLGLPERTKS 346
           D+       N E + +IQ+L+ LQKQ++IT PELFSILS+   ++ ILLI L +P R++ 
Sbjct: 282 DDLL-----NVETDEFIQSLDILQKQSIITAPELFSILSNSIEREKILLIDLRIPRRSEI 336

Query: 347 NYIVAKNTINIDPNVLWDFENNCPISEDTKLEKILND-QLFNIRKSFAYVVYYTDLKTYM 405
           N+IVA N + IDPN+LWD + N P+ +D  LE +L + ++F  R  F YVVYYTD+KT+M
Sbjct: 337 NHIVAPNLVKIDPNLLWDRKTNTPVYQDDILEHLLEENEIFINRDKFEYVVYYTDVKTFM 396

Query: 406 KINFDYNFTLFYLLTSSRTSVLKTFPTSLLGGLEKWKKVIRTYYHENGINALNYLHK 462
            +NFDY F  FYL+ +S+ + L + PT+LLGG EKWKK + TY  E  ++  +YL++
Sbjct: 397 YMNFDYVFIFFYLMLTSQKTHLTSVPTALLGGYEKWKKTLHTYAQEYDVSIEDYLYR 453

>Suva_9.30 Chr9 (41061..42434,42912..44726) [3189 bp, 1062 aa] {ON}
           YIL156W (REAL)
          Length = 1062

 Score =  328 bits (841), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 208/476 (43%), Positives = 288/476 (60%), Gaps = 48/476 (10%)

Query: 8   SSTFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYD 67
           +++FTPEYS EL  RV+D+Y  DIK   PQL+L KL+DLLEHT YL E +   +   R +
Sbjct: 5   TTSFTPEYSNELLRRVRDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSMRHERPN 64

Query: 68  DALSAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSI 127
           DAL+A+++GCYY++LIIPQS QFQT+NKSYS+Y+D K +Y+NE NMTNV  MV+ E+  +
Sbjct: 65  DALTAFVIGCYYVFLIIPQSLQFQTRNKSYSIYSDLKKMYENEMNMTNVVLMVKKEIGVV 124

Query: 128 LDKSYQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMAKPYDSL- 186
           LD S +     +  I + RAFSV             P  +         L  A P   L 
Sbjct: 125 LDDSVKHVVGIEHRITKKRAFSV-------------PGIDLSDQLASLSLDAAGPRGHLH 171

Query: 187 -----PMELDDSTPLWTAPSLNPNDQLKLALEQPELTLDEQLSDKT--------QHNLID 233
                  + D S+P+WTAP+L PNDQLKLAL  PE+       +          Q  L++
Sbjct: 172 KTSSTEEDADQSSPVWTAPNLEPNDQLKLAL-LPEVIPTPAFPESGRKTSTPVRQSVLLE 230

Query: 234 DKYNNFTIPLPHQIPLPVKVTDFNHDKKIQKIYPVDRSETHRKDSYHSVYMDNDNSAGYV 293
           D      +P  H        T  + D+   +I   DRS THRKDSYHSVYM + ++  + 
Sbjct: 231 D------VPYTHN---DNDGTSASSDQPFGEI-TADRSVTHRKDSYHSVYMVDSDT--FK 278

Query: 294 RKND-----EANNYIQTLERLQKQNVITCPELFSILSDPTTKDDILLIYLGLPERTKSNY 348
             ND     E + +IQ+LE LQKQ++IT PELF+ILS+ +  + +LLI L +P+R+  N 
Sbjct: 279 SDNDDLLDVETDGFIQSLEILQKQSIITAPELFTILSNQSESEKLLLIDLRIPQRSALNN 338

Query: 349 IVAKNTINIDPNVLWDFENNCPISEDTKLEKIL--NDQLFNIRKSFAYVVYYTDLKTYMK 406
           IVA N + IDPN+LWD + N P+ +D  LE++L  N+   N R  F YVV Y+D+KT+M 
Sbjct: 339 IVAPNLVKIDPNLLWDKKTNKPVYQDDILEQLLEGNEHFIN-RDKFQYVVCYSDVKTFMT 397

Query: 407 INFDYNFTLFYLLTSSRTSVLKTFPTSLLGGLEKWKKVIRTYYHENGINALNYLHK 462
           +NFDY+F  FYLL +S+ + L T PT+LLGG EKWKK + TY  +  I+  +YL++
Sbjct: 398 MNFDYSFIFFYLLLTSQKTRLATVPTALLGGYEKWKKTLHTYAQQYHISIDDYLYR 453

>YIL156W Chr9 (48091..51306) [3216 bp, 1071 aa] {ON}
           UBP7Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1071

 Score =  321 bits (823), Expect = 1e-97,   Method: Compositional matrix adjust.
 Identities = 210/475 (44%), Positives = 282/475 (59%), Gaps = 52/475 (10%)

Query: 11  FTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDDAL 70
           FTPEYS EL  RVQD+Y  DIK   PQL+L KL+DLLEHT YL E +   +   R +DAL
Sbjct: 17  FTPEYSNELLRRVQDLYHEDIKHYYPQLKLEKLLDLLEHTEYLFELYLDSIHHDRPNDAL 76

Query: 71  SAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSILDK 130
           +A+I+GCYY++LIIPQS QFQT+NKSYS+Y D K +Y+NE NMTNV  MV+ E+  +LD+
Sbjct: 77  TAFIIGCYYVFLIIPQSLQFQTRNKSYSIYTDLKKMYENEMNMTNVVLMVKKEIGVVLDE 136

Query: 131 SYQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMAKPYDS----- 185
           S +     +  I + RAFSV             P  +         L  A P D      
Sbjct: 137 SVKHGAGIEHRITKKRAFSV-------------PADDLSGQVASLSLDTAAPQDHGLKGT 183

Query: 186 -LPMELDDSTPLWTAPSLNPNDQLKLALEQPELTLDEQLSDKTQHNLIDDKYNNFTIPLP 244
               + + S+P+WTAP+L PNDQLKLAL  PE+       +  +           ++P+ 
Sbjct: 184 FTEDDAEQSSPVWTAPNLEPNDQLKLAL-LPEVIPTPAFREPERKT---------SVPVR 233

Query: 245 HQIPLP-VKVTDFNHDKKIQKIYP------VDRSETHRKDSYHSVYM--------DNDNS 289
             + L  V       D     + P       DRS THRKDSYHSVYM        DND+ 
Sbjct: 234 PSVLLEDVPSIYHEDDTSFASLNPPFREITADRSVTHRKDSYHSVYMVDSGNLKEDNDDL 293

Query: 290 AGYVRKNDEANNYIQTLERLQKQNVITCPELFSILSDPTTKDDILLIYLGLPERTKSNYI 349
                 N E + +IQ+L+ LQKQ++IT PELFSILS+   ++ +LLI L +P+R+  N+I
Sbjct: 294 F-----NVENDGFIQSLDILQKQSIITAPELFSILSNRVEREKVLLIDLRIPQRSAINHI 348

Query: 350 VAKNTINIDPNVLWDFENNCPISEDTKLEKIL--NDQLFNIRKSFAYVVYYTDLKTYMKI 407
           VA N +N+DPN+LWD + N PI +D  LE +L  N+   N R  F Y+VYYTD+KT+M I
Sbjct: 349 VAPNLVNVDPNLLWDKQTNTPIYKDDILEHLLKENENFIN-RNKFDYIVYYTDVKTFMTI 407

Query: 408 NFDYNFTLFYLLTSSRTSVLKTFPTSLLGGLEKWKKVIRTYYHENGINALNYLHK 462
           NFDY F  FYL+ +S+ + L T PT+LLGG EKWKK + +Y  E  I+  +YL++
Sbjct: 408 NFDYAFIFFYLMLTSQKTPLTTVPTTLLGGYEKWKKTLHSYAQEYHISIEDYLYR 462

>NDAI0F00200 Chr6 (35966..39283) [3318 bp, 1105 aa] {ON} Anc_5.712
          Length = 1105

 Score =  318 bits (815), Expect = 3e-96,   Method: Compositional matrix adjust.
 Identities = 220/531 (41%), Positives = 306/531 (57%), Gaps = 71/531 (13%)

Query: 9   STFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAF-HHFLPSGRYD 67
           S FTPEYS EL ++VQ IY +DIK   PQL+L KL+DLLEHT YLLE F  +   +    
Sbjct: 7   SPFTPEYSNELLQKVQSIYHDDIKHYYPQLKLEKLLDLLEHTEYLLELFFTYNKNNTNNK 66

Query: 68  DALSAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSI 127
           D L+A+IVGCYYL+LIIPQS QFQ+KNKSY +Y + K LY+NE +MTNV  MV++E++++
Sbjct: 67  DVLTAFIVGCYYLFLIIPQSIQFQSKNKSYGIYTELKKLYENETHMTNVLLMVKDEIENV 126

Query: 128 L--DKSYQEPEPTKRVIPRGRAFSVK----DDTPKDYNTIEFPIRERKSSTTQRPLSMAK 181
           L  D++    +   R+I R RA+S+      +  K  +      +E  ++ T+  L+   
Sbjct: 127 LDMDENNNGSDLNHRIIKRQRAYSISINELSNQVKSLSISNSIDQEHINNKTETSLTNQP 186

Query: 182 P-YDSLPM----------------ELDDSTPLWTAPSLNPNDQLKLALEQPELTLDEQL- 223
           P +  LP+                + D ++PLWTAPSL P DQLKLA      T      
Sbjct: 187 PNHHLLPIILHCDEEFSNEEINATDFDRASPLWTAPSLEPKDQLKLAYTNNTNTKTNTDN 246

Query: 224 ----SDKTQHNL----IDDKYNNFTIP-LPHQIPLPVKVTDF------------------ 256
                D T ++     I   ++N + P +P +IP+    T+                   
Sbjct: 247 NNGQKDSTANDFPFAPIQMPFDNGSAPDIPPKIPITKATTNIINNSESENNVNEGTMPFT 306

Query: 257 -------------NHDKKIQKIYPVDRSETHRKDSYHSVYMDNDNSAGYVRKNDEANNYI 303
                        N+ K I++  P DR+  HRKDSYHS+YM +D SA  + +  ++N YI
Sbjct: 307 TSSLENINNINNINNYKTIEQTNP-DRASNHRKDSYHSIYMVDDGSADGITQYYDSNPYI 365

Query: 304 QTLERLQKQNVITCPELFSILSDPTTKDDILLIYLGLPERTKSNYIVAKNTINIDPNVLW 363
            +LERLQKQ +IT  ELFSILS+P  K  +LLI L  P+R  SN+IVA N I IDP +LW
Sbjct: 366 HSLERLQKQCIITAQELFSILSNPIEKSKLLLIDLRFPKRFSSNHIVAPNLIMIDPMLLW 425

Query: 364 DFENNCPISEDTKLEKILND----QLFNIRKSFAYVVYYTDLKTYMKINFDYNFTLFYLL 419
           + + N PI + T LE +L +    +L   R  F Y+V+YTD KTYM  NFDY+FT FYLL
Sbjct: 426 NSKTNTPIYDITTLENLLYEPKARKLLQNRTQFEYIVFYTDNKTYMNTNFDYSFTFFYLL 485

Query: 420 TSSRTSV-LKTFPTSLLGGLEKWKKVIRTYYHENGINALNYLHKFHVHNID 469
            +S+T+  +K+ PT LLGG +KWKKV+ +Y  +   N  +YL+K H H+ D
Sbjct: 486 VTSKTNKNIKSAPTHLLGGYDKWKKVLYSYSEQYNFNMGDYLYKPHRHSGD 536

>SAKL0E15136g Chr5 complement(1258870..1261983) [3114 bp, 1037 aa]
           {ON} uniprot|Q875P1 Saccharomyces kluyveri UBP7
          Length = 1037

 Score =  314 bits (804), Expect = 4e-95,   Method: Compositional matrix adjust.
 Identities = 202/491 (41%), Positives = 273/491 (55%), Gaps = 54/491 (10%)

Query: 9   STFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDD 68
            ++TPEYS EL + VQD+Y  DIK   P+L+L KLIDLLEH  YL E++H  L  G  +D
Sbjct: 3   CSYTPEYSNELLQFVQDVYAQDIKHYYPKLKLEKLIDLLEHAEYLFESYHMMLKQGNQED 62

Query: 69  ALSAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSIL 128
           AL+A+I+G +Y+YLIIPQS QF T+NKSY +Y D +  YQ+E +MTNV  MV  +VD+IL
Sbjct: 63  ALTAFIIGSFYVYLIIPQSIQFHTRNKSYGIYVDLRKYYQDETSMTNVLLMVTKKVDAIL 122

Query: 129 DKSYQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMAKPYDSLPM 188
            KS ++ + TK  I R RA+SV        N +            Q P  ++K  D+L  
Sbjct: 123 CKS-RDFDDTK--ITRKRAYSVPSQALA--NQLRSLTLNNTDGLEQLP-EVSKESDTLTN 176

Query: 189 ELDDSTPLWTAPSLNPNDQLKLALEQPELTLDEQLSDKTQHNLIDDKYNNFTI------- 241
             DD T +W+AP L P+DQLKLAL  P  +     +      ++D     F+I       
Sbjct: 177 YADDYTTIWSAPKLEPDDQLKLALNPPSKS--SSATSSLSSFVMDQHSKKFSIGESSSDE 234

Query: 242 --PLPHQIPLP------------------VKVTDFNHDKK-----IQKIYP--VDRSETH 274
             P+P Q  LP                  V   D    +K     +  IY   VDR  TH
Sbjct: 235 FEPIPTQEALPMDHATPSEISQRTRHHSIVSSNDTGKSRKDSVESVANIYVQNVDRYNTH 294

Query: 275 RKDSYHSVYMDNDNSAGYVRKNDEANNY--IQTLERLQKQNVITCPELFSILSDPTTKDD 332
           RKDSYHSVYM N+        +D+ N Y   Q L RLQKQ VI+C EL  IL     +++
Sbjct: 295 RKDSYHSVYMLNE--------DDDTNEYDFFQNLSRLQKQYVISCEELMDILQS-DERNN 345

Query: 333 ILLIYLGLPERTKSNYIVAKNTINIDPNVLWDFENNCPISEDTKLEKILND-QLFNIRKS 391
           +LL+ L + +R  +N+IVA N INIDP  LWD +   PIS D +LEK +   Q F  R  
Sbjct: 346 VLLVDLRISKRFHNNHIVAPNLINIDPRDLWDVDRKVPISSDVELEKKMGSYQTFQSRSK 405

Query: 392 FAYVVYYTDLKTYMKINFDYNFTLFYLLTSSRTSVLKTFPTSLLGGLEKWKKVIRTYYHE 451
           F Y+VYYTD+KT++ I+FDY    F LL +S ++ L++ P +LLG  E+WK  I  Y   
Sbjct: 406 FKYIVYYTDMKTFLNIDFDYRLVFFQLLYASSSTRLRSPPKALLGDYEQWKTFIGQYAKH 465

Query: 452 NGINALNYLHK 462
           + I   +YL +
Sbjct: 466 HDIVTGDYLFR 476

>KLTH0E00814g Chr5 (80059..82983) [2925 bp, 974 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 974

 Score =  291 bits (746), Expect = 2e-87,   Method: Compositional matrix adjust.
 Identities = 179/459 (38%), Positives = 263/459 (57%), Gaps = 59/459 (12%)

Query: 11  FTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDDAL 70
           ++PEYS EL + V+D+Y  DI    P+LRL KLIDLLEH  YL E++ H L + + +D L
Sbjct: 5   YSPEYSNELLQFVKDVYTQDIAHYFPKLRLEKLIDLLEHAEYLFESYRHALAANQAEDLL 64

Query: 71  SAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSILDK 130
           +A++ GC+Y+YLIIP S QFQ+++KSY++Y D K  YQ+EANMTNV  MV   ++S+   
Sbjct: 65  TAFVAGCFYIYLIIPHSIQFQSRDKSYAIYADLKKYYQDEANMTNVLLMVTEVIESM--- 121

Query: 131 SYQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMAKPYDSLPMEL 190
           S  E E T R++ R RA+SV    P   + +      + +S T  P     P ++   E 
Sbjct: 122 SKDEVE-TARIM-RKRAYSV----PYGKSPVTIQALSKANSATVEP---DAPTET---EF 169

Query: 191 DDSTPLWTAPSLNPNDQLKLALEQPELTLDEQLSDKTQHNLIDDKYNNFTIPLP--HQIP 248
           ++ T +WTAP L PND LK++L     +     S++ Q   I ++ ++F    P  H + 
Sbjct: 170 ENGTTMWTAPELEPNDHLKVSLGSHHSSTSSASSNE-QFPKIHNESHSFPFEEPELHALS 228

Query: 249 L----------PVKV------------TDFNHDKKIQKIYPVDRSETHRKDSYHSVYMDN 286
           L          P +             +DFN  K       ++R  THRKDSYHSV+M N
Sbjct: 229 LGGSRTRRSSVPARASRKLGTTQASNSSDFNDQK-------INRYATHRKDSYHSVHMSN 281

Query: 287 DNSAGYVRKNDEANNYIQTLERLQKQNVITCPELFSILSDPTTKDDILLIYLGLPERTKS 346
           D+   +             L RLQKQ+V+TC +L  IL     +D++LLI L   +R ++
Sbjct: 282 DDYDAFTF----------NLARLQKQSVVTCDQLMRILCS-QDRDNLLLIDLRFSKRFQT 330

Query: 347 NYIVAKNTINIDPNVLWDFENNCPISEDTKLEKILNDQLFNIRKSFAYVVYYTDLKTYMK 406
           N+I+A N +N+DP +LW+     PI  D +LE+ L+++L N R  F Y+VYYTD+KT+MK
Sbjct: 331 NHILAPNLLNVDPTLLWNQNKGSPIESDVQLERTLDNKLLNARSQFEYIVYYTDMKTFMK 390

Query: 407 INFDYNFTLFYLLTSSRTSVLKTFPTSLLGGLEKWKKVI 445
           ++FDY    F L+ +S  + LK  P  LLGG E+WKK +
Sbjct: 391 LDFDYQLVFFQLIYTSNKN-LKCTPKVLLGGYEQWKKFL 428

>Kwal_55.19645 s55 (62575..65487) [2913 bp, 970 aa] {ON} YIL156W
           (UBP7) - Ubiquitin-specific protease [contig 159] FULL
          Length = 970

 Score =  257 bits (657), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 169/456 (37%), Positives = 241/456 (52%), Gaps = 53/456 (11%)

Query: 11  FTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDDAL 70
           ++PEYS EL + V+++Y  DI    P+LRL KLIDLLEH  YL E++   L + +  + L
Sbjct: 5   YSPEYSNELLQFVKEVYTQDIAHYYPRLRLEKLIDLLEHAEYLFESYRRSLEAKQNSELL 64

Query: 71  SAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSILDK 130
           +A++VGC+Y+YLIIP S QF +++KSY++Y D +  YQ+E NMTNV  MV   ++S+   
Sbjct: 65  TAFVVGCFYIYLIIPHSIQFHSRDKSYAIYADLRKYYQDETNMTNVLLMVTGVIESV--- 121

Query: 131 SYQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMAKPYDSLPMEL 190
           S  E E  K  I R RA+SV      D         E  SST   P +  +         
Sbjct: 122 SRDELESAK--IMRKRAYSVPHKKLSDKMQALTLSPETASSTNAGPETDNE--------- 170

Query: 191 DDSTPLWTAPSLNPNDQLKLAL-------------EQPELTLDEQLSDKTQ------HNL 231
           +DST +WTAP L PND LK+ L             EQ     +E  S  +       H+ 
Sbjct: 171 NDST-MWTAPELEPNDHLKVNLGGHNSSVSSRSSNEQAFKVGNEGNSSSSDDIEMAVHST 229

Query: 232 IDDKYNNFTIPLPHQIPLPVKVTDFNHDKKIQKIY--PVDRSETHRKDSYHSVYMDNDNS 289
             D+      P    +P+ V+    +    +  IY   VDR  THRK SYHSV+M     
Sbjct: 230 TQDQR-----PRRSSVPIKVEAPQNSLQSTVDDIYCQKVDRYNTHRKGSYHSVHM----- 279

Query: 290 AGYVRKNDEANNYIQTLERLQKQNVITCPELFSILSDPTTKDDILLIYLGLPERTKSNYI 349
                  DE +++     RLQKQ++ITC +L  IL D    + +LL+ L   +R ++N+I
Sbjct: 280 -----TGDEYDSFTFNTARLQKQSIITCDKLLRIL-DSEEAERLLLVDLRFIKRFETNHI 333

Query: 350 VAKNTINIDPNVLWDFENNCPISEDTKLEKILNDQLFNIRKSFAYVVYYTDLKTYMKINF 409
           VA N +N+DP  LWDF     I  D  LE +  +        F ++VYYTD+KT+M+++F
Sbjct: 334 VAPNLVNLDPMNLWDFAKGRAIEGDAPLEVLNKNHALKDLSQFKHIVYYTDMKTFMRLDF 393

Query: 410 DYNFTLFYLLTSSRTSVLKTFPTSLLGGLEKWKKVI 445
           DY    F +L +S   +  T P  LLGG E+WKK +
Sbjct: 394 DYQLVFFQMLYTSNWRISCT-PKVLLGGYEQWKKFL 428

>KLLA0A00396g Chr1 (29717..32755) [3039 bp, 1012 aa] {ON} similar to
           uniprot|P40453 Saccharomyces cerevisiae YIL156W UBP7
           Ubiquitin-specific protease that cleaves
           ubiquitin-protein fusions
          Length = 1012

 Score =  226 bits (575), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 162/473 (34%), Positives = 249/473 (52%), Gaps = 62/473 (13%)

Query: 7   FSSTFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRY 66
            S  +TPEYS EL   VQ++Y  D+K    +L+L KLI+LLE    L E++   L   +Y
Sbjct: 1   MSRLYTPEYSDELLSFVQEVYSQDVKHYYAKLKLEKLIELLEQAESLFESYRESLSVEKY 60

Query: 67  DDALSAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDS 126
           +D L  Y++G +Y++LIIP S QF  +NKSYS+Y+D K LYQ+E NM+NV  MV ++VDS
Sbjct: 61  EDCLCEYVIGSFYVFLIIPGSVQFSARNKSYSIYSDLKKLYQDELNMSNVLLMVLHKVDS 120

Query: 127 ILDKSYQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMAKPYDSL 186
           +L+++ +          R RAFSV++        I + +   + +   +  S+   Y S 
Sbjct: 121 VLNQNMEILAKQHLDPSRKRAFSVEEP------IIRYQLHNLQLNNADQK-SVDDDYKSF 173

Query: 187 PMELDDSTPLWTAPSLNPNDQLKLALEQPE---------LTLDEQL----SDKTQHNLID 233
                 ++  W AP L+PND+L LA+   +         ++LDE L     D    + + 
Sbjct: 174 ------ASTEWKAPQLDPNDRLHLAIASSKTTESSSLNSISLDENLYKEQDDTDALDSVS 227

Query: 234 DKY------------NNFTIPLPHQIPLPVKVTDFNHDK---------KIQKIYPVDRSE 272
           DK                   +P    LP +     H K          ++ +   DRS 
Sbjct: 228 DKLLGSIHKPDLLDRTGIIRKVPRHQSLPTE----QHHKLYAQNDSSLMLENMDSFDRSR 283

Query: 273 THRKDSYHSVYMDNDNSAGYVRKNDEANNYIQTLERLQKQNVITCPELFSILSDPTTKDD 332
           THRKDSYHSVY+ ++         ++ NN    L R Q++N I C  LFS+L D  ++++
Sbjct: 284 THRKDSYHSVYLGDE--------LEDLNNISTGLARHQQENTIDCFALFSLLKDAESREN 335

Query: 333 ILLIYLGLPERTKSNYIVAKNTINIDPNVLWDFENNCPISEDTKLEKILNDQLFNIRKSF 392
           +LLI L LP+R +SN++VA N +NIDP +L+D E    +     L+KI+ + + +    +
Sbjct: 336 LLLIDLRLPKRFESNHLVAPNLLNIDPCLLFDTEKGTSLESFEALKKIVANPILDKISQY 395

Query: 393 AYVVYYTDLKTYMKINFDYNFTLFYLLTSSRTSVLKTFPTSLLGGLEKWKKVI 445
             +VYYTD K++M + F+Y   LF LL     + +   P SLLGG E+WK  +
Sbjct: 396 DNIVYYTDYKSFMHLTFNYELILFELLFKKTGTAI---PKSLLGGYEQWKAFL 445

>Ecym_4009 Chr4 (19798..24351) [4554 bp, 1517 aa] {ON} similar to
           Ashbya gossypii AFR296C
          Length = 1517

 Score =  224 bits (571), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 161/476 (33%), Positives = 254/476 (53%), Gaps = 40/476 (8%)

Query: 11  FTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDDAL 70
           + PEYS ELQ+ V+++Y  +++    +LRL KLIDLLEH AYLLE++   L  G+ +  +
Sbjct: 5   YMPEYSLELQQFVEEVYVENLEDCYQKLRLEKLIDLLEHGAYLLESYRELLGRGQVEAGI 64

Query: 71  SAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSILD- 129
           +AY+VG +YLYLIIPQS +F T+N SYS+Y D K  Y+++ NM NV  +V  +V S++  
Sbjct: 65  TAYVVGAFYLYLIIPQSIEFHTRNLSYSIYVDLKRHYESDPNMMNVMLLVAAKVGSVMQL 124

Query: 130 --KSYQEPEPTKRVIPRGRAFSVKD-DTPKDYNTIEFPIRERKSSTTQRPLSMAKPYDSL 186
                 + +   R   R RA+S++  D+ K  +T+     ER S+             + 
Sbjct: 125 YLSGEGDEKYGARFTGRKRAYSMQSCDSSKLADTLGKLSIERSSTRGTTVFEGKTEQGAF 184

Query: 187 PMELDDST---PLWTAPSLNPNDQLKLALE---QPEL--TLDEQLSDKTQHN-------L 231
             +  D      +W+AP+L P+DQLKLA+     P +  T D +  D    N       +
Sbjct: 185 GQQQQDDEWEDTVWSAPNLEPDDQLKLAVSYSHSPSIHDTSDSKTKDSGLENNSAAEFSV 244

Query: 232 IDDKYNNFTIPLPHQIPLPVKVTDFNHDKKIQKIYP----VDRSETHRKDSYHSVYMDND 287
           +D+++ +          L V  +D  ++ ++  I      +DR  TH +D  + +  D  
Sbjct: 245 LDEEWVSERRSGFMSQSLQVDSSDNKNNDELPSIGDHNDVLDRFYTHGQDLRYPICND-- 302

Query: 288 NSAGYVRKNDEANNYIQTLERLQKQNVITCPELFSILSDPTTKDDILLIYLGLPERTKSN 347
              G V   + +      +  L + + I C +L S L+  + +  +LLI L LP+R + +
Sbjct: 303 ---GVVPCENSS------IMWLYESSSIKCLDLLSKLTS-SERSSMLLIDLRLPKRYEYS 352

Query: 348 YIVAKNTINIDPNVLWDFENNCPISEDTKLEKILNDQLFNIRKSFAYVVYYTDLKTYMKI 407
           +I+A+N INIDP +LWD E   P+S   +LE ++++ LF  R+ FA +V YTD  TYM+I
Sbjct: 353 HILAENVINIDPELLWDDEKGAPVSSVKELELVIDNHLFRSRRQFATIVCYTDNYTYMQI 412

Query: 408 NFDYNFTLFYLLTSSRTS-VLKTFPTSLLGGLEKWKKVIRTYYHENGINALNYLHK 462
           +FD+ F LF LL   R   VLKT    L GG E+WK  ++       I   ++L K
Sbjct: 413 DFDFVFLLFRLLYLGRPQLVLKT----LSGGYEQWKSFLKELKRTESIILSDFLWK 464

>CAGL0H06721g Chr8 complement(667816..671061) [3246 bp, 1081 aa]
           {ON} similar to uniprot|P40453 Saccharomyces cerevisiae
           YIL156w UBP7
          Length = 1081

 Score =  223 bits (567), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 133/298 (44%), Positives = 183/298 (61%), Gaps = 31/298 (10%)

Query: 190 LDDSTPLWTAPSLNPNDQLKLAL-----EQPELTLD-EQLSDKTQHNLIDDKYNNFTIPL 243
           ++  +P+WTAP L+PNDQLKLAL       P + LD + L D   +  +           
Sbjct: 274 VEHGSPIWTAPDLDPNDQLKLALGTELLSPPVMGLDGDTLGDDIYYETVS---------- 323

Query: 244 PHQIPLPVKVTDFNHDKKIQKIYPVDRSETHRKDSYHSVYM---DNDNSAGYVRKNDEAN 300
                   K  D ++  K  +    +R  THRKDSYHS+YM   DN+NS  Y    D +N
Sbjct: 324 --------KGDDVSYRGKDFEDLHANRLITHRKDSYHSIYMIDDDNNNSKNYF---DGSN 372

Query: 301 NYIQTLERLQKQNVITCPELFSILSDPTTKDDILLIYLGLPERTKSNYIVAKNTINIDPN 360
            +IQ LERLQKQ++IT PELFSILS+P  +  +LLI L L +R+ +N+IVA N +NIDP 
Sbjct: 373 AFIQGLERLQKQSIITAPELFSILSNPEERHKLLLIDLRLNKRSMANHIVAPNVVNIDPT 432

Query: 361 VLWDFENNCPISEDTKLEKILNDQLFNIRKSFAYVVYYTDLKTYMKINFDYNFTLFYLLT 420
            LWD E N PI +DT LE+ LN+ LFN R  + Y+VYY+D+KTYM   +DY+F LFYLLT
Sbjct: 433 NLWDNEANSPIYKDTILEQRLNNPLFNGRLKYDYIVYYSDMKTYMNFEYDYSFILFYLLT 492

Query: 421 SSRTSVLKTFPTSLLGGLEKWKKVIRTYYHENGINALNYLHKFHVHNIDQKEGDRSNI 478
           +S    L + PT+LLGG EKWKKV+ TY  +  I   +YL++ +  + ++ E + + I
Sbjct: 493 TSGKH-LSSVPTALLGGYEKWKKVMNTYVSQYQIELDDYLYRPYAPSNNKGEQNNAQI 549

 Score = 99.0 bits (245), Expect = 7e-21,   Method: Compositional matrix adjust.
 Identities = 65/181 (35%), Positives = 105/181 (58%), Gaps = 8/181 (4%)

Query: 11  FTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDDAL 70
           FTPE+S +L  ++Q IY ++I+P  PQL+L +L+DLLE    +LE +   +       A+
Sbjct: 4   FTPEFSGQLLLQIQQIYVDEIRPQFPQLKLQRLLDLLEQAQCMLEDYMGCVDVDT-SKAV 62

Query: 71  SAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSILDK 130
             +I GC+Y+YL++P+S QFQT++KSYS+Y + + LY+++ NMTNV +MV+ EV  I ++
Sbjct: 63  RVFITGCFYIYLVMPESMQFQTRSKSYSLYTELRHLYESQLNMTNVIAMVKEEVAQIQEQ 122

Query: 131 S--YQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMA--KPYDSL 186
              +Q+ E      P G      D+     N  +  I  R + +   P  M+    +D L
Sbjct: 123 CDNFQDNEGVDDSKPLGNNLKGADNM---LNQGKRLITRRSAYSISSPSGMSTLSLHDEL 179

Query: 187 P 187
           P
Sbjct: 180 P 180

>TBLA0E01760 Chr5 complement(430209..433847) [3639 bp, 1212 aa] {ON}
           Anc_5.712 YIL156W
          Length = 1212

 Score =  209 bits (531), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 106/201 (52%), Positives = 142/201 (70%), Gaps = 9/201 (4%)

Query: 267 PVDRSETHRKDSYHSVYMDND-----NSAGYVRKNDEANNYIQTLERLQKQNVITCPELF 321
           PVDRS THRKDSYHSVYM ND     N+ GY    DE + YI++LE +QKQ+VITCPELF
Sbjct: 445 PVDRSVTHRKDSYHSVYMFNDSNEDNNNHGY----DETSEYIESLEHIQKQDVITCPELF 500

Query: 322 SILSDPTTKDDILLIYLGLPERTKSNYIVAKNTINIDPNVLWDFENNCPISEDTKLEKIL 381
           S+LS+   ++ +LLI L  PER   N+IVA N + ++P +LWD   N P+    KLE+I+
Sbjct: 501 SLLSNNVEREKVLLIDLRFPERFVKNHIVAPNILQLNPKLLWDDTTNTPVYTAEKLEQII 560

Query: 382 NDQLFNIRKSFAYVVYYTDLKTYMKINFDYNFTLFYLLTSSRTSVLKTFPTSLLGGLEKW 441
           N+ LF+ R +F YVVYY+D+KTYM + FDY FTLFYLL +  +  +K+ PTSLLGG EKW
Sbjct: 561 NNPLFSKRDTFKYVVYYSDMKTYMNMTFDYLFTLFYLLVTCTSKPVKSLPTSLLGGYEKW 620

Query: 442 KKVIRTYYHENGINALNYLHK 462
            KVI +Y ++  I   +Y+++
Sbjct: 621 YKVINSYVNQYSITMNDYVYR 641

 Score =  149 bits (376), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 76/147 (51%), Positives = 101/147 (68%), Gaps = 7/147 (4%)

Query: 11  FTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDDAL 70
           +TPEYS EL + VQ+IY N+ K   PQL+L KLIDLL+H+++L E +   L    +DDAL
Sbjct: 10  YTPEYSDELLQCVQEIYNNEFKTHYPQLKLEKLIDLLDHSSFLFETYTKSLRDSHFDDAL 69

Query: 71  SAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSILDK 130
           SA+IVG +Y+Y IIPQSTQF TKN+ Y MY++ K LY++E NMTNV SMV+ E+  ILD 
Sbjct: 70  SAFIVGSFYMYFIIPQSTQFLTKNRHYRMYHELKNLYEDELNMTNVLSMVKTEITKILDS 129

Query: 131 SYQEPEPT-------KRVIPRGRAFSV 150
           +Y+    +        + I R RAFSV
Sbjct: 130 NYKSQNESSNNLFVDSKFIRRERAFSV 156

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 19/48 (39%), Positives = 26/48 (54%), Gaps = 12/48 (25%)

Query: 191 DDSTPLWTAPSLNPNDQLKLALEQPELTLDEQLSDKTQHNLIDDKYNN 238
           D+S+PLWTAP L+  +QLKLA             D     ++DD Y+N
Sbjct: 263 DESSPLWTAPQLDSKNQLKLA------------PDAGNPQIVDDAYSN 298

>KNAG0L02200 Chr12 complement(394140..397625) [3486 bp, 1161 aa]
           {ON} Anc_5.712 YIL156W
          Length = 1161

 Score =  202 bits (514), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 108/205 (52%), Positives = 143/205 (69%), Gaps = 4/205 (1%)

Query: 258 HDKKIQKIYPVDRSETHRKDSYHSVYM--DNDNSAGYVRKNDEANNYIQTLERLQKQNVI 315
           HD+  +   P DRS THRK+SYHSVYM  ++++S G +   DE+N YIQ+LERLQKQ++I
Sbjct: 341 HDRSFKDFTP-DRSLTHRKNSYHSVYMLEESESSQGNLYY-DESNAYIQSLERLQKQSII 398

Query: 316 TCPELFSILSDPTTKDDILLIYLGLPERTKSNYIVAKNTINIDPNVLWDFENNCPISEDT 375
           T PELFSILS+      +LLI L L  R  ++ I+A NT++IDP +LW+  +  P+ E T
Sbjct: 399 TAPELFSILSNEQQSKQLLLIDLRLDYRYNTSKIIAPNTVHIDPKMLWNSNSGAPMYEIT 458

Query: 376 KLEKILNDQLFNIRKSFAYVVYYTDLKTYMKINFDYNFTLFYLLTSSRTSVLKTFPTSLL 435
           +LE  LN+ LFN R  F YVVY++D+KT+MK+NFDY+FT FYLL ++R   LK  PT LL
Sbjct: 459 ELESKLNNPLFNRRDEFDYVVYFSDMKTFMKLNFDYHFTFFYLLNTARGKPLKCVPTVLL 518

Query: 436 GGLEKWKKVIRTYYHENGINALNYL 460
           GG EKWKKVI  Y  +  I   +YL
Sbjct: 519 GGYEKWKKVILEYGKQYNICVTDYL 543

 Score =  165 bits (418), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 95/236 (40%), Positives = 133/236 (56%), Gaps = 30/236 (12%)

Query: 11  FTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDDAL 70
           FTPE S EL +RV  +Y +DI   LPQLRL +LIDLLEHT +L E +   L   +  DAL
Sbjct: 14  FTPELSDELWQRVVKVYTDDIGTALPQLRLQRLIDLLEHTEWLYELYLSCLGKDQNMDAL 73

Query: 71  SAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSILDK 130
            ++I GC+Y+YL++PQS QF T+N+++++Y+D + LY+++ NMTNV  MV+ EV  +L+ 
Sbjct: 74  GSFINGCFYVYLVMPQSIQFHTRNRAHTVYSDVRALYESQVNMTNVLLMVKEEVQVVLES 133

Query: 131 SYQEPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMAKPYDSLPM-- 188
            +      +R IPR RA+SV D+     N  +  ++    +   RP S  K    LP   
Sbjct: 134 QWDSASLNER-IPRNRAYSVPDEARVVQNLDKLTLQSPTETRGGRPRSQKKQLLQLPRPG 192

Query: 189 --------------------------ELDD-STPLWTAPSLNPNDQLKLALEQPEL 217
                                     +LDD S+PLW AP L PNDQLKLA E  +L
Sbjct: 193 NVPVHSDSEFIAEQGISLHGDDSGWSDLDDQSSPLWRAPQLEPNDQLKLAAEVHDL 248

>AFR296C Chr6 complement(972519..976028) [3510 bp, 1169 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL156W
           (UBP7) and YKR098C (UBP11)
          Length = 1169

 Score =  136 bits (343), Expect = 5e-33,   Method: Compositional matrix adjust.
 Identities = 78/207 (37%), Positives = 120/207 (57%), Gaps = 11/207 (5%)

Query: 7   FSSTFTPEYSTELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRY 66
            S  + PEYS+EL+  VQ+ Y+  ++ L P+LR  KL+DLLE  A L E++   +  G+ 
Sbjct: 1   MSVPYIPEYSSELRTFVQEAYEQQVQELYPRLRFEKLVDLLERAANLFESYQDLVREGQT 60

Query: 67  DDALSAYIVGCYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDS 126
            + L AY++G +YLYLIIPQS +F T+N SYS+Y D +  Y+ E NMTNV  MV  +VD+
Sbjct: 61  REGLMAYVIGAFYLYLIIPQSIEFHTRNLSYSLYTDLRKHYEREPNMTNVVQMVTEKVDA 120

Query: 127 ILDKSYQEPEPTKRV---IPRGRAFSVKD-DTPKDYNTIEFPIRERKSSTTQRPLSMAKP 182
           +L +  Q PE  +R    + R RA+SV +    +  ++++    + K       +  A P
Sbjct: 121 VLLR--QTPEDGERGDTKLYRKRAYSVPEKGVARSSDSLQHLTVDGKRRGGHHAIGGAIP 178

Query: 183 YDSLPMELDDSTPLWTAPSLNPNDQLK 209
              + ++ D    LW+AP L  ND L+
Sbjct: 179 --EVAVQADT---LWSAPKLEENDLLR 200

 Score = 95.9 bits (237), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 61/180 (33%), Positives = 96/180 (53%), Gaps = 14/180 (7%)

Query: 268 VDRSETHRKDSYHSVYMDNDNSAGYVRKNDEANNYIQTLERLQKQNVITCPELFSILSDP 327
           +DR    R + Y+     N N+AG    N         L RL + + I C +L  IL + 
Sbjct: 413 LDRPHNSRVEPYNP--FANGNAAGLESCN--------PLTRLYETSSIKCSDLMIIL-ES 461

Query: 328 TTKDDILLIYLGLPERTKSNYIVAKNTINIDPNVLWDFENNCPISEDTKLEKILNDQLFN 387
             +D +L I L  P+R + N+IVA++ INIDP +LWD E + PI+   + E+ L++ LF 
Sbjct: 462 DIQDRVLFIDLRPPKRYELNHIVARHLINIDPLLLWDTERSAPITSVNEFERRLDNPLFT 521

Query: 388 IRKSFAYVVYYTDLKTYMKINFDYNFTLFYLLTSSRTSVLKTFPTSLLGGLEKWKKVIRT 447
            R  F+Y+V YTD  T M ++F +  T F L+   +  +L      L GG ++W+  ++T
Sbjct: 522 TRGQFSYLVCYTDNHTSMNMDFKFELTFFELVYMGKPRLLT---KCLQGGYDQWRLYLKT 578

>KAFR0D02160 Chr4 (432966..435506) [2541 bp, 846 aa] {ON} Anc_5.712
           YIL156W
          Length = 846

 Score =  132 bits (333), Expect = 7e-32,   Method: Compositional matrix adjust.
 Identities = 134/448 (29%), Positives = 207/448 (46%), Gaps = 108/448 (24%)

Query: 16  STELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDDALSAYIV 75
           S EL + V  IY + IKP+  QL   + IDLLE+T  L   F +FL      D+L ++I+
Sbjct: 13  SDELTKLVVSIYNSKIKPIYKQLLTLRPIDLLEYTEQL---FEYFLKGN--TDSLDSFII 67

Query: 76  GCYYLYLIIPQS-TQFQTKNKSY-SMYNDWKILYQNEANMTNVCSMVRNEVDSILDKSYQ 133
           G +Y+ L+IP S    ++ N  Y ++Y D K  Y+++ N++++  ++R+E ++IL     
Sbjct: 68  GYFYISLVIPTSHAMIKSSNNDYIAIYQDLKKYYESQPNLSDLLFIIRSESENIL----- 122

Query: 134 EPEPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMAKPYDSLPMELDDS 193
                       ++F V  D P  ++  E    E  ++                   D S
Sbjct: 123 ------------QSFDV--DAPSSHSQHE----EDNTA-------------------DSS 145

Query: 194 TPLWTAPSLNPNDQLKLALEQPELTLDEQLSDKTQHNLIDDKYNNFTIPLPHQIPLPVKV 253
           T +W AP L PNDQLKLA+   E  L+ +   + +   ID   N              K 
Sbjct: 146 TTIWQAPFLEPNDQLKLAIISSESELESETEVEAE---IDINAN------------ESKY 190

Query: 254 TDFNHDKKIQKIYPVDRSETHRKDSYHSVYMDNDNSAGYVRKNDEANNYIQTLERLQKQN 313
           T+F +DK I                                 NDE + Y++    L ++ 
Sbjct: 191 TNFINDKTI---------------------------------NDE-DTYLK---HLYEEC 213

Query: 314 VITCPELFSILSDPTTKDDILLIYLGLPERTKSNYIVAKNTINIDPNVLWDFENNCPISE 373
            IT  ELFSILS+P+ +  IL+I L L        I + N I  DP  LW+  +  P+  
Sbjct: 214 FITPHELFSILSNPSDRLKILIIDLRLSRYFNLQTIRSPNLIKFDPIELWNNRDQTPVLH 273

Query: 374 DTKLEKILNDQLFNIRKSFAYVVYYTDLKTYMKI-NFDYNFTLFYLLTSSRTSVLKTFPT 432
            T L    ++ LF     F+Y++ Y+D +T     +F+YNF+ F LL SS    +K  P 
Sbjct: 274 RTSL---FSNPLFQKIDLFSYIIIYSDNETTTAFESFEYNFSFFKLLMSSS---MKVTPN 327

Query: 433 SLLGGLEKWKKVIRTYYHENGINALNYL 460
            LLGG EKW+++I +Y  + GI   NY+
Sbjct: 328 FLLGGFEKWEQLISSYSEQYGIETSNYI 355

>YKR098C Chr11 complement(633026..635179) [2154 bp, 717 aa] {ON}
           UBP11Ubiquitin-specific protease that cleaves ubiquitin
           from ubiquitinated proteins
          Length = 717

 Score =  107 bits (266), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 58/128 (45%), Positives = 77/128 (60%)

Query: 23  VQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDDALSAYIVGCYYLYL 82
           V+ +Y+ DIK    QLRL  L  LL+H A+L   +   L   +  +AL+A+I+GCYYLYL
Sbjct: 12  VRKVYEVDIKQFYSQLRLKNLRGLLDHAAHLFNVYLRDLEINQEMEALTAFIIGCYYLYL 71

Query: 83  IIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSILDKSYQEPEPTKRVI 142
           IIPQS QFQT+N  YS Y   K  YQ+E  M  V  +VR+E   I+D+   E     R I
Sbjct: 72  IIPQSLQFQTRNNLYSSYAKLKNDYQDEHVMGYVLKVVRDESTVIVDRYLAESNGICRTI 131

Query: 143 PRGRAFSV 150
            R RA+S+
Sbjct: 132 KRKRAYSL 139

>Skud_11.338 Chr11 complement(614651..616789) [2139 bp, 712 aa] {ON}
           YKR098C (REAL)
          Length = 712

 Score =  103 bits (256), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 56/128 (43%), Positives = 80/128 (62%)

Query: 23  VQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDDALSAYIVGCYYLYL 82
           V+D+Y+ DIK    QLRL  L  L++HT++L + +   L   R  +AL+A+I+G YYLYL
Sbjct: 12  VRDVYEVDIKQFYSQLRLKNLRGLVDHTSHLFDVYLRDLEINREVEALTAFIIGGYYLYL 71

Query: 83  IIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSILDKSYQEPEPTKRVI 142
           IIPQS QFQT++  YS Y   K  YQ+E  M+ V  +VR+E  SI+D+   +       I
Sbjct: 72  IIPQSLQFQTRSNLYSSYAKLKNSYQDEQLMSYVLRLVRDESTSIVDQYLSDSNRITVTI 131

Query: 143 PRGRAFSV 150
            R RA+S+
Sbjct: 132 TRKRAYSL 139

>Smik_11.362 Chr11 complement(623098..625263) [2166 bp, 721 aa] {ON}
           YKR098C (REAL)
          Length = 721

 Score =  101 bits (251), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 54/128 (42%), Positives = 78/128 (60%)

Query: 23  VQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDDALSAYIVGCYYLYL 82
           V+++Y+ DIK    QLRL  L  LL+H A+L E +       +  +AL+A+I+G YYLYL
Sbjct: 12  VRNVYEVDIKQFYSQLRLKNLRGLLDHAAHLFEVYLRDSEINQEMEALTAFIIGGYYLYL 71

Query: 83  IIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSILDKSYQEPEPTKRVI 142
           +IPQS QFQT+N  YS Y   K  YQ+E  M+ V  +V+ E + I+D+   +     R I
Sbjct: 72  VIPQSLQFQTRNNLYSSYAKLKNDYQDEQIMSYVLKIVKEESNMIVDRYLSDSNRISRTI 131

Query: 143 PRGRAFSV 150
            R RA+S+
Sbjct: 132 TRKRAYSL 139

>Suva_11.335 Chr11 complement(617850..620024) [2175 bp, 724 aa] {ON}
           YKR098C (REAL)
          Length = 724

 Score = 95.1 bits (235), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 63/167 (37%), Positives = 96/167 (57%), Gaps = 14/167 (8%)

Query: 23  VQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDDALSAYIVGCYYLYL 82
           V+++Y  DIK +  QLRL KL  LLEH AYL + +   L + +  +AL+A+IVG +YLYL
Sbjct: 12  VREVYDVDIKCVYSQLRLKKLKTLLEHAAYLFDVYVRDLKNNQKKNALTAFIVGGFYLYL 71

Query: 83  IIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSILDKSYQEPEPTKRVI 142
           +IP S QFQT+N  YS Y   K  YQ+E  M+ V  +V++E   I+D+   + +   R +
Sbjct: 72  VIPHSLQFQTRNNVYSSYAKLKNKYQDEQGMSYVLKLVKDESTIIVDQCLSDSKRISRSM 131

Query: 143 PRGRAFS-------VKDDTPKDYNTIEFPIRERKSSTTQRPLSMAKP 182
            R RA+S       V   +   +N ++ P+RE        P+ ++KP
Sbjct: 132 KRKRAYSLPLRPLPVHMASLSIHNQLDVPLRE-------MPIEISKP 171

>KAFR0H00150 Chr8 (14149..16119) [1971 bp, 656 aa] {ON} Anc_5.712
           YIL156W possible pseudogene; NNN added to avoid internal
           stop codon
          Length = 656

 Score = 94.0 bits (232), Expect = 2e-19,   Method: Compositional matrix adjust.
 Identities = 64/180 (35%), Positives = 94/180 (52%), Gaps = 11/180 (6%)

Query: 18  ELQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLP-SGRYDDALSAYIVG 76
           +L   V  I+Q+DIK    +LRL +L DLL+HT YLL+ F  +     R   A  A++ G
Sbjct: 29  DLPSLVDSIFQHDIKDYYTKLRLERLNDLLDHTTYLLDLFKVYTSHKSRKRQATLAFVNG 88

Query: 77  CYYLYLIIPQSTQFQTKNKSYSMYNDWKILYQNEANMTNVCSMVRNEVDSILDKSYQEPE 136
            +YL+LIIP   QFQTKNK ++ Y D KI Y+ + +M N+   V+ +  SIL+   Q+  
Sbjct: 89  SFYLFLIIPYCVQFQTKNKLFTRYKDLKIDYEGQISMKNILDTVKEKSVSILE---QDLS 145

Query: 137 PTKRVIPRGRAF---SVKDDTPKDYNTIEF----PIRERKSSTTQRPLSMAKPYDSLPME 189
              R I + RA+   S++    +D ++       P      S  QR LS  K   +L  E
Sbjct: 146 GINRRILKKRAYTEPSIRSGLSRDRSSTSVLSRKPTLSHVPSNPQRTLSTPKRSSTLMTE 205

>CAGL0G02563g Chr7 complement(235498..237393) [1896 bp, 631 aa] {ON}
           weakly similar to uniprot|P36026 Saccharomyces
           cerevisiae YKR098c UBP11 ubiquitin C-terminal hydrolase
          Length = 631

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/98 (27%), Positives = 45/98 (45%), Gaps = 2/98 (2%)

Query: 19  LQERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDDALSAYIVGCY 78
           L+  V  +++  IK     L L K+  LL   A  L+           + +   Y  GC+
Sbjct: 13  LKSLVSQVFETSIKKQYWVLTLCKVSQLLGQAAKYLDKTETLGQEKLLESSYMNYAAGCF 72

Query: 79  YLYLIIPQSTQFQTKNKSYSMYNDWK--ILYQNEANMT 114
           Y+YL++P + QFQ ++  Y  Y   K   L + E ++T
Sbjct: 73  YIYLLVPNANQFQLEDTEYGTYLQLKNNYLVKGEGDLT 110

>KLLA0F19338g Chr6 (1789536..1792211) [2676 bp, 891 aa] {ON} similar
           to uniprot|P38359 Saccharomyces cerevisiae YBR294W SUL1
           High affinity sulfate permease sulfate uptake is
           mediated by specific sulfate transporters Sul1p and
           Sul2p which control the concentration of endogenous
           activated sulfate intermediates and uniprot|Q12325
           Saccharomyces cerevisiae YLR092W SUL2
          Length = 891

 Score = 38.1 bits (87), Expect = 0.072,   Method: Compositional matrix adjust.
 Identities = 29/103 (28%), Positives = 48/103 (46%), Gaps = 9/103 (8%)

Query: 20  QERVQDIYQNDIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPSGRYDDALSAYIVGCYY 79
           +E V D  Q   + L P L  S +++ L     LL+  HH+  +  Y+D ++   VGC  
Sbjct: 113 EETVVDAKQLYDEKLRPYLTFSAIVEYLTSLFPLLKWVHHYNFNWLYNDLVAGITVGC-- 170

Query: 80  LYLIIPQS---TQFQTKNKSYSMYNDW--KILYQNEANMTNVC 117
             +++PQS    Q  T    Y +Y+ +    +Y   A   +VC
Sbjct: 171 --VLVPQSMSYAQIATLPAQYGLYSSFVGAFIYSFFATSKDVC 211

>CAGL0I06765g Chr9 (655806..658469) [2664 bp, 887 aa] {ON} similar
           to uniprot|P32571 Saccharomyces cerevisiae YDR069c DOA4
           ubiquitin-specific protease
          Length = 887

 Score = 35.8 bits (81), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 26/89 (29%), Positives = 47/89 (52%), Gaps = 3/89 (3%)

Query: 315 ITCPELFSILSDPTTKDDILLIYLGLPERTKSNYIVAKNTINIDPNVLWDFENNCPISED 374
           I+C EL S++     +D +LLI +       +++I  KN I I+P    +  ++  I + 
Sbjct: 190 ISCSELLSLMK--MKEDSLLLIDVRPKLEYDAHHIKTKNIICIEPISFKESYSDQQIEKT 247

Query: 375 TKLEKILND-QLFNIRKSFAYVVYYTDLK 402
           + +    ++ QLF  R  F Y++ YTDL+
Sbjct: 248 SMIPSPKHEIQLFQRRSEFQYIILYTDLE 276

>NCAS0G00320 Chr7 complement(55420..56604) [1185 bp, 394 aa] {ON} 
          Length = 394

 Score = 32.7 bits (73), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 39/84 (46%), Gaps = 8/84 (9%)

Query: 362 LWDFENNCPISE--DTKLEKILNDQLFNIRKSFAYVVYYTDL-----KTYMKINFDYNFT 414
           +W F +  PIS+  DT  E +L +  +++ KSF   V Y +L     K Y+ +N DY   
Sbjct: 65  IWKFWSRRPISKTIDTSEESLLWEGFWSLTKSFQVTVSYNELLSNHFKDYITLNPDYGRP 124

Query: 415 LFYL-LTSSRTSVLKTFPTSLLGG 437
              L    S  +   T P  ++ G
Sbjct: 125 ELILPADESEATDFGTLPVLIICG 148

>KLLA0E14213g Chr5 complement(1257304..1258902) [1599 bp, 532 aa]
           {ON} highly similar to uniprot|Q12428 Saccharomyces
           cerevisiae YPR002W PDH1 Mitochondrial protein that
           participates in respiration induced by diauxic shift
           homologous to E. coli PrpD may take part in the
           conversion of 2-methylcitrate to 2-methylisocitrate
          Length = 532

 Score = 32.0 bits (71), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 23/51 (45%)

Query: 136 EPTKRVIPRGRAFSVKDDTPKDYNTIEFPIRERKSSTTQRPLSMAKPYDSL 186
           +P+KR IP      + D T  D   +E+PI  R       PL M K Y  L
Sbjct: 445 DPSKRSIPNALLVELNDGTVLDEVVVEYPIGHRLRRKEGVPLLMQKFYHHL 495

>ZYRO0E00594g Chr5 complement(38569..43626) [5058 bp, 1685 aa] {ON}
           similar to uniprot|P34241 Saccharomyces cerevisiae
           YKL014C URB1 Nucleolar protein required for the normal
           accumulation of 25S and 5.8S rRNAs associated with the
           27SA2 pre-ribosomal particle proposed to be involved in
           the biogenesis of the 60S ribosomal subunit
          Length = 1685

 Score = 31.6 bits (70), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 29/52 (55%), Gaps = 1/52 (1%)

Query: 30  DIKPLLPQLRLSKLIDLLEHTAYLLEAFHHFLPS-GRYDDALSAYIVGCYYL 80
           + KP    ++ S ++ +L+H   L+  + H+L S G +D  +++Y  GC  L
Sbjct: 344 NFKPWESDMQASTVLKILDHVPELVPPYCHYLASHGTHDPKMTSYWFGCTML 395

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 66,566,933
Number of extensions: 3251160
Number of successful extensions: 11473
Number of sequences better than 10.0: 89
Number of HSP's gapped: 11870
Number of HSP's successfully gapped: 97
Length of query: 562
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 447
Effective length of database: 40,294,809
Effective search space: 18011779623
Effective search space used: 18011779623
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 68 (30.8 bits)