Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_237.18.850ON50350323800.0
Suva_13.4758.850ON51543817160.0
NCAS0C003108.850ON55643617100.0
TDEL0B001908.850ON49243416930.0
YMR285C (NGL2)8.850ON51543816900.0
Smik_13.5018.850ON51543816590.0
TPHA0I003208.850ON52943716570.0
ZYRO0C14872g8.850ON49643616380.0
TBLA0B029008.850ON52043616370.0
CAGL0I02684g8.850ON49343516340.0
Skud_13.4588.850ON51443816350.0
SAKL0D01166g8.850ON50543416270.0
NDAI0K003708.850ON56842716250.0
KAFR0L019608.850ON51143816030.0
KLTH0C03608g8.850ON49543415680.0
Kwal_27.102048.850ON49443614870.0
KNAG0K006508.850ON48244114690.0
KLLA0C06248g8.850ON51644014120.0
ABL118W8.850ON50442413570.0
Ecym_46198.850ON48742213101e-177
NDAI0E002608.850ON49844911221e-149
TBLA0D033008.850ON48044511181e-148
NCAS0B002708.850ON47644011001e-146
Smik_13.168.850ON5024539231e-119
CAGL0B02387g8.850ON4714469171e-118
Suva_13.258.850ON5024479081e-116
YML118W (NGL3)8.850ON5054528951e-114
Skud_13.238.850ON4984518761e-112
KAFR0A028608.850ON4784348581e-109
KNAG0G034708.850ON4664418181e-103
Ecym_73547.78ON7852371761e-12
KLLA0F15884g7.78ON7902381742e-12
CAGL0H06149g7.78ON8732481724e-12
ACR288W7.78ON7362351714e-12
Suva_1.457.78ON8312251715e-12
SAKL0B10032g7.78ON7312291698e-12
KLTH0D02310g7.78ON7392451698e-12
KNAG0D048407.78ON7792471634e-11
KAFR0K006707.78ON7952271591e-10
YAL021C (CCR4)7.78ON8372271582e-10
NDAI0H025207.78ON8982241572e-10
Kwal_26.71127.78ON7422291563e-10
Smik_1.457.78ON8392271546e-10
Skud_1.407.78ON8692281528e-10
ZYRO0D05302g7.78ON8572301521e-09
KAFR0D012507.90ON3562371472e-09
TPHA0H026807.78ON8722531431e-08
TDEL0H037307.78ON7972501421e-08
TBLA0A046607.78ON8962551402e-08
Kpol_1040.147.78ON7842251384e-08
NCAS0F016407.78ON8552361332e-07
ACR277C7.90ON3782631242e-06
KNAG0L005507.90ON3812361142e-05
Kpol_1044.67.90ON3722551115e-05
Kwal_26.71707.90ON3722451106e-05
KLTH0D02574g7.90ON3682461081e-04
TPHA0L005307.90ON3912401071e-04
CAGL0F01001g7.90ON3592371072e-04
SAKL0B09768g7.90ON3681141053e-04
ZYRO0D05588g7.90ON3561071044e-04
KLLA0F07733g7.90ON371771034e-04
TBLA0E022607.90ON388257990.002
Ecym_26367.90ON36777930.009
NCAS0I005007.90ON38995910.014
TDEL0H036007.90ON366248900.018
Smik_15.1257.90ON36364900.018
Skud_15.1157.90ON36363890.023
NDAI0A085307.90ON365236870.037
Suva_15.1277.90ON36363860.055
YOL042W (NGL1)7.90ON36363850.067
NDAI0E021058.677ON40832714.2
Smik_16.1918.493ON79873706.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_237.1
         (503 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON} com...   921   0.0  
Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {...   665   0.0  
NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850      663   0.0  
TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}...   656   0.0  
YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON} ...   655   0.0  
Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {...   643   0.0  
TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}...   642   0.0  
ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]...   635   0.0  
TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {O...   635   0.0  
CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {...   634   0.0  
Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {...   634   0.0  
SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar ...   631   0.0  
NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON...   630   0.0  
KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {...   622   0.0  
KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {...   608   0.0  
Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {...   577   0.0  
KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {...   570   0.0  
KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {...   548   0.0  
ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic ho...   527   0.0  
Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar...   509   e-177
NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850...   436   e-149
TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {O...   435   e-148
NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850      428   e-146
Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W (...   360   e-119
CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {...   357   e-118
Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W (...   354   e-116
YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5' e...   349   e-114
Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W (...   342   e-112
KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {O...   335   e-109
KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {O...   319   e-103
Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar t...    72   1e-12
KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]...    72   2e-12
CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {...    71   4e-12
ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic ho...    70   4e-12
Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON} Y...    70   5e-12
SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} simila...    70   8e-12
KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {...    70   8e-12
KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.7...    67   4e-11
KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {...    66   1e-10
YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}  ...    65   2e-10
NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78      65   2e-10
Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {O...    65   3e-10
Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON} Y...    64   6e-10
Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON} Y...    63   8e-10
ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {...    63   1e-09
KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.9...    61   2e-09
TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.7...    60   1e-08
TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.7...    59   1e-08
TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa] ...    59   2e-08
Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {O...    58   4e-08
NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78      56   2e-07
ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON} S...    52   2e-06
KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90...    49   2e-05
Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119...    47   5e-05
Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W...    47   6e-05
KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} simila...    46   1e-04
TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90...    46   1e-04
CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly...    46   2e-04
SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {...    45   3e-04
ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} simila...    45   4e-04
KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} simila...    44   4e-04
TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {O...    43   0.002
Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {O...    40   0.009
NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90 ...    40   0.014
TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {O...    39   0.018
Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042...    39   0.018
Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042...    39   0.023
NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa] ...    38   0.037
Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042...    38   0.055
YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putat...    37   0.067
NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}     32   4.2  
Smik_16.191 Chr16 (342583..344979) [2397 bp, 798 aa] {ON} YPL045...    32   6.5  

>Kpol_237.1 s237 complement(188..1699) [1512 bp, 503 aa] {ON}
           complement(188..1699) [1512 nt, 504 aa]
          Length = 503

 Score =  921 bits (2380), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/503 (88%), Positives = 445/503 (88%)

Query: 1   MDSVKNVDDATTIAVKLEKELIIPNDNEGNEXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 60
           MDSVKNVDDATTIAVKLEKELIIPNDNEGNE                             
Sbjct: 1   MDSVKNVDDATTIAVKLEKELIIPNDNEGNESVKVRSKKKGRSKPSPEEIERKRAERAAA 60

Query: 61  XXXXXXXLLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLF 120
                  LLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLF
Sbjct: 61  KEQKRKELLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLF 120

Query: 121 PDSGEAVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIAS 180
           PDSGEAVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIAS
Sbjct: 121 PDSGEAVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIAS 180

Query: 181 KNHGVAIVWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKN 240
           KNHGVAIVWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKN
Sbjct: 181 KNHGVAIVWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKN 240

Query: 241 XXXXXXXXXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFC 300
                      HLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFC
Sbjct: 241 TKTTGIIIGTTHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFC 300

Query: 301 GDFNSQPFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXXXXNIEKFG 360
           GDFNSQPFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRN           NIEKFG
Sbjct: 301 GDFNSQPFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNGEEDVDDEEGGNIEKFG 360

Query: 361 KDQPQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGE 420
           KDQPQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGE
Sbjct: 361 KDQPQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGE 420

Query: 421 PIISNWANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKH 480
           PIISNWANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKH
Sbjct: 421 PIISNWANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKH 480

Query: 481 GQPHEGEYASDHLSMICNIELLL 503
           GQPHEGEYASDHLSMICNIELLL
Sbjct: 481 GQPHEGEYASDHLSMICNIELLL 503

>Suva_13.475 Chr13 complement(822078..823625) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/438 (70%), Positives = 360/438 (82%), Gaps = 2/438 (0%)

Query: 68  LLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGEAV 127
           +LA+G+DPD PPEL FIKRP L LH++EPVTGF F LMTYNCLAQALIRRKLFPDSG+A+
Sbjct: 78  MLAQGIDPDCPPELHFIKRPFLSLHEEEPVTGFRFKLMTYNCLAQALIRRKLFPDSGDAL 137

Query: 128 KWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAI 187
           KW+RRS+VLL EF+HYN+DVICLQEIDHIQ+Q+FWK EF KLGYE Q+HR ++KNHGVAI
Sbjct: 138 KWYRRSRVLLNEFRHYNADVICLQEIDHIQFQSFWKEEFSKLGYEGQYHRNSTKNHGVAI 197

Query: 188 VWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPK-NXXXXXX 246
           +W+R+MF+  D+MLIDFDKE S +IP RT TNN GL+L+LKFS+K+LS L K +      
Sbjct: 198 IWRRDMFQQVDKMLIDFDKEVSGNIPTRTTTNNVGLVLALKFSEKVLSNLGKASSKKSGI 257

Query: 247 XXXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQ 306
                HLFWHPFGTYERTRQCY++L KM+EFMHRVNVLQN NDGDLSHW PFFCGDFNSQ
Sbjct: 258 LIGTSHLFWHPFGTYERTRQCYIVLKKMEEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQ 317

Query: 307 PFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXXXXNIEKFGKDQPQT 366
           PFD+PYLSMT KP+ Y +RAKTVI+CSTS+KFSK+R+           NIEKFGKDQP++
Sbjct: 318 PFDTPYLSMTCKPVHYEKRAKTVIECSTSFKFSKVRDGEEGADEEEGGNIEKFGKDQPES 377

Query: 367 PVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIISNW 426
           PVP+ F ANEEQ  LV+ MA +HN L MRA SLYSV YK+VH ENAG+DN RGEP ISNW
Sbjct: 378 PVPKDFHANEEQIELVDEMAQLHNSLDMRAVSLYSVAYKNVHPENAGLDNDRGEPEISNW 437

Query: 427 ANTWRGLLDYIFHVNTWDF-DNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHGQPHE 485
           ANTWRGLLDY+F++  WD   N Q VDSL+ FE +N I+ RGFLRMP  SEM KHGQPH 
Sbjct: 438 ANTWRGLLDYLFYIKKWDLRSNCQEVDSLDDFEKDNEIKFRGFLRMPPGSEMTKHGQPHV 497

Query: 486 GEYASDHLSMICNIELLL 503
           GEYASDHLSM+C+IEL L
Sbjct: 498 GEYASDHLSMVCDIELQL 515

>NCAS0C00310 Chr3 (42498..44168) [1671 bp, 556 aa] {ON} Anc_8.850
          Length = 556

 Score =  663 bits (1710), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/436 (70%), Positives = 354/436 (81%), Gaps = 2/436 (0%)

Query: 69  LAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGEAVK 128
           LA+GLDP+  P+LQFI+RP+LHLH++EPVTGF  ++MTYNCLAQALIRRKLFPDSG+A+K
Sbjct: 121 LAQGLDPNALPDLQFIQRPILHLHEEEPVTGFKISIMTYNCLAQALIRRKLFPDSGDALK 180

Query: 129 WFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAIV 188
           WF+RSKVL  EF+HYN DVICLQEIDH+QYQ+FWK EFEK+GYESQFHR  SKNHGVAI+
Sbjct: 181 WFKRSKVLSNEFKHYNPDVICLQEIDHLQYQSFWKAEFEKVGYESQFHRKQSKNHGVAII 240

Query: 189 WKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXXXX 248
           W++E+F +TD+MLIDFDKE S +IPPRT TNN GL LSLKF++K LS             
Sbjct: 241 WRKELFTLTDKMLIDFDKEPSGEIPPRTTTNNAGLALSLKFTEKALSKFSNGTSRMGIIV 300

Query: 249 XXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQPF 308
              HLFWHPFGTYERTRQCYV+LNKMKEFMHR+NVLQN NDGD SHW PFFCGDFNSQPF
Sbjct: 301 GTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRINVLQNNNDGDTSHWYPFFCGDFNSQPF 360

Query: 309 DSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXXXXNIEKFGKDQPQTPV 368
           D+PYLSMTSKPI Y  RAKTVI+CSTSYKFSK R+           NIEKFGKDQPQTPV
Sbjct: 361 DTPYLSMTSKPIHYKGRAKTVIECSTSYKFSKKRDGEEDADEEEGGNIEKFGKDQPQTPV 420

Query: 369 PETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIISNWAN 428
           P+ FIANEEQ  LV+ M ++HN L MRA SLY VGY+ VH ENAG+DN  GEP ISNWA+
Sbjct: 421 PDHFIANEEQKKLVKNMELLHNSLDMRAISLYGVGYRKVHPENAGLDNDCGEPEISNWAH 480

Query: 429 TWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPK--HGQPHEG 486
           TW GLLDYI  +  W FD+ Q VD+LEKFE ENSI++RG+LRMP  +EM K  HGQPH G
Sbjct: 481 TWNGLLDYILFIKHWGFDDCQHVDTLEKFEKENSIKVRGYLRMPPSTEMSKHGHGQPHTG 540

Query: 487 EYASDHLSMICNIELL 502
           EY SDHLSMIC +EL+
Sbjct: 541 EYPSDHLSMICELELI 556

>TDEL0B00190 Chr2 complement(37032..38510) [1479 bp, 492 aa] {ON}
           Anc_8.850 YMR285C
          Length = 492

 Score =  656 bits (1693), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/434 (69%), Positives = 352/434 (81%), Gaps = 1/434 (0%)

Query: 68  LLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGEAV 127
           +LAKG+DPD+PPELQFIKRP+L LH+DEP+ G +F L+TYNCLAQALIRRKLFPDSG+++
Sbjct: 58  MLAKGMDPDHPPELQFIKRPLLTLHEDEPIEGLSFKLLTYNCLAQALIRRKLFPDSGDSL 117

Query: 128 KWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAI 187
           KWFRRSKVL YEF+HYN+DV+CLQEID+IQYQ FWK E +KLGY++QF++   KNHGV+I
Sbjct: 118 KWFRRSKVLQYEFKHYNADVLCLQEIDYIQYQQFWKDELDKLGYDTQFYKQPCKNHGVSI 177

Query: 188 VWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXXX 247
            WKR +F++TDRMLID+DKE+S  I  RT T+N+GLIL+LKF+D    + P +       
Sbjct: 178 AWKRHLFQLTDRMLIDYDKESSGKIEKRTLTHNSGLILALKFTDAAKQSCP-HIRKSGIL 236

Query: 248 XXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQP 307
               HLFWHPFGTYERTRQCYV+L KMKEFM RVNVLQN NDG+LSHWVPFFCGDFNSQP
Sbjct: 237 VGTSHLFWHPFGTYERTRQCYVVLKKMKEFMKRVNVLQNNNDGNLSHWVPFFCGDFNSQP 296

Query: 308 FDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXXXXNIEKFGKDQPQTP 367
           FD+PYLSMTSKP+EYT RAKTV++CSTSY FSKLRN           NIEKFGKDQPQTP
Sbjct: 297 FDTPYLSMTSKPVEYTGRAKTVVECSTSYTFSKLRNGEEDAEDEEGGNIEKFGKDQPQTP 356

Query: 368 VPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIISNWA 427
           VPETF A  EQ  LVE M  +HN + MRA SLY+VGY  VH EN+GIDN RGEP +SNWA
Sbjct: 357 VPETFDATPEQQKLVEEMQELHNSIDMRAISLYAVGYGEVHPENSGIDNDRGEPEMSNWA 416

Query: 428 NTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHGQPHEGE 487
           NTWRGLLDYI  +  WD  +R+ VDSLE FE ENS++LRG LRMP  SEM  HGQPHEGE
Sbjct: 417 NTWRGLLDYILLITQWDSSDRKKVDSLETFEKENSLKLRGLLRMPPASEMSHHGQPHEGE 476

Query: 488 YASDHLSMICNIEL 501
           YASDHLSM+C IEL
Sbjct: 477 YASDHLSMMCTIEL 490

>YMR285C Chr13 complement(840144..841691) [1548 bp, 515 aa] {ON}
           NGL2Protein involved in 5.8S rRNA processing; Ccr4p-like
           RNase required for correct 3'-end formation of 5.8S rRNA
           at site E; similar to Ngl1p and Ngl3p
          Length = 515

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 306/438 (69%), Positives = 358/438 (81%), Gaps = 2/438 (0%)

Query: 68  LLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGEAV 127
           +LA+G+DPD PPEL FI+RP L LH+ EPVTGF F LMTYNCLAQALIRRKLFPDSG+A+
Sbjct: 78  MLAQGVDPDCPPELHFIRRPFLSLHEAEPVTGFRFKLMTYNCLAQALIRRKLFPDSGDAL 137

Query: 128 KWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAI 187
           KW+RRSKVLL EF++YNSDVICLQEIDHIQ+Q+FWK EF KLGY+ Q++R A+KNHGVAI
Sbjct: 138 KWYRRSKVLLNEFKYYNSDVICLQEIDHIQFQSFWKDEFSKLGYDGQYYRNATKNHGVAI 197

Query: 188 VWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTL-PKNXXXXXX 246
           +W+RE+F   D+MLID+DKE+S  I  RT TNN GL+L+LKFS+K+LS L  K+      
Sbjct: 198 MWRRELFHQVDKMLIDYDKESSESISTRTTTNNVGLVLALKFSEKVLSNLGKKSSKKCGI 257

Query: 247 XXXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQ 306
                HLFWHPFGTYERTRQCY++L KMKEFMHRVNVLQN NDGDLSHW PFFCGDFNSQ
Sbjct: 258 LIGTTHLFWHPFGTYERTRQCYIVLKKMKEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQ 317

Query: 307 PFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXXXXNIEKFGKDQPQT 366
           PFD+PYLSMTSKP+ Y  RAKTVI CSTSYKFSK+R+           NIEK+GKDQP++
Sbjct: 318 PFDTPYLSMTSKPVHYRNRAKTVIGCSTSYKFSKVRDGEEGADDEEGGNIEKYGKDQPES 377

Query: 367 PVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIISNW 426
           PVPE F ANEEQ+ LV++MA +HN L MRA SLYSVGYK+VH ENAG+DN RGEP ISNW
Sbjct: 378 PVPEKFHANEEQSELVDKMAQLHNSLDMRAISLYSVGYKNVHPENAGLDNDRGEPEISNW 437

Query: 427 ANTWRGLLDYIFHVNTWD-FDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHGQPHE 485
           ANTWRGLLDY+F+V  WD   N Q V++L  FE EN ++ RGFLRMP  +EM KHGQPH 
Sbjct: 438 ANTWRGLLDYLFYVKKWDPQSNCQEVETLGDFEKENKVKCRGFLRMPPGNEMTKHGQPHV 497

Query: 486 GEYASDHLSMICNIELLL 503
           GEYASDHLSM+C++EL L
Sbjct: 498 GEYASDHLSMVCDLELQL 515

>Smik_13.501 Chr13 complement(822672..824219) [1548 bp, 515 aa] {ON}
           YMR285C (REAL)
          Length = 515

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 302/438 (68%), Positives = 356/438 (81%), Gaps = 2/438 (0%)

Query: 68  LLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGEAV 127
           +LA+G+DPD PPEL FIKRP L LH+ EPVTGF F LMTYNCLAQALIRRKLFPDSG+A+
Sbjct: 78  MLAQGVDPDCPPELHFIKRPFLVLHEKEPVTGFRFKLMTYNCLAQALIRRKLFPDSGDAL 137

Query: 128 KWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAI 187
           KW+RRS+VLL EF++Y +DVICLQEIDHIQ+Q+FWK EF KLGY+ Q++R ++KNHGVAI
Sbjct: 138 KWYRRSRVLLNEFKYYKADVICLQEIDHIQFQSFWKDEFNKLGYDGQYYRNSTKNHGVAI 197

Query: 188 VWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXX-XX 246
           +W+REMF+  D+MLID+DKETS +I  RT TNN GL+L+LKFS+K+LS L K+       
Sbjct: 198 MWRREMFQQVDKMLIDYDKETSENISTRTTTNNVGLVLALKFSEKVLSNLSKSSSKKCGI 257

Query: 247 XXXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQ 306
                HLFWHPFGTYERTRQCYV+L KMKEFMHRVNVLQN NDGDLSHW PFFCGDFNSQ
Sbjct: 258 LIGTTHLFWHPFGTYERTRQCYVVLKKMKEFMHRVNVLQNENDGDLSHWFPFFCGDFNSQ 317

Query: 307 PFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXXXXNIEKFGKDQPQT 366
           PFD+PYLSMTSKP+ Y  RAKTVI+CSTS+KFSK R+           NIEK+GKDQP++
Sbjct: 318 PFDTPYLSMTSKPVHYKNRAKTVIECSTSFKFSKARDGDESADDEEGGNIEKYGKDQPES 377

Query: 367 PVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIISNW 426
           PVPE + ANEEQ  LV++MA +HN L MRA SLYSVGY++VH ENAG+DN RGEP ISNW
Sbjct: 378 PVPENYHANEEQIELVDKMAQLHNSLDMRAISLYSVGYRNVHPENAGLDNDRGEPEISNW 437

Query: 427 ANTWRGLLDYIFHVNTWDF-DNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHGQPHE 485
           ANTWRGLLDY+F+V  WD   N Q V++L  FE  N ++ RGFLRMP   EM KHGQPH 
Sbjct: 438 ANTWRGLLDYLFYVKKWDLRSNCQEVENLGDFEKVNEMKCRGFLRMPPGKEMTKHGQPHV 497

Query: 486 GEYASDHLSMICNIELLL 503
           GEYASDHLSM+C++EL L
Sbjct: 498 GEYASDHLSMVCDLELEL 515

>TPHA0I00320 Chr9 complement(61470..63059) [1590 bp, 529 aa] {ON}
           Anc_8.850 YMR285C
          Length = 529

 Score =  642 bits (1657), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 298/437 (68%), Positives = 353/437 (80%), Gaps = 3/437 (0%)

Query: 68  LLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGEAV 127
           +LA GLDPD PPELQFI+RP+L LH DEP   F FTLMTYNCLAQALIRRKLFPDSGEAV
Sbjct: 91  MLANGLDPDCPPELQFIRRPLLTLHDDEPEKSFTFTLMTYNCLAQALIRRKLFPDSGEAV 150

Query: 128 KWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAI 187
           KW+RRS+VLL EF++YN D+ICLQEIDHIQ+Q+FW+ EF+K+GY SQFHRI SKNHGVAI
Sbjct: 151 KWYRRSRVLLNEFKYYNPDLICLQEIDHIQFQSFWQEEFKKMGYASQFHRIHSKNHGVAI 210

Query: 188 VWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPK--NXXXXX 245
           VWK  +F++TDRMLIDFDKE S DI PRT+TNNTGLILSLK+SD +L+  P+  N     
Sbjct: 211 VWKNNLFRLTDRMLIDFDKELSGDILPRTKTNNTGLILSLKYSDSVLAKYPELGNNNKSG 270

Query: 246 XXXXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNS 305
                 HLFWHPFGTYERTRQC+VLLNK+KEF  RVNVLQN NDG++ HW  FFCGDFNS
Sbjct: 271 IIIGTTHLFWHPFGTYERTRQCFVLLNKVKEFKKRVNVLQNNNDGNMDHWTAFFCGDFNS 330

Query: 306 QPFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRN-XXXXXXXXXXXNIEKFGKDQP 364
           QPFD+PYLS+TSKP+EY ERAK VI+CSTSY +SKLRN            NIEKFGKDQP
Sbjct: 331 QPFDTPYLSITSKPVEYKERAKIVIECSTSYTYSKLRNGDDDEAEDEEGGNIEKFGKDQP 390

Query: 365 QTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIIS 424
           QTPVP+++    EQ  LV +M  +HN L M+A SLY+VGYK VH EN+G+DN +GEP IS
Sbjct: 391 QTPVPDSYTPTPEQADLVSKMESLHNSLNMKATSLYAVGYKKVHPENSGLDNKKGEPEIS 450

Query: 425 NWANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHGQPH 484
           NWA++WRGLLDYIF+V+ WDF + + V+  EKFE +N ++LRG+LRMP  +EM K+GQPH
Sbjct: 451 NWAHSWRGLLDYIFYVDHWDFSDCKEVEDFEKFEKKNHMKLRGYLRMPPATEMSKYGQPH 510

Query: 485 EGEYASDHLSMICNIEL 501
           +GEY SDHLSM+C IEL
Sbjct: 511 QGEYPSDHLSMMCKIEL 527

>ZYRO0C14872g Chr3 complement(1155977..1157467) [1491 bp, 496 aa]
           {ON} similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 496

 Score =  635 bits (1638), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/436 (68%), Positives = 348/436 (79%), Gaps = 3/436 (0%)

Query: 68  LLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGEAV 127
           ++A+G+DPD+PPELQFIKRP+L LH+ E V GF F LMTYNCLAQALIRRKLFP SG+A+
Sbjct: 62  MMAQGIDPDFPPELQFIKRPILPLHKGENVEGFKFKLMTYNCLAQALIRRKLFPTSGDAL 121

Query: 128 KWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAI 187
           KW+RRSKVLL EF++YN+DVICLQEID+IQYQ+FWK E  KLGY+SQFHR ASKNHGVAI
Sbjct: 122 KWYRRSKVLLNEFKYYNADVICLQEIDYIQYQSFWKDELAKLGYDSQFHRQASKNHGVAI 181

Query: 188 VWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXXX 247
           VWKRE F MTD+MLIDFD+E+S DIPPRT TNN GLILSLKFSDK+      N       
Sbjct: 182 VWKREYFVMTDKMLIDFDRESSGDIPPRTTTNNAGLILSLKFSDKVAQE--HNLKKTGII 239

Query: 248 XXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQP 307
               HLFWHPFGT+ERTRQCYV+LNK+KEF HRVNVLQNGNDGD SHW PFFCGDFNSQP
Sbjct: 240 VGTTHLFWHPFGTFERTRQCYVVLNKVKEFSHRVNVLQNGNDGDHSHWYPFFCGDFNSQP 299

Query: 308 FDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLR-NXXXXXXXXXXXNIEKFGKDQPQT 366
           FDSPYLSMT KPIEY++RAKTVI+CSTSY FSK+R             NIEKFG DQP  
Sbjct: 300 FDSPYLSMTRKPIEYSKRAKTVIECSTSYTFSKMRDGEEDDAEEEEGGNIEKFGTDQPDH 359

Query: 367 PVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIISNW 426
           PVP+ + A + +  LVE+M  +HN L MRA SLYSV Y+ VH ENAG+DN RGEP ISNW
Sbjct: 360 PVPQHYEAKDHERELVEQMQSLHNSLDMRAVSLYSVAYRKVHPENAGLDNERGEPEISNW 419

Query: 427 ANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHGQPHEG 486
           A+TWRGLLDY+F +  WDF + + +DSLE FE ENS+++RG LR+P   EM +HGQPH G
Sbjct: 420 AHTWRGLLDYLFFIRHWDFSDCKEIDSLESFERENSLKIRGLLRVPPGKEMTEHGQPHTG 479

Query: 487 EYASDHLSMICNIELL 502
           EY SDHL M+C +EL+
Sbjct: 480 EYPSDHLCMLCELELV 495

>TBLA0B02900 Chr2 complement(668940..670502) [1563 bp, 520 aa] {ON}
           Anc_8.850 YMR285C
          Length = 520

 Score =  635 bits (1637), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 291/436 (66%), Positives = 345/436 (79%), Gaps = 1/436 (0%)

Query: 68  LLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGEAV 127
           LLA+G+DPD P ELQFIKRP+L +H++EPV GF F+LMTYNCLAQALIRRKLFP+ G+A+
Sbjct: 86  LLAQGIDPDCPKELQFIKRPILQMHENEPVKGFKFSLMTYNCLAQALIRRKLFPEGGDAL 145

Query: 128 KWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAI 187
           KW RRSKVLL EF+HYN D+ICLQEIDH+QYQ+FWK EF KLGYE QF++  SKNHGV++
Sbjct: 146 KWHRRSKVLLNEFKHYNPDIICLQEIDHVQYQSFWKEEFSKLGYECQFYKKPSKNHGVSV 205

Query: 188 VWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXXX 247
           VWK+E+F+MTDRML+D+DKE S DI PRT TNN  L+LSLKFS K+    PKN       
Sbjct: 206 VWKKELFEMTDRMLVDYDKELSGDIEPRTTTNNIALLLSLKFSKKVTERFPKNINKTGIL 265

Query: 248 XXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQP 307
               HLFWHPFGTYERTRQCY++LNKMKEF+ RVN+LQN  D D SHW PFFCGDFNSQP
Sbjct: 266 IGTTHLFWHPFGTYERTRQCYIILNKMKEFIDRVNILQNNGDKDFSHWYPFFCGDFNSQP 325

Query: 308 FDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXXXXNIEKFGKDQPQTP 367
           FDSPYLSMTSKPI+Y+ R+KTVI+CSTS+KFSK R+           NIEKFGKDQPQ P
Sbjct: 326 FDSPYLSMTSKPIKYSGRSKTVIECSTSFKFSKKRD-GEEGDDEEGGNIEKFGKDQPQHP 384

Query: 368 VPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIISNWA 427
           VP+ + AN+EQ  LV +M  +HN L MRA SLYS GY  VH EN+GIDN R EP ISNWA
Sbjct: 385 VPDDYQANDEQKLLVTKMQELHNSLDMRAISLYSAGYSKVHPENSGIDNERNEPEISNWA 444

Query: 428 NTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHGQPHEGE 487
           + WRGLLDY+F++ +WDF   + +DSLE FE EN I++RG+LRMP   E+P HGQP EGE
Sbjct: 445 HIWRGLLDYLFYIKSWDFTPNKEIDSLEDFERENDIKIRGYLRMPPAKELPSHGQPFEGE 504

Query: 488 YASDHLSMICNIELLL 503
           Y SDHL M+C +EL L
Sbjct: 505 YPSDHLCMLCEVELCL 520

>CAGL0I02684g Chr9 complement(239316..240797) [1482 bp, 493 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285c
          Length = 493

 Score =  634 bits (1634), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/435 (67%), Positives = 341/435 (78%), Gaps = 1/435 (0%)

Query: 68  LLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGEAV 127
           +L +G+DPD PPELQFI+R ML LH++EPV G    +M+YNCLAQALIRRKLFPDSGEA+
Sbjct: 58  MLERGVDPDCPPELQFIRRNMLKLHEEEPVEGLKIKIMSYNCLAQALIRRKLFPDSGEAL 117

Query: 128 KWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAI 187
           KW+RRS+VLL EF+HY+ DV+CLQEID+IQYQ+FWK EF+KLGY SQFHR  SKNHGV I
Sbjct: 118 KWYRRSRVLLNEFKHYDPDVLCLQEIDYIQYQSFWKEEFQKLGYSSQFHRKPSKNHGVCI 177

Query: 188 VWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXX- 246
           +WK E F+M+DRMLIDFD E S DI PRT TNN  LIL+LKF+ K+     K        
Sbjct: 178 IWKHEKFEMSDRMLIDFDSEKSGDIEPRTTTNNAALILALKFTQKVKMMGKKLLDDKSGI 237

Query: 247 XXXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQ 306
                HLFWHPFGTYERTRQCYV+LNKMKEFMHRVNVLQN NDGD+SHW PFFCGDFNSQ
Sbjct: 238 LVGTTHLFWHPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDGDMSHWYPFFCGDFNSQ 297

Query: 307 PFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXXXXNIEKFGKDQPQT 366
           PFDSPYLSMT KPI+Y  RAKTVI+CSTS+KFSK R            NIEKFGKDQPQT
Sbjct: 298 PFDSPYLSMTCKPIKYDSRAKTVIECSTSFKFSKKRESGEDAEDEEGGNIEKFGKDQPQT 357

Query: 367 PVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIISNW 426
           PVPE F+AN+EQT LV +M  +HN L MRA SLYSV Y  VH EN+G+DN RGEP ISNW
Sbjct: 358 PVPEKFVANDEQTKLVSQMEELHNSLDMRAVSLYSVAYHKVHPENSGLDNERGEPEISNW 417

Query: 427 ANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHGQPHEG 486
           A+TWRGLLDY+F +  W+FD+R  +D+LE FE  N+I++RG LRMP  SEM  HGQPH G
Sbjct: 418 AHTWRGLLDYMFMIRNWEFDDRTEIDTLEDFENSNNIKIRGLLRMPPGSEMSTHGQPHVG 477

Query: 487 EYASDHLSMICNIEL 501
           EY SDHL ++  +EL
Sbjct: 478 EYPSDHLCLLSEVEL 492

>Skud_13.458 Chr13 complement(813694..815238) [1545 bp, 514 aa] {ON}
           YMR285C (REAL)
          Length = 514

 Score =  634 bits (1635), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 299/438 (68%), Positives = 350/438 (79%), Gaps = 2/438 (0%)

Query: 68  LLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGEAV 127
           +LA G+DPD PPEL FI+RP+L L + EPVTGF F LMTYNCLAQALIRRKLFPDSG+A+
Sbjct: 77  MLAHGVDPDCPPELHFIQRPLLSLGEGEPVTGFRFKLMTYNCLAQALIRRKLFPDSGDAL 136

Query: 128 KWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAI 187
           KWFRRSKVLL EF++YN+DVICLQE+DHIQ+Q+FWK +F K+GY+ Q+HR  +KNHGVAI
Sbjct: 137 KWFRRSKVLLNEFKYYNADVICLQEVDHIQFQSFWKGKFNKMGYDGQYHRNPTKNHGVAI 196

Query: 188 VWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXX-XX 246
           +W+R MF+  D+MLID+DKE S  I  RT TNN GL+L+LKFS ++LS L K        
Sbjct: 197 IWRRSMFQKVDKMLIDYDKEASGSILTRTTTNNVGLVLALKFSKEVLSKLGKKSSKKCGI 256

Query: 247 XXXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQ 306
                HLFWHPFGTYERTRQCYV+L KMKEFMHRVNVLQN NDGDLSHW PFFCGDFNSQ
Sbjct: 257 LIGTTHLFWHPFGTYERTRQCYVVLRKMKEFMHRVNVLQNDNDGDLSHWFPFFCGDFNSQ 316

Query: 307 PFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXXXXNIEKFGKDQPQT 366
           PFD+PYLSMTSKP+ Y  RAKTVI+CSTS+KFSK+R+           NIEKFGKDQP++
Sbjct: 317 PFDTPYLSMTSKPVHYKSRAKTVIECSTSFKFSKVRDGEEGADDEEGGNIEKFGKDQPES 376

Query: 367 PVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIISNW 426
           PVPE F AN+EQ  +V+ M  +HN L MRA SLYSVGYK VH ENAG+DN RGEP ISNW
Sbjct: 377 PVPENFHANDEQIEIVDDMVQLHNSLDMRAISLYSVGYKSVHPENAGLDNDRGEPEISNW 436

Query: 427 ANTWRGLLDYIFHVNTWDF-DNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHGQPHE 485
           ANTWRGLLDY+F++  WD   NRQ V++L  FE +N I+ RGFLRMP  SEM KHGQPH 
Sbjct: 437 ANTWRGLLDYLFYIKKWDLQSNRQEVENLSDFEKKNEIKCRGFLRMPPASEMTKHGQPHV 496

Query: 486 GEYASDHLSMICNIELLL 503
           GEY SDHLSM+C++EL L
Sbjct: 497 GEYPSDHLSMVCDLELQL 514

>SAKL0D01166g Chr4 (86218..87735) [1518 bp, 505 aa] {ON} similar to
           uniprot|Q03264 Saccharomyces cerevisiae YMR285C
          Length = 505

 Score =  631 bits (1627), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 297/434 (68%), Positives = 341/434 (78%), Gaps = 2/434 (0%)

Query: 68  LLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGEAV 127
           +LA GLDP+ PP+LQFIKRP+L LH++EPV GF F +MTYN LAQALIRRKLFP SG AV
Sbjct: 72  MLAHGLDPNVPPDLQFIKRPLLCLHEEEPVKGFKFKIMTYNALAQALIRRKLFPSSGNAV 131

Query: 128 KWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAI 187
           KWF+RSKVLL EF+HY++DV CLQEIDHIQYQAFWK EF+KLGY SQFHRI +KNHGVAI
Sbjct: 132 KWFKRSKVLLNEFKHYDADVHCLQEIDHIQYQAFWKEEFQKLGYASQFHRIGTKNHGVAI 191

Query: 188 VWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXXX 247
           VW+  +F M D ML+D+DKE S DIPPRT T N GLIL+LKF+DK+L+  P         
Sbjct: 192 VWRCSLFTMVDTMLVDYDKEPSGDIPPRTTTKNAGLILALKFTDKVLNQFP-GTKKSGIL 250

Query: 248 XXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQP 307
               HLFWHPFGT+ERTRQCYV+LNKMKE +HRVNVLQN  D D SHW PF CGDFNSQP
Sbjct: 251 IGTTHLFWHPFGTFERTRQCYVVLNKMKELIHRVNVLQNNQDRDYSHWYPFICGDFNSQP 310

Query: 308 FDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXXXXNIEKFGKDQPQTP 367
           FD+PYLSMTSKP+ Y  RAKTVI+CSTS+ FSKLR+           NIEKFGK QP+ P
Sbjct: 311 FDTPYLSMTSKPVTYRGRAKTVIECSTSFTFSKLRD-GEEGEDEEGGNIEKFGKGQPEHP 369

Query: 368 VPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIISNWA 427
           VP+ F A EEQTALV++M  +HN L MRA SLY+VGYKHVH ENAG+DN  GEP ISNWA
Sbjct: 370 VPKEFHATEEQTALVKQMESLHNSLDMRAISLYAVGYKHVHPENAGLDNDSGEPEISNWA 429

Query: 428 NTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHGQPHEGE 487
            TWRGLLDYIF V  W+  +R +VD ++ FE EN I++RG LRMP   EM KHGQPHEGE
Sbjct: 430 ETWRGLLDYIFFVKNWNGTDRSSVDKIDVFERENGIKIRGLLRMPPGEEMTKHGQPHEGE 489

Query: 488 YASDHLSMICNIEL 501
           Y SDHLSM+C IEL
Sbjct: 490 YPSDHLSMMCEIEL 503

>NDAI0K00370 Chr11 complement(78396..80102) [1707 bp, 568 aa] {ON}
           Anc_8.850 YML118W
          Length = 568

 Score =  630 bits (1625), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/427 (68%), Positives = 342/427 (80%), Gaps = 3/427 (0%)

Query: 78  PPELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGEAVKWFRRSKVLL 137
           PPELQFIKRP+L+LH++EPV GF F++MTYNCLAQALIRRKLFPDSG+A+KW+RRSKVLL
Sbjct: 143 PPELQFIKRPILYLHEEEPVQGFKFSMMTYNCLAQALIRRKLFPDSGDALKWYRRSKVLL 202

Query: 138 YEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAIVWKREMFKMT 197
            EF +Y+ D+ICLQE+DHIQYQ+FWK EFEKLGY+SQ+HR   KNHGV+I+W+R +F MT
Sbjct: 203 NEFTYYSPDIICLQEVDHIQYQSFWKTEFEKLGYQSQYHRKGVKNHGVSIIWRRSLFTMT 262

Query: 198 DRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXXXXX--XXHLFW 255
           D+MLI+FDKE+S ++PPRT TNN GLILSLKF+ +  +   KN             HLFW
Sbjct: 263 DKMLIEFDKESSGNVPPRTTTNNVGLILSLKFTPEAKAQF-KNVETTKTGIIIGTTHLFW 321

Query: 256 HPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQPFDSPYLSM 315
           HPFGTYERTRQCYV+LNKMKEFMHRVNVLQN ND DLSHW PFFCGDFNSQPFDSPYLSM
Sbjct: 322 HPFGTYERTRQCYVVLNKMKEFMHRVNVLQNNNDRDLSHWYPFFCGDFNSQPFDSPYLSM 381

Query: 316 TSKPIEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXXXXNIEKFGKDQPQTPVPETFIAN 375
             KP+EY+ RAKTVI+CSTSYKFSK R+           NIEKFG DQPQTPVPE FIAN
Sbjct: 382 VRKPVEYSGRAKTVIECSTSYKFSKKRDGEEDVDDEEGGNIEKFGIDQPQTPVPEEFIAN 441

Query: 376 EEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIISNWANTWRGLLD 435
            EQT LV+ M  +HN L MRA SLY VGYK+VH ENA IDN  GEP ISNWA+TW GLLD
Sbjct: 442 GEQTILVKDMEKLHNSLNMRAISLYGVGYKNVHPENASIDNECGEPEISNWAHTWNGLLD 501

Query: 436 YIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHGQPHEGEYASDHLSM 495
           Y+  V  W F +    ++L++FE  NS+R+RGFLRMP  +EM KHGQPH GEY SDHLSM
Sbjct: 502 YLLFVKEWTFSDCTKTETLKQFEESNSMRIRGFLRMPPANEMTKHGQPHVGEYPSDHLSM 561

Query: 496 ICNIELL 502
           +C+IELL
Sbjct: 562 LCSIELL 568

>KAFR0L01960 Chr12 complement(370756..372291) [1536 bp, 511 aa] {ON}
           Anc_8.850 YMR285C
          Length = 511

 Score =  622 bits (1603), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 292/438 (66%), Positives = 341/438 (77%), Gaps = 3/438 (0%)

Query: 68  LLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGEAV 127
           +LA+GLDPD PPELQFI+RP+L L + E   GF F +MTYNCLAQALIRRKLFPDSGEAV
Sbjct: 75  MLAQGLDPDLPPELQFIRRPLLALSKAESTAGFEFKIMTYNCLAQALIRRKLFPDSGEAV 134

Query: 128 KWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAI 187
           KWFRRSKVLL EF++Y+SDVICLQE+D IQ+Q FWK EF+KLGY+SQFH   SKNHG++I
Sbjct: 135 KWFRRSKVLLNEFKYYDSDVICLQEVDRIQFQTFWKEEFDKLGYDSQFHAKPSKNHGISI 194

Query: 188 VWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXXX 247
           +WKR +F MTD+MLID+DKE S +IPPRT TNN GL+L+LKFS K+L   P N       
Sbjct: 195 LWKRSLFTMTDKMLIDYDKEISGNIPPRTTTNNVGLVLALKFSPKVLERFP-NTRKSGII 253

Query: 248 XXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQP 307
               HLFWHPFGTYERTRQCY++LNK KEFMHRVNVLQN ND    HW  FF GDFNSQP
Sbjct: 254 VGTTHLFWHPFGTYERTRQCYIVLNKTKEFMHRVNVLQNNNDEIKDHWYTFFGGDFNSQP 313

Query: 308 FDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXXXXNIEKFGKDQPQTP 367
           FD+PYLSMTSKP++Y+ RAKTVI+CSTSY FSK R+           NIEKFGKDQP TP
Sbjct: 314 FDTPYLSMTSKPVKYSNRAKTVIECSTSYTFSKSRDGEEDAEDEEGGNIEKFGKDQPATP 373

Query: 368 VPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIISNWA 427
           VP  F A+ EQ +LV  M  +HN L MRA SLYSVGY  VH ENAG+DNTRGEP ISNWA
Sbjct: 374 VPSFFDASSEQQSLVANMEKLHNSLDMRAISLYSVGYGTVHIENAGLDNTRGEPEISNWA 433

Query: 428 NTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPK--HGQPHE 485
           + W GLLDY+F + +WDF ++  VDSL+KFE EN ++++ FL+MP  +EM K  HGQPH 
Sbjct: 434 HAWNGLLDYLFVIKSWDFSDKIQVDSLKKFEDENELKVKAFLKMPTKAEMGKFGHGQPHV 493

Query: 486 GEYASDHLSMICNIELLL 503
           GEY SDHLSMIC +EL L
Sbjct: 494 GEYPSDHLSMICKLELKL 511

>KLTH0C03608g Chr3 complement(313729..315216) [1488 bp, 495 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 495

 Score =  608 bits (1568), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 282/434 (64%), Positives = 331/434 (76%), Gaps = 2/434 (0%)

Query: 68  LLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGEAV 127
           ++A+GLDPD+PP+LQFI RPML L+  E   GF F LMTYNCLAQALIRRKLFP SG A+
Sbjct: 62  MIARGLDPDFPPDLQFIHRPMLSLNPSENANGFVFKLMTYNCLAQALIRRKLFPTSGNAL 121

Query: 128 KWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAI 187
           KWF+RS+VLL EF HYNSDV+CLQE+D+IQYQ+FWK EFEKLGYESQFHR  +KNHG+AI
Sbjct: 122 KWFKRSRVLLNEFMHYNSDVLCLQEVDYIQYQSFWKEEFEKLGYESQFHRHGTKNHGIAI 181

Query: 188 VWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXXX 247
           VWKR+MF M D+MLID+DKE S  + PRT T N GL ++L F+ K+L+  P         
Sbjct: 182 VWKRDMFTMVDKMLIDYDKEPSGALEPRTTTKNVGLAIALGFTKKVLAKYP-GSSKRGII 240

Query: 248 XXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQP 307
               HLFWHPFGT+ERTRQCYV+LNKMKEFMHR+NVLQ+      + W PFFCGDFNSQP
Sbjct: 241 VGTTHLFWHPFGTFERTRQCYVMLNKMKEFMHRINVLQDKGATQENLWYPFFCGDFNSQP 300

Query: 308 FDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXXXXNIEKFGKDQPQTP 367
           FD+PYLS++SKP+ Y  RAKTVI+CSTSY FSK R+           NIEKFG  QP+ P
Sbjct: 301 FDTPYLSVSSKPVTYKGRAKTVIECSTSYTFSKARD-GEECDDEEGGNIEKFGDGQPEHP 359

Query: 368 VPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIISNWA 427
           VPE F A EEQ  LVE MA +HN L MR  S+YSVGYKHVHAENAG+DN   EP ISNWA
Sbjct: 360 VPEKFSATEEQKGLVESMASLHNSLDMRGISIYSVGYKHVHAENAGLDNNFNEPEISNWA 419

Query: 428 NTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHGQPHEGE 487
            TWRGLLDYIF +  WDF ++ + + LE F+ EN I++RG LRMP   EMP HGQPHEGE
Sbjct: 420 ETWRGLLDYIFFIKKWDFSDKASPEELEAFQDENGIKIRGLLRMPPAKEMPNHGQPHEGE 479

Query: 488 YASDHLSMICNIEL 501
           Y SDHLSM+C +EL
Sbjct: 480 YGSDHLSMMCELEL 493

>Kwal_27.10204 s27 complement(239835..241319) [1485 bp, 494 aa] {ON}
           YMR285C (NGL2) - DNase/RNase (putative); CCR4 C-terminal
           homolog; displays homology to drosophila Angelgene;
           homolog to ngl1 and ngl3  [contig 39] FULL
          Length = 494

 Score =  577 bits (1487), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/436 (62%), Positives = 327/436 (75%), Gaps = 3/436 (0%)

Query: 68  LLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGEAV 127
           +LA+GLDP++PP+LQFI RPML L  +    GF F +MTYNCLAQALIRRKLFP SG A+
Sbjct: 62  MLARGLDPEFPPDLQFISRPMLPLDSNYSPEGFVFKIMTYNCLAQALIRRKLFPTSGNAL 121

Query: 128 KWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAI 187
           KWF+RS+VLL EF HY +DV CLQEID+IQYQ+FWK EF KLGY+SQFHR  +KNHG+AI
Sbjct: 122 KWFKRSRVLLNEFMHYKADVHCLQEIDYIQYQSFWKEEFGKLGYDSQFHRHGTKNHGIAI 181

Query: 188 VWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXXX 247
           VWKR++F M D+ML+D+DKE S  + PRT T N GL+L+L FS K+L   P         
Sbjct: 182 VWKRDLFTMVDKMLVDYDKEPSGSLKPRTTTKNVGLVLALAFSKKVLDKYP-GTSKRGIL 240

Query: 248 XXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQP 307
               HLFWHPFGT+ERTRQCYVLLNKMK+F+HRVNVLQ+G+  +   W PFFCGDFN+QP
Sbjct: 241 VGTTHLFWHPFGTFERTRQCYVLLNKMKDFIHRVNVLQDGSSPE-KKWYPFFCGDFNAQP 299

Query: 308 FDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXXXXNIEKFGKDQPQTP 367
           FD+PYLSM+SKP+ Y +RAKTVI+CSTSY FSK R+           NIEKFG  QP+ P
Sbjct: 300 FDTPYLSMSSKPVVYKDRAKTVIECSTSYTFSKARD-GEECDDEEGGNIEKFGDGQPEHP 358

Query: 368 VPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIISNWA 427
           VP+T+ A  EQ  LV+ MA +HN L MRA S+YSV YKHVH ENAG DNT  EP ISNWA
Sbjct: 359 VPDTYEAAPEQKELVQTMAELHNSLDMRAISVYSVAYKHVHPENAGRDNTHNEPEISNWA 418

Query: 428 NTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHGQPHEGE 487
            TWRGLLDYIF +  W+F + +  + L+ FE EN +++   LRMP   EMP HGQPHEGE
Sbjct: 419 ETWRGLLDYIFFIKQWNFTDNKRPEELQTFEKENDVKILSLLRMPPSEEMPNHGQPHEGE 478

Query: 488 YASDHLSMICNIELLL 503
           Y SDHLS++C IEL L
Sbjct: 479 YGSDHLSLMCEIELNL 494

>KNAG0K00650 Chr11 complement(116371..117819) [1449 bp, 482 aa] {ON}
           Anc_8.850 YMR285C
          Length = 482

 Score =  570 bits (1469), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 269/441 (60%), Positives = 331/441 (75%), Gaps = 9/441 (2%)

Query: 71  KGLDPDYPPELQFIKRPMLHLHQDEPVTG----FNFTLMTYNCLAQALIRRKLFPDSGEA 126
           +G   D P EL+FI+RPML +H D  +         TLMTYNCLAQALIRRKLFPDSG A
Sbjct: 43  QGAKSDIPAELRFIERPMLSVHPDGAIGAEGNRLPVTLMTYNCLAQALIRRKLFPDSGPA 102

Query: 127 VKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVA 186
           +KW+RRS+VLL +F+HY  DV+CLQE+D +Q+ +FW+ EFEKLGY +QFH+  +KNHGVA
Sbjct: 103 LKWYRRSQVLLNKFKHYEPDVLCLQEVDAVQWHSFWRGEFEKLGYAAQFHKKQTKNHGVA 162

Query: 187 IVWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXX 246
           +VW+ ++F M D+MLIDFDKE S D+PPRT TNN GL+++LKF+++ L T  ++      
Sbjct: 163 VVWRSKLFTMADKMLIDFDKEQSGDVPPRTTTNNAGLVIALKFTEQAL-TGHRDTPRSGI 221

Query: 247 XXXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQ 306
                HLFWHPFGT+ERTRQCYV+LNKMKEFMHRVNVLQN NDG+  HW PFFCGDFNSQ
Sbjct: 222 LVGTTHLFWHPFGTFERTRQCYVVLNKMKEFMHRVNVLQNENDGNNQHWFPFFCGDFNSQ 281

Query: 307 PFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLR--NXXXXXXXXXXXNIEKFGKDQP 364
           P+D+PYLSMTSKP+ Y+ RA+TVI+CSTSY FSK R              NIE FGKDQP
Sbjct: 282 PYDAPYLSMTSKPVSYSGRARTVIECSTSYTFSKQRDGEDAAADEEEEGGNIEIFGKDQP 341

Query: 365 QTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIIS 424
             PVP TF  N EQ ALV +M  +HN L MRA SLYSVGY++VH ENAG DN RGEP IS
Sbjct: 342 HHPVPATFEPNAEQCALVHQMETLHNSLDMRAVSLYSVGYRNVHPENAGADNARGEPEIS 401

Query: 425 NWANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPK--HGQ 482
           NWA+TW GLLDY+F+V  WDF +R  VD+LE+FE ++ + ++  LRMP   EM +  HGQ
Sbjct: 402 NWAHTWNGLLDYLFYVGHWDFKDRTGVDTLEEFEQDSGVTVKRLLRMPSKQEMQQFGHGQ 461

Query: 483 PHEGEYASDHLSMICNIELLL 503
           PH GEY SDHL+M+C++EL L
Sbjct: 462 PHTGEYPSDHLAMVCDLELAL 482

>KLLA0C06248g Chr3 complement(552493..554043) [1551 bp, 516 aa] {ON}
           similar to uniprot|Q03264 Saccharomyces cerevisiae
           YMR285C
          Length = 516

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 257/440 (58%), Positives = 320/440 (72%), Gaps = 6/440 (1%)

Query: 68  LLAKGLDPDYPPELQFIKRPMLHLHQDEPVTGFN----FTLMTYNCLAQALIRRKLFPDS 123
           L+A+G+DP  P +L+FIKRPML + +D            ++MTYNCLAQALIRR LFP S
Sbjct: 79  LIAQGIDPKLPADLRFIKRPMLAVPRDSSGQSTREVCPISIMTYNCLAQALIRRTLFPTS 138

Query: 124 GEAVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNH 183
           G AVKWF+RS+VLL EF++YN DV+CLQEID +QY++FWK+EF KLGY  QFH   +KNH
Sbjct: 139 GNAVKWFKRSQVLLNEFKYYNVDVLCLQEIDTVQYKSFWKMEFTKLGYMCQFHFNPTKNH 198

Query: 184 GVAIVWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXX 243
           GV I WK ++F MTD+MLID+DKET+  I PRT T N G++LSLKF  K+L   P +   
Sbjct: 199 GVLIAWKEDLFDMTDKMLIDYDKETTGAIEPRTTTKNVGMLLSLKFKKKVLEKYP-DTKV 257

Query: 244 XXXXXXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDF 303
                   HLFWHPFGTYERTRQCY++L K+KEF +R+NVLQN  DGD SHW  FFCGDF
Sbjct: 258 SGIIIGTTHLFWHPFGTYERTRQCYIVLKKVKEFQNRINVLQNEKDGDNSHWPAFFCGDF 317

Query: 304 NSQPFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXXXXNIEKFGKDQ 363
           NSQPFD+PYLS+TSKP+EYT RAKTVI+CSTS+ FSKLR+           NIEKFGK Q
Sbjct: 318 NSQPFDAPYLSITSKPVEYTGRAKTVIECSTSFTFSKLRD-GDEGEGEEGGNIEKFGKGQ 376

Query: 364 PQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPII 423
           P+TPVPE+F  NEEQ  L E M  +HN++ MRA SLYS+ Y  VH EN+G+DN R EP I
Sbjct: 377 PETPVPESFSGNEEQKQLCENMKTLHNDIDMRAISLYSIAYSKVHPENSGLDNKRNEPEI 436

Query: 424 SNWANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHGQP 483
           SNWA+ WRGLLDY+++V +WD  +   +D L  FE    +++   LR+P   EM +HGQP
Sbjct: 437 SNWAHAWRGLLDYLYYVTSWDGCDCTKIDELSTFEQNYGVQVLELLRIPPAKEMTEHGQP 496

Query: 484 HEGEYASDHLSMICNIELLL 503
           HEGEY SDHL MI  + +++
Sbjct: 497 HEGEYPSDHLCMIVKLGIIM 516

>ABL118W Chr2 (177531..179045) [1515 bp, 504 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR285C (NGL2) and
           YML118W (NGL3)
          Length = 504

 Score =  527 bits (1357), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 248/424 (58%), Positives = 305/424 (71%), Gaps = 3/424 (0%)

Query: 80  ELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGEAVKWFRRSKVLLYE 139
           ++ FIKRP+L  + DE   GF F +MTYNCLAQALIRRKLFP SG A+KWF+RSKVLL E
Sbjct: 84  DVGFIKRPLLVCNGDE-AKGFVFRMMTYNCLAQALIRRKLFPTSGNALKWFKRSKVLLSE 142

Query: 140 FQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAIVWKREMFKMTDR 199
            Q+YN DVICLQEIDH QY++FW    +  GY S+FHR   KNHG+AIVW+R +F   D 
Sbjct: 143 LQYYNPDVICLQEIDHTQYKSFWMDALQHAGYCSKFHRSFGKNHGIAIVWRRSLFNKVDE 202

Query: 200 MLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXXXXXXXHLFWHPFG 259
            LIDFD+E S +I  RT T N GLI++L+++D+I    P             HLFWHPFG
Sbjct: 203 TLIDFDEEQSGEIERRTTTKNVGLIVALEYTDEIKRRYP-GSAQSGIVVGTSHLFWHPFG 261

Query: 260 TYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQPFDSPYLSMTSKP 319
           TYER RQCY++L++MK F+ R+ +L+ G+ G  S W PFFCGDFNSQPFD+PYLSM SKP
Sbjct: 262 TYERARQCYIILSRMKVFLKRLRLLERGSCGAASQWHPFFCGDFNSQPFDAPYLSMCSKP 321

Query: 320 IEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXXXXNIEKFGKDQPQTPVPETFIANEEQT 379
           I Y  RA+TVI+CSTSYKFS LR+           NIEKFG  QP+TPVP++F    EQ 
Sbjct: 322 IIYEGRARTVIECSTSYKFSSLRDGCAADEEEGG-NIEKFGAGQPETPVPDSFDGTPEQR 380

Query: 380 ALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIISNWANTWRGLLDYIFH 439
           ALV+ M  +HN L MRA SLYS+ Y++VH ENAGIDN RGEP ISNWA+ WRGLLDYI +
Sbjct: 381 ALVDAMQSLHNALDMRAISLYSLAYRYVHPENAGIDNNRGEPEISNWAHAWRGLLDYIMY 440

Query: 440 VNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHGQPHEGEYASDHLSMICNI 499
           V  WDF +   VD + +F+   S+ +R  LR+P  SEMP HGQPHEGEY SDHLS++C +
Sbjct: 441 VMPWDFSDNTEVDDIGEFQKNTSVIVRSLLRVPPASEMPSHGQPHEGEYPSDHLSLMCEL 500

Query: 500 ELLL 503
           ELL+
Sbjct: 501 ELLM 504

>Ecym_4619 Chr4 (1212417..1213880) [1464 bp, 487 aa] {ON} similar to
           Ashbya gossypii ABL118W
          Length = 487

 Score =  509 bits (1310), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 242/422 (57%), Positives = 302/422 (71%), Gaps = 6/422 (1%)

Query: 81  LQFIKRPMLHLHQDEPV-TGFNFTLMTYNCLAQALIRRKLFPDSGEAVKWFRRSKVLLYE 139
           L+FI RPML L   + V  GF+F+LMTYNCLAQ+LIRR LFP SG A+KW +RS VLL E
Sbjct: 69  LEFIARPMLPLKVTQTVHKGFSFSLMTYNCLAQSLIRRSLFPTSGRALKWTKRSMVLLKE 128

Query: 140 FQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAIVWKREMFKMTDR 199
           F+HYN+DV+CLQEID+ QY +FW      LGY S+FHR+ +K+HGVAI WK+++F   D+
Sbjct: 129 FKHYNADVLCLQEIDYTQYYSFWMNRLSNLGYGSRFHRMDNKSHGVAIFWKKDLFIWMDQ 188

Query: 200 MLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXXXXXXXHLFWHPFG 259
           MLI+FD E S +I PR  TNN G+IL+L FSDK+  + P             HLFWHPFG
Sbjct: 189 MLINFDNEDSGEIEPRKTTNNVGMILALGFSDKVKQSFP-GTVKSGIIVGTSHLFWHPFG 247

Query: 260 TYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQPFDSPYLSMTSKP 319
           TYERTRQCYV+LNKMKEF+HRV++ QN +  DL+ W PFFCGDFNSQPFD+PYLS+TSKP
Sbjct: 248 TYERTRQCYVILNKMKEFIHRVHLSQNEHHTDLTKWYPFFCGDFNSQPFDAPYLSITSKP 307

Query: 320 IEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXXXXNIEKFGKDQPQTPVPETFIANEEQT 379
           + Y+ RAKTVI+CS +YKF  L             +    G+D+P  PVPE+F    E +
Sbjct: 308 VLYSGRAKTVIECSAAYKFPDL----GAGARGANEDGGTVGEDRPVDPVPESFQPTAEVS 363

Query: 380 ALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIISNWANTWRGLLDYIFH 439
           +LV++M  +HN L MRA SLY+V YKHVH +NAG+DN RGEP ISNWA TWRGLLDYI +
Sbjct: 364 SLVQKMEKLHNSLDMRAISLYAVAYKHVHPDNAGLDNERGEPEISNWAYTWRGLLDYIMY 423

Query: 440 VNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHGQPHEGEYASDHLSMICNI 499
           +  W   N   VDSLE FE  + I ++  LRMP   EM  HGQPH+GEY SDHL+M+C +
Sbjct: 424 ITPWQASNNVEVDSLESFEKLSHITVQEMLRMPPAKEMSSHGQPHDGEYPSDHLAMMCKL 483

Query: 500 EL 501
           E+
Sbjct: 484 EV 485

>NDAI0E00260 Chr5 (30097..31593) [1497 bp, 498 aa] {ON} Anc_8.850
           YML118W
          Length = 498

 Score =  436 bits (1122), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 214/449 (47%), Positives = 284/449 (63%), Gaps = 30/449 (6%)

Query: 72  GLDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGEAVKWFR 131
           G +PD P ELQFIKRP+L LH D+PV G    +MTYNCLAQ+LI+R LFP SG+A+KW R
Sbjct: 61  GFEPDIPSELQFIKRPLLTLHDDDPVKGTMLKIMTYNCLAQSLIQRDLFPGSGQALKWVR 120

Query: 132 RSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAIVWKR 191
           RSKVLL E ++Y+SD++ LQEID +Q++ +WK+   KLGY+ +F++   K HGV I WKR
Sbjct: 121 RSKVLLNELKYYDSDLLSLQEIDFVQFKQYWKIVLAKLGYDCEFYKKNGKIHGVLIAWKR 180

Query: 192 EMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXXXXXXX 251
            +F     + IDFD+  S  I PRTRT N GL+++L+F +K  S + K            
Sbjct: 181 NLFAKVKSLPIDFDETLSGTIKPRTRTKNVGLVIALEFLNKDKSAIKKK----GVIIGTT 236

Query: 252 HLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQPFDSP 311
           HLFWH FGT+ERTRQCYV++++M +FM ++        G +  W PFF GDFNSQP D+P
Sbjct: 237 HLFWHLFGTFERTRQCYVMMDQMDKFMKKL--------GGIEKWYPFFTGDFNSQPKDAP 288

Query: 312 YLSMTSKPIEYTERAKTVIQCSTSYKFSKLR-----------------NXXXXXXXXXXX 354
           Y+S+TSKP+ +    K VI+CS +YK+SK R                 +           
Sbjct: 289 YVSITSKPVSFQNETKIVIECSAAYKYSKKRNGEEEEKNEGKEKQHEIDSSDSSDAETDE 348

Query: 355 NIEKFGKDQPQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGI 414
             E+   +QP    P  F    EQ  LV ++A +HN L +RA SLYSVGY+ V  ENA I
Sbjct: 349 EKEEIIPNQPSNARPLHFTPTREQAELVSQLAALHNSLNLRAISLYSVGYRKVDPENAYI 408

Query: 415 DNTRGEPIISNWANTWRGLLDYIFHVNTWDFD-NRQAVDSLEKFEIENSIRLRGFLRMPL 473
           +N RGEP +S WA  W GLLDYIF +  WD   N + VDSL+ FE EN+++LRG L+MP 
Sbjct: 409 NNDRGEPELSEWARMWSGLLDYIFFLQHWDGKTNHEKVDSLKTFERENNVKLRGLLKMPQ 468

Query: 474 DSEMPKHGQPHEGEYASDHLSMICNIELL 502
             EM +H  P++GEY SDHL M+  +ELL
Sbjct: 469 SKEMCEHAIPYKGEYPSDHLCMMIQLELL 497

>TBLA0D03300 Chr4 complement(823242..824684) [1443 bp, 480 aa] {ON}
           Anc_8.850 YMR285C
          Length = 480

 Score =  435 bits (1118), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 219/445 (49%), Positives = 292/445 (65%), Gaps = 18/445 (4%)

Query: 69  LAKGLDPDYPPELQFIKRPMLHL--HQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGEA 126
           L +G DPD+P EL FIKRP+L+L  H      GF F+LMTYNCLAQA+IRR++F DSG A
Sbjct: 38  LIQGEDPDHPIELSFIKRPILYLPHHGHSNRKGFKFSLMTYNCLAQAMIRREVFSDSGPA 97

Query: 127 VKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEK-LGYESQFHRIASKNHGV 185
           +KWFRRSKVL+ E  +YN D++CLQEID  QY+ FWK + E  L   + +++   K+HGV
Sbjct: 98  LKWFRRSKVLMNEITYYNPDILCLQEIDDFQYENFWKDQLESNLNMNTFYYKQKIKHHGV 157

Query: 186 AIVWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDK-ILSTLPK----- 239
            I WK+ +FK  D M++DFD   +S+I  RT T N  + ++LKF+D+ I    P      
Sbjct: 158 LIAWKKSIFKQVDHMVVDFDDVKTSNIARRTITRNIAMYVALKFNDEFITKNFPNLLHSF 217

Query: 240 NXXXXXXXXXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFF 299
           +           HLFWHPFGT+ERTRQCY+LL KMK+F+  +NV     D   +HW PF 
Sbjct: 218 DQNDIGFIISTTHLFWHPFGTFERTRQCYILLEKMKKFIDILNV----KDHLKTHWYPFI 273

Query: 300 CGDFNSQPFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXXXXNIEKF 359
           CGDFNS P D+PYLSMTSKPIEYT R K VI+CST+YKFSK RN             EK 
Sbjct: 274 CGDFNSTPRDAPYLSMTSKPIEYTGREKKVIECSTAYKFSKRRNGEIGDSDEEE---EKK 330

Query: 360 GKDQPQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRG 419
             +QP+  VP++F    EQ  LV ++  +HN+L +RA SLY + YK V   N  I+N RG
Sbjct: 331 LINQPKDMVPDSFTPTIEQAKLVHQLQSLHNQLALRATSLYGLAYKIVDPSNVNINNDRG 390

Query: 420 EPIISNWANTWRGLLDYIFHVNTWDFDN--RQAVDSLEKFEIENSIRLRGFLRMPLDSEM 477
           EP  ++WA +W G+LDYI +V+ WD +    +  +SLE+FE  N + ++G L+MPL+ +M
Sbjct: 391 EPEFTSWAKSWHGVLDYIMYVDNWDINEPPSEIGESLEEFEKNNQLLIKGLLKMPLNKDM 450

Query: 478 PKHGQPHEGEYASDHLSMICNIELL 502
           P H QP E EY SDH+S++C +E+L
Sbjct: 451 PFHTQPFEREYPSDHISILCEMEIL 475

>NCAS0B00270 Chr2 (27753..29183) [1431 bp, 476 aa] {ON} Anc_8.850
          Length = 476

 Score =  428 bits (1100), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 211/440 (47%), Positives = 289/440 (65%), Gaps = 14/440 (3%)

Query: 69  LAKGLDPDYPPELQFIKRPMLHLHQDEPVTG---FNFTLMTYNCLAQALIRRKLFPDSGE 125
           + +GLDPD PPELQF +RP L LH +EP  G     F+++TYNCLAQ LI R +FP+SG 
Sbjct: 42  MQQGLDPDIPPELQFQRRPFLTLHDNEPDNGESKHEFSILTYNCLAQGLIMRDMFPESGN 101

Query: 126 AVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGV 185
           A+KW RRSK ++ E ++YN D++CLQEID    + FW V+F+ LGY  +F +   K HGV
Sbjct: 102 ALKWTRRSKTMINELKYYNPDIMCLQEIDFKYVKEFWSVQFKSLGYSFKFFKKEKKIHGV 161

Query: 186 AIVWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXX 245
            I W+  +FK  D+  +DFD+  + DIPPRT+T N GLI++L+F D   +    +     
Sbjct: 162 VIAWRDSIFKFYDQCQVDFDELLAGDIPPRTKTRNIGLIVALQFLDN--NNNNPSRESHG 219

Query: 246 XXXXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNS 305
                 HLFWHPFGT+ERTRQCY++L++M +F+  +N         +++W PF  GDFNS
Sbjct: 220 IVVATTHLFWHPFGTFERTRQCYLMLSEMNKFLSFLN-----EHSGITNWYPFLTGDFNS 274

Query: 306 QPFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRN---XXXXXXXXXXXNIEKFGKD 362
           QP D+PY+SMT+KPI+Y +  +TVI+CSTSY +SK RN                E+F K 
Sbjct: 275 QPKDAPYMSMTTKPIQYHDEMRTVIECSTSYTYSKKRNGDMDVNEKEQSDSEEDEEFIKK 334

Query: 363 QPQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPI 422
           QP  P P  F   +EQ ALV  +  +HN L  RA SLYSVGY++VH EN+ I+NTRGEP 
Sbjct: 335 QPTDPRPAFFQPTKEQAALVNTIQQLHNSLPFRAISLYSVGYRNVHPENSFINNTRGEPE 394

Query: 423 ISNWANTWRGLLDYIFHVNTWDF-DNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHG 481
            S+W   W GLLDYIF++  W+  D    V++LE FE  N++++ GFL++PL  EM  H 
Sbjct: 395 FSSWGIHWSGLLDYIFYIKAWNLKDKNDDVETLETFEKTNTLKILGFLKLPLRKEMAHHS 454

Query: 482 QPHEGEYASDHLSMICNIEL 501
           QP+EGEY SDHL+++C ++L
Sbjct: 455 QPYEGEYPSDHLALMCKLQL 474

>Smik_13.16 Chr13 (28600..30108) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  360 bits (923), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 185/453 (40%), Positives = 269/453 (59%), Gaps = 37/453 (8%)

Query: 68  LLAKGLDPDYP-PELQFIKRPMLHLHQDEPVTGF------------NFTLMTYNCLAQAL 114
           L+++G DPD+P P+LQFI+RP+LH+  ++    F            +  +MTYN LAQ L
Sbjct: 63  LISQGKDPDFPTPDLQFIERPLLHISSEKNANDFKSSFIQATSSSLDIKIMTYNTLAQTL 122

Query: 115 IRRKLFPDSGEAVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQ 174
           IRR  FP SG A+KW +RSKVL++E + Y  D++ LQE+D+ + + FW+  F KLG++  
Sbjct: 123 IRRDFFPQSGSALKWHKRSKVLVHELKTYTPDIVSLQEVDYNELK-FWRENFHKLGFDLS 181

Query: 175 FHRIASKNHGVAIVWKREMFKMTDRMLIDFDKETSSD-IPPRTRTNNTGLILSLKFSDKI 233
           F R   K HG+ + W  E F++ +  ++D+D+  + + I  RTRT N  LI+SL+F D  
Sbjct: 182 FRRNGGKTHGLLVAWNNEKFQLDNEWMLDYDQILAGNVISARTRTKNIALIVSLRFKDT- 240

Query: 234 LSTLPKNXXXXXXXXXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLS 293
                +N           HLFWHPFG +ER RQ Y++L K++E            D    
Sbjct: 241 -----RNASTNGIVVANTHLFWHPFGVFERLRQSYLVLQKIQEI----------KDFPKY 285

Query: 294 H-WVPFFCGDFNSQPFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXX 352
           H W     GDFN++P + PYL++TSKP+  T   + +++CS +Y++SK RN         
Sbjct: 286 HGWHSLLMGDFNTEPEEPPYLAITSKPLTLTGSTRAMVECSLAYRYSKKRNGEESDQDDE 345

Query: 353 XXNIEKFGK---DQPQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHA 409
             +    G+   +QP+ P P+ F A +E+  LV ++  +HN L ++  SLY +GY  VH 
Sbjct: 346 DYDENSRGERNLNQPKNPKPKHFAATKEEKDLVNQLITLHNSLHVKGISLYGLGYGKVHP 405

Query: 410 ENAGIDNTRGEPIISNWANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFL 469
           ENA  +   GEP +SNWANTW GLLDYIF++ + D ++ Q   SL  FE  N + + G+L
Sbjct: 406 ENA--NEGHGEPELSNWANTWCGLLDYIFYIESDDNNSAQQEKSLNVFEENNGVNVIGYL 463

Query: 470 RMPLDSEMPKHGQPHEGEYASDHLSMICNIELL 502
           RMP   EMPKH QP EGEYASDH+S++C I L 
Sbjct: 464 RMPCKQEMPKHSQPFEGEYASDHISLMCQIRLF 496

>CAGL0B02387g Chr2 complement(228209..229624) [1416 bp, 471 aa] {ON}
           weakly similar to uniprot|Q03264 Saccharomyces
           cerevisiae YMR285c or uniprot|Q03210 Saccharomyces
           cerevisiae YML118w
          Length = 471

 Score =  357 bits (917), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 192/446 (43%), Positives = 263/446 (58%), Gaps = 32/446 (7%)

Query: 68  LLAKGLDPDYPPELQFIKRPMLHL-HQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGEA 126
           LL++GLDPD+P E QFI+RP+L + H D    G   ++MTYNCLAQ LIRR++FP+SG A
Sbjct: 45  LLSRGLDPDFPAECQFIERPILLVPHGDNYERGLPLSIMTYNCLAQTLIRREMFPESGPA 104

Query: 127 VKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVA 186
           +KWF RSKVLL+E +HYN+D+ CLQEID +QY  FW  E  K GY++ +    SK+HGV 
Sbjct: 105 LKWFVRSKVLLHEIKHYNADICCLQEIDDVQYDLFWSEELPKFGYKTIYFHQDSKSHGVM 164

Query: 187 IVWKREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDKILSTLPK-NXXXXX 245
           I WK E+F++   M I+FDKE  + I PRTRTNN GL+++L F+D   +   +       
Sbjct: 165 IAWKEELFQLESHMNIEFDKEAPAGIQPRTRTNNVGLLVALAFTDAFRARNNRIRTSRSG 224

Query: 246 XXXXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNS 305
                 HLFWHPFGTY+RTRQC V+  K+ EF   V        GD   +   F GDFNS
Sbjct: 225 VIIGTFHLFWHPFGTYDRTRQCLVIKKKILEFAGTVK-------GD---YCKMFTGDFNS 274

Query: 306 QPFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXXXXNIEKF------ 359
           QP   PYL +T    +   + +T I+ ST+Y++S+ RN             E+       
Sbjct: 275 QPNSVPYLVLTQPRAQLNTQQRTSIEASTAYRYSERRNLGKEYSMEEEEEEEEEEEKREY 334

Query: 360 ----GKDQPQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGID 415
               G D   TP P+ F + EEQ  LV  +    N++ + A SLYS+GY  V   +    
Sbjct: 335 EYDQGTDPWNTPRPDEFDSTEEQRQLVNNLIDRCNDVPLCATSLYSIGYHTVDPTHIADH 394

Query: 416 NTRGEPIISNWANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDS 475
           +   EP +S+W+  W GLLDYIF+VN       Q   +   FE  N+I + G+L+MP  +
Sbjct: 395 H---EPELSSWSTKWAGLLDYIFYVN-------QRPSTPATFETANNIAIAGYLQMPTHA 444

Query: 476 EMPKHGQPHEGEYASDHLSMICNIEL 501
           +M  H QP+ GEY SDH+SM+C +E+
Sbjct: 445 QMHNHSQPYTGEYPSDHISMMCALEI 470

>Suva_13.25 Chr13 (32137..33645) [1509 bp, 502 aa] {ON} YML118W
           (REAL)
          Length = 502

 Score =  354 bits (908), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 183/447 (40%), Positives = 266/447 (59%), Gaps = 30/447 (6%)

Query: 68  LLAKGLDPDYP-PELQFIKRPMLHLHQD-------EPVTGFNFTLMTYNCLAQALIRRKL 119
           L+++G DPD+P P+LQFIKRP LHLH +             +  +MTYN LAQ LIRR  
Sbjct: 65  LISQGKDPDFPTPDLQFIKRPFLHLHHEIAQGSTESTPNSLDVKIMTYNTLAQTLIRRNF 124

Query: 120 FPDSGEAVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIA 179
           FP SG A+KW +RSKVL++E + Y  D++ LQE+D+ + + FW+  F KLG++  F R  
Sbjct: 125 FPQSGSALKWHKRSKVLVHELKTYKPDIVSLQEVDYNELK-FWQENFRKLGFDLTFKRHD 183

Query: 180 SKNHGVAIVWKREMFKMTDRMLIDFDKETSSD-IPPRTRTNNTGLILSLKFSDKILSTLP 238
            K HG+ I W    F++ +  ++D+D   + + IP RTRT N  LI SL+  +       
Sbjct: 184 GKTHGLLIAWNSGKFQLENEWMLDYDNILAGNAIPARTRTKNIALIASLRLKNI------ 237

Query: 239 KNXXXXXXXXXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPF 298
            +           HLFWHPFG +ER RQ Y++L K++E   +     NG       W   
Sbjct: 238 SDPSTDGVIVANTHLFWHPFGVFERLRQSYLVLAKIQEI--KACPKYNG-------WHSV 288

Query: 299 FCGDFNSQPFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXXXXNIEK 358
             GDFN++P + PYL++T KP+  T  A+ + +CS +Y++SK RN           + + 
Sbjct: 289 LMGDFNTEPEEPPYLAITRKPVALTGSARVMAECSLAYRYSKKRNGEEGGQDDEECDEQS 348

Query: 359 FGK---DQPQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGID 415
            G+   +QPQ P P++F A  EQ ALV+++  +HN L +R  SLY +GY  V  EN+   
Sbjct: 349 RGEGRFNQPQNPKPKSFTATSEQKALVDQLVALHNSLHVRGVSLYGLGYGKVQPENSHES 408

Query: 416 NTRGEPIISNWANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDS 475
           N  GEP +SNWAN+W GLLDYIF++   D  +    + ++ FE +N++R+ G+L+MP   
Sbjct: 409 N--GEPELSNWANSWCGLLDYIFYIEHSDEHSAHDQNPVDDFENKNNLRVMGYLKMPRAK 466

Query: 476 EMPKHGQPHEGEYASDHLSMICNIELL 502
           EMPKH QP EGEYASDH+S++C +  L
Sbjct: 467 EMPKHSQPFEGEYASDHVSLMCQLRFL 493

>YML118W Chr13 (32334..33851) [1518 bp, 505 aa] {ON}  NGL33'-5'
           exonuclease specific for poly-A RNAs; has a domain
           similar to a magnesium-dependent endonuclease motif in
           mRNA deadenylase Ccr4p; similar to Ngl1p and Ngl2p
          Length = 505

 Score =  349 bits (895), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 183/452 (40%), Positives = 267/452 (59%), Gaps = 34/452 (7%)

Query: 68  LLAKGLDPDYP-PELQFIKRPMLHLHQDE-----PVT------GFNFTLMTYNCLAQALI 115
           L+++G DPD+P P+LQFI+RP L ++ D      P T        +  +MTYN LAQ LI
Sbjct: 63  LISQGKDPDFPTPDLQFIERPFLPINHDNSKGLTPATIQVTQDSLDVKIMTYNTLAQTLI 122

Query: 116 RRKLFPDSGEAVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQF 175
           RR  FP+SG A+KW +RSKVL++E + Y  DV+ LQE+D+ +   FW+  F KLG++  F
Sbjct: 123 RRDFFPESGPALKWHKRSKVLVHELKKYRPDVVSLQEVDYNELN-FWQENFHKLGFDVIF 181

Query: 176 HRIASKNHGVAIVWKREMFKMTDRMLIDFDKETSSD-IPPRTRTNNTGLILSLKFSDKIL 234
            R   K HG+ + W  + F++ +  ++D+D   + + I  RTRT N  LI+SL F     
Sbjct: 182 KRHEGKTHGLLVAWNNKKFQLDNDWMLDYDNILAGNVISARTRTKNIALIISLYFKGITD 241

Query: 235 STLPKNXXXXXXXXXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSH 294
           S+               HLFWHPFG +ER RQ Y++L K++E   +     NG       
Sbjct: 242 SS------SRGIIVANTHLFWHPFGVFERLRQSYLVLQKIQEI--KACSKYNG------- 286

Query: 295 WVPFFCGDFNSQPFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXXXX 354
           W     GDFN++P + PYL++T +P+      + +++CS +Y++SK RN           
Sbjct: 287 WHSLLMGDFNTEPEEPPYLAITKRPLILKGPIRAMVECSLAYRYSKKRNGEESDQDDEEC 346

Query: 355 NIEKFGK---DQPQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAEN 411
           + +  G+   DQPQ P PE+F A +E+ ALV ++  +HN L ++  SLY +GY  VH EN
Sbjct: 347 DEKSRGEGHSDQPQNPKPESFTATKEEKALVNQLVALHNSLHVKGVSLYGIGYGKVHPEN 406

Query: 412 AGIDNTRGEPIISNWANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRM 471
           A  + + GEP +SNWANTW GLLDYIF++      + +  + L  FE  N++++ G+LRM
Sbjct: 407 A--NGSHGEPGLSNWANTWCGLLDYIFYIEGDHNQDTRQKEPLNAFEGNNNVKIIGYLRM 464

Query: 472 PLDSEMPKHGQPHEGEYASDHLSMICNIELLL 503
           P   EMPKH QP EGEYASDH+S++C I L  
Sbjct: 465 PCAQEMPKHSQPFEGEYASDHISLMCQIRLFF 496

>Skud_13.23 Chr13 (32056..33552) [1497 bp, 498 aa] {ON} YML118W
           (REAL)
          Length = 498

 Score =  342 bits (876), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 178/451 (39%), Positives = 261/451 (57%), Gaps = 35/451 (7%)

Query: 68  LLAKGLDPDYP-PELQFIKRPMLHLH----QDEPVTG-------FNFTLMTYNCLAQALI 115
           L+++G DPD+P P+LQFI+RP LH++    QD   +G        +  +MTYN LAQ LI
Sbjct: 65  LISQGKDPDFPTPDLQFIERPFLHVYREVSQDSKTSGMQVPPSSLDVQIMTYNTLAQTLI 124

Query: 116 RRKLFPDSGEAVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQF 175
           RR  FP SG A+KW +RSKVL++E + Y  D++ LQE+D+ +   FW   F KLG+ S F
Sbjct: 125 RRDFFPQSGSALKWHKRSKVLVHELKTYKPDIVSLQEVDYNEL-GFWHENFHKLGFGSTF 183

Query: 176 HRIASKNHGVAIVWKREMFKMTDRMLIDFDKETSSD-IPPRTRTNNTGLILSLKFSDKIL 234
            R   K HG+ + W  E F+  +  ++D+D   + + I  RTRT N  LI+SL   +   
Sbjct: 184 RRHEGKTHGLMVAWNNEKFQQDNEWMLDYDTILAGNAISARTRTKNIALIVSLSVKNMT- 242

Query: 235 STLPKNXXXXXXXXXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSH 294
                N           HLFWHPFG +ER RQ +++L K++E                  
Sbjct: 243 -----NLSTSGVIVANTHLFWHPFGVFERLRQSFLVLKKIEEIKTCPKYYG--------- 288

Query: 295 WVPFFCGDFNSQPFDSPYLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXXXX 354
           W     GDFN++P + PY+++T +P+  T  A+ + +CS +Y++SK+RN           
Sbjct: 289 WHSLLMGDFNTEPEEPPYMAITRRPLTLTGSARAMTECSLAYRYSKMRNGEESDQDEECD 348

Query: 355 NIEKFGK---DQPQTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAEN 411
             E  G+   DQPQ P P+ F+A +EQ  LV ++  +HN L ++  SLY + Y  VH +N
Sbjct: 349 E-ESTGEGQHDQPQNPKPKYFVATKEQKNLVNQLVALHNSLHVKGISLYGLSYGKVHPDN 407

Query: 412 AGIDNTRGEPIISNWANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRM 471
           +      GEP +SNWANTW GLLDYIF++   D  +    + ++ FE +N++++ G+LRM
Sbjct: 408 S--KENHGEPELSNWANTWCGLLDYIFYIERNDNVSSSKDEPVKNFEDQNNVKIIGYLRM 465

Query: 472 PLDSEMPKHGQPHEGEYASDHLSMICNIELL 502
           P   EMPKH QP EGEYASDH+S++C + L 
Sbjct: 466 PRAEEMPKHSQPFEGEYASDHISLMCQLRLF 496

>KAFR0A02860 Chr1 complement(596779..598215) [1437 bp, 478 aa] {ON}
           Anc_8.850 YMR285C
          Length = 478

 Score =  335 bits (858), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 180/434 (41%), Positives = 261/434 (60%), Gaps = 25/434 (5%)

Query: 83  FIKRPMLHLHQDEPV-TGFNFTLMTYNCLAQALIRRKLFPDSGEAVKWFRRSKVLLYEFQ 141
           FIKR +L L   E +    +  +MTYN L+Q+LIRR+++PD+ +A+KW  RSKV+L E +
Sbjct: 53  FIKRAILQLPNVEELDNSVDLKIMTYNTLSQSLIRREIYPDAHDAIKWHVRSKVILNEIK 112

Query: 142 HYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHR--IASKNHGVAIVWKREMFKMTDR 199
           +YN D++C QE+D IQ+  FW  E  KLGYE +F++     K HGVAI W+  +F+  D 
Sbjct: 113 YYNCDIMCFQEVDVIQWDKFWLPELSKLGYEGEFYKDFRGPKVHGVAIFWRSNLFEQFDV 172

Query: 200 MLIDFDKETSSD-IPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXXXXXXXHLFWHPF 258
           + I+FD   + + I   TRT N GLI++LKF                      HLFWHPF
Sbjct: 173 IKINFDDIVAGNAISKTTRTWNVGLIVALKFKSS------NAKFRSGIVIGTTHLFWHPF 226

Query: 259 GTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSH-WVPFFCGDFNSQPFDSPYLSMTS 317
           GT+ERTRQ  +LL K ++ +  +N  + G+  ++S+ W+P   GDFNSQP D PYLS+TS
Sbjct: 227 GTFERTRQLAILLKKFRKLIDNLNT-ECGHINEMSNRWLPILTGDFNSQPCDMPYLSITS 285

Query: 318 KPIEYTERAKTVIQCSTSYKFSKLRNXXXXXXXXXXXNIE----------KFGKDQPQTP 367
           KP+  +  AKTVI+CST+YKFS+ R+           N E          +  +  P  P
Sbjct: 286 KPVSASGEAKTVIECSTAYKFSRRRSGSINSSEEVDHNEETQSEKEVEEEEDEESNPIDP 345

Query: 368 VPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTRGEPIISNWA 427
            P  F A  EQ  L+ ++  +HN + ++A SL+ + YK VH+   G+ N + EP +S+ +
Sbjct: 346 RPSHFEATSEQKDLIAKLEKVHNSINLKATSLFGIAYKKVHS--IGL-NCKNEPELSHTS 402

Query: 428 NTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHGQPHEGE 487
             W GLLDYIF +  W+   +    SLE FE   S+R++G L+MP   E+PK+ QPH+G+
Sbjct: 403 IFWTGLLDYIFILEPWNEVEKTDWGSLEDFEKRMSLRVKGLLKMPEMKELPKNVQPHQGQ 462

Query: 488 YASDHLSMICNIEL 501
           Y SDHLSMIC++ +
Sbjct: 463 YPSDHLSMICDLNV 476

>KNAG0G03470 Chr7 complement(743425..744825) [1401 bp, 466 aa] {ON}
           Anc_8.850 YMR285C
          Length = 466

 Score =  319 bits (818), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 178/441 (40%), Positives = 252/441 (57%), Gaps = 37/441 (8%)

Query: 83  FIKRPMLHLHQDEPVTG--------FNFTLMTYNCLAQALIRRKLFPDSGEAVKWFRRSK 134
           FIKRP+L +    P  G            +MTYN LAQ LIRR  FPD+ +A+KW RRS+
Sbjct: 43  FIKRPLLEV----PYVGGVPCRDGYVRVKIMTYNTLAQTLIRRTTFPDAKDAIKWHRRSQ 98

Query: 135 VLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAIVWKREMF 194
           VL+ E ++Y++DV+CLQE D IQ+  FW  EF++LGY+  F     K HGVAIVWK  MF
Sbjct: 99  VLIQELEYYDADVVCLQETDRIQWDKFWVEEFDRLGYKGGFFNFPGKVHGVAIVWKTSMF 158

Query: 195 KMT--DRMLIDFDKETSS-DIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXXXXXXX 251
           + T  D++ +  D   +  DI   T T    L ++L+        L  +           
Sbjct: 159 EDTPLDKLPLCLDDYVAGDDIAATTGTRTVALAVALR--------LKHHKTSRPIIFSTT 210

Query: 252 HLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQPFDSP 311
           HLFWH FGT+ERTRQ +V+L+++ +F+ +V    + +         FF GDFNSQP D+P
Sbjct: 211 HLFWHLFGTFERTRQLFVILSELNKFIKKVT---DAHCPRGQRCYTFFTGDFNSQPCDAP 267

Query: 312 YLSMTSKPIEYTERAKTVIQCSTSYKFSKLRNX-------XXXXXXXXXXNIEKFGKDQP 364
           YLS+T KP++   RAK++I+CS SY++SK RN                  ++E    ++P
Sbjct: 268 YLSLTDKPVQLKGRAKSIIECSLSYRYSKRRNSILEDDEDSMVREPSDQESVED-ETNRP 326

Query: 365 QTPVPETFIANEEQTALVERMAVIHNELGMRANSLYSVGYKHVHAENAGIDNTR--GEPI 422
           Q P P T+ A  EQ   V+ +  +HN + ++  SLY +GY  VH EN+   +T    EP 
Sbjct: 327 QDPRPYTYDAMPEQVERVQHLQNLHNCIPLQGVSLYGIGYHLVHPENSNKYSTSVNQEPQ 386

Query: 423 ISNWANTWRGLLDYIFHVNTWDFDNRQAVDSLEKFEIENSIRLRGFLRMPLDSEMPKHGQ 482
           +S+ A  W GLLDYIF +  W  +N   +  L+  E +  I++ G+LRMPL  EM  H +
Sbjct: 387 LSHRALHWSGLLDYIFLITEWS-ENATKISDLQALERQTGIKINGYLRMPLKEEMCDHTE 445

Query: 483 PHEGEYASDHLSMICNIELLL 503
           PHE EY SDHL+M+C+I L L
Sbjct: 446 PHENEYPSDHLAMMCDISLPL 466

>Ecym_7354 Chr7 (736001..738358) [2358 bp, 785 aa] {ON} similar to
           Ashbya gossypii ACR288W
          Length = 785

 Score = 72.4 bits (176), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 66/237 (27%), Positives = 96/237 (40%), Gaps = 34/237 (14%)

Query: 90  HLHQDEPVTGFNFTLMTYNCLAQALIRRKLFP-DSGEAVKWFRRSKVLLYEFQHYNSDVI 148
           H++QD      +FTL++YN L Q     K++      A+ W  R + L  E   Y +DVI
Sbjct: 435 HVNQD--TLKRSFTLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKEEVLSYQTDVI 492

Query: 149 CLQEIDHIQYQAFWKVEFEKLGYESQFH----------RIASKNHGVAIVWKREMFKMTD 198
           CLQE++   Y+ FW    EK GY   FH          + A K  G  I +K   F    
Sbjct: 493 CLQEVESKTYEEFWLPLLEKQGYSGVFHAKTRARTMQVKDAKKVDGCCIFYKNSEFSCIF 552

Query: 199 RMLIDFD---------KETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXXXXX 249
           +  IDF          + T   +      +N  LI+ LK                     
Sbjct: 553 KDAIDFSSVWMKHKKFQRTEDYLNRAMNKDNIALIVKLK----------HELSGEHVWVV 602

Query: 250 XXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQ 306
             HL W P     +T Q  VLL+ +++ + + + +  GN  +        CGDFNSQ
Sbjct: 603 TTHLHWDPHFNDVKTFQVGVLLDYIEKLLKQQSNI--GNPQEKKKVPLIICGDFNSQ 657

>KLLA0F15884g Chr6 complement(1468612..1470984) [2373 bp, 790 aa]
           {ON} similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 790

 Score = 71.6 bits (174), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 63/238 (26%), Positives = 101/238 (42%), Gaps = 38/238 (15%)

Query: 92  HQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGE-AVKWFRRSKVLLYEFQHYNSDVICL 150
           H +  +   +FTL++YN L       K++  +   A+ W  R + L  +   +++DVICL
Sbjct: 444 HMNNTLLKNSFTLLSYNTLCHHYATPKMYRFTPSWALSWDYRREKLKEQLLDFDTDVICL 503

Query: 151 QEIDHIQYQAFWKVEFEKLGYESQFH----------RIASKNHGVAIVWKREMFKMTDRM 200
           QE++ + Y+ +W    EK  Y   FH          + + K  G AI +K++ F++  + 
Sbjct: 504 QEVETLTYEEYWVPLMEKYNYSCLFHAKTRAKTMHAKDSKKVDGCAIFYKKDQFQLVFQD 563

Query: 201 LIDFDK---------ETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXXXXXXX 251
            IDF            T   +      +N  LI  LK     L+T               
Sbjct: 564 SIDFSSAWRSHKKFHRTEDYLNRAMNKDNVALIAELKH----LNT------NENVWVVTT 613

Query: 252 HLFWHPFGTYERTRQCYVLLNKMKEFM---HRVNVLQNGNDGDLSHWVPFFCGDFNSQ 306
           HL W P     +T Q  V+L+ ++  +   H VN     N+ D+       CGDFNSQ
Sbjct: 614 HLHWDPQFNDVKTFQVGVMLDYLETLIKQHHHVN-----NNNDIKKIPMVICGDFNSQ 666

>CAGL0H06149g Chr8 complement(598643..601264) [2622 bp, 873 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021c CCR4
          Length = 873

 Score = 70.9 bits (172), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 60/248 (24%), Positives = 104/248 (41%), Gaps = 39/248 (15%)

Query: 102 FTLMTYNCLAQALIRRKLFPDSGE-AVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQA 160
           FT+++YN L Q     K++  +   A+ W  R + L  +  ++N+D+ICLQE++   ++ 
Sbjct: 538 FTMLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILNFNTDIICLQEVEAKTFED 597

Query: 161 FWKVEFEKLGYESQFH----------RIASKNHGVAIVWKREMFKMTDRMLIDFD----- 205
           FW+   EK GY   FH          + + K  G    +K   FKM  +  +DF      
Sbjct: 598 FWQPLLEKHGYTGLFHAKTRAKTMQSKDSKKVDGCCAFYKTSKFKMLFKECVDFSGLWMK 657

Query: 206 ----KETSSDIPPRTRTNNTGLILSLKF--SDKILSTLPKNXXXXXXXXXXXHLFWHPFG 259
               + T   +      +N  +++ L+   S +I+  +              HL W P  
Sbjct: 658 HKKFQRTEDYLNRAMNKDNVAIVMKLQHIQSGEIMWLV------------TTHLHWDPKF 705

Query: 260 TYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQPFDSPYLSMTSKP 319
              +T Q  VLL+ M+  +   N  Q     D+  +    CGD NS    S Y   ++  
Sbjct: 706 NDVKTFQVGVLLDHMETLLKEQNPKQ-----DVKKYPLVICGDLNSYLSSSVYELFSTGR 760

Query: 320 IEYTERAK 327
           +++    K
Sbjct: 761 VQHHHDGK 768

>ACR288W Chr3 (882345..884555) [2211 bp, 736 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YAL021C (CCR4)
          Length = 736

 Score = 70.5 bits (171), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 62/235 (26%), Positives = 94/235 (40%), Gaps = 32/235 (13%)

Query: 92  HQDEPVTGFNFTLMTYNCLAQALIRRKLFP-DSGEAVKWFRRSKVLLYEFQHYNSDVICL 150
           H +E +   +FTL++YN L Q     K++      A+ W  R + L  E   Y +D+ICL
Sbjct: 388 HLNEELLKKSFTLLSYNTLCQHYATPKMYRFVPSWALSWDYRREKLKDEVLAYQTDIICL 447

Query: 151 QEIDHIQYQAFWKVEFEKLGYESQFH----------RIASKNHGVAIVWKREMFKMTDRM 200
           QE++   Y+ FW    EK GY   FH          + A K  G  I +K   F    + 
Sbjct: 448 QEVESKTYEEFWLPILEKQGYSGIFHAKTRARTMQSKDAKKVDGCCIFYKNSEFTAVFKD 507

Query: 201 LIDFD---------KETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXXXXXXX 251
            IDF          + T   +      +N  LI+ L+                       
Sbjct: 508 AIDFSSVWMKHKKFQRTEDYLNRAMNKDNVALIIKLR----------HERTGEHVWVVTT 557

Query: 252 HLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQ 306
           HL W P     +T Q  V+L+ +++ + +   +  G+  D        CGDFNSQ
Sbjct: 558 HLHWDPHFNDVKTFQVAVMLDYIEKLLKQHGGV--GSPQDKKKIPLVICGDFNSQ 610

>Suva_1.45 Chr1 complement(87201..89696) [2496 bp, 831 aa] {ON}
           YAL021C (REAL)
          Length = 831

 Score = 70.5 bits (171), Expect = 5e-12,   Method: Compositional matrix adjust.
 Identities = 60/225 (26%), Positives = 92/225 (40%), Gaps = 32/225 (14%)

Query: 101 NFTLMTYNCLAQALIRRKLFPDSGE-AVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQ 159
           +FT+++YN L Q     K++  +   A+ W  R   L  +   Y+SDV+CLQE++   ++
Sbjct: 498 SFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYSSDVLCLQEVESKTFE 557

Query: 160 AFWKVEFEKLGYESQFHRIA----------SKNHGVAIVWKREMFKMTDRMLIDFD---- 205
            +W    EK GY   FH  A           K  G  I +KR+ FKM +R  +DF     
Sbjct: 558 DYWVPLLEKHGYTGVFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKMVNRDSMDFSGAWM 617

Query: 206 -----KETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXXXXXXXHLFWHPFGT 260
                + T   +      +N  L L L+                       HL W P   
Sbjct: 618 KHKKFQRTEDYLNRAMNKDNVALFLKLQHVSS----------GDTIWVVTTHLHWDPKFN 667

Query: 261 YERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNS 305
             +T Q  VLL+ ++  + + +   N    D+       CGDFNS
Sbjct: 668 DVKTFQVGVLLDHLETLL-KEDTTHNSRQ-DIKKSPVLICGDFNS 710

>SAKL0B10032g Chr2 (853065..855260) [2196 bp, 731 aa] {ON} similar
           to uniprot|P31384 Saccharomyces cerevisiae YAL021C CCR4
           Component of the CCR4-NOT transcriptional complex which
           is involved in regulation of gene expression component
           of the major cytoplasmic deadenylase which is involved
           in mRNA poly(A) tail shortening
          Length = 731

 Score = 69.7 bits (169), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 59/229 (25%), Positives = 98/229 (42%), Gaps = 38/229 (16%)

Query: 101 NFTLMTYNCLAQALIRRKLFPDSGE-AVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQ 159
           +FTL++YN L Q     K++  +   A+ W  R   L  +   + +DV+CLQE++   ++
Sbjct: 398 SFTLLSYNTLCQHYATPKMYRYTPSWALSWDYRRDKLKEQIISFQADVVCLQEVECKTFE 457

Query: 160 AFWKVEFEKLGYESQFH----------RIASKNHGVAIVWKREMFKMTDRMLIDFD---- 205
            FW    +K GY   FH          + + K  G  + +K   FK+  +  +DF     
Sbjct: 458 DFWAPFLQKHGYTGVFHAKTRARTMQSKDSKKVDGCCVFYKNSEFKLVFKDAVDFSSVWM 517

Query: 206 -----KETSSDIPPRTRTNNTGLILS---LKFSDKILSTLPKNXXXXXXXXXXXHLFWHP 257
                + T   +      +N  L +    LK +++I  T               HL W P
Sbjct: 518 KHKKFQRTEDYLNRAMNKDNVALFVKLQHLKTNEQIWVT-------------TTHLHWDP 564

Query: 258 FGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQ 306
                +T Q  VLL+ M++ +   N +  GN+ ++       CGDFNSQ
Sbjct: 565 QFNDVKTFQVGVLLDYMEKLLRDQNGV--GNNQEMKKVPLVICGDFNSQ 611

>KLTH0D02310g Chr4 complement(230632..232851) [2220 bp, 739 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 739

 Score = 69.7 bits (169), Expect = 8e-12,   Method: Compositional matrix adjust.
 Identities = 62/245 (25%), Positives = 100/245 (40%), Gaps = 40/245 (16%)

Query: 92  HQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGE-AVKWFRRSKVLLYEFQHYNSDVICL 150
           HQ       +FT+++YN L Q     K++  +   A+ W  R + L  +   YN+D++CL
Sbjct: 398 HQSRETLKKSFTILSYNTLCQHYATPKMYRFTPSWALSWEYRREKLKEQILSYNTDIVCL 457

Query: 151 QEIDHIQYQAFWKVEFEKLGYESQFH----------RIASKNHGVAIVWKREMFKMTDRM 200
           QE++   Y+ FW     + GY   FH          + + K  G    +K   FK+  + 
Sbjct: 458 QEVECKTYEDFWAPLLREKGYSGIFHTKTRARTMHSKDSKKVDGCCFFYKDSEFKLMFKE 517

Query: 201 LIDFD---------KETSSDIPPRTRTNNTGLILSL---KFSDKILSTLPKNXXXXXXXX 248
            +DF          + T   +      +N  L++ L   K  + + +             
Sbjct: 518 AVDFSSVWMKHKKFQRTEDYLNRAMNKDNVALVVKLQHIKSGEHVWAA------------ 565

Query: 249 XXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVP-FFCGDFNSQP 307
              HL W P     +T Q  VLL+ M++ +   N   N N+      VP   CGDFNSQ 
Sbjct: 566 -TTHLHWDPQFNDVKTFQVGVLLDYMEKVIKEQN---NCNNTQELKKVPVVICGDFNSQT 621

Query: 308 FDSPY 312
             + Y
Sbjct: 622 NSAVY 626

>KNAG0D04840 Chr4 (874511..876850) [2340 bp, 779 aa] {ON} Anc_7.78
           YAL021C
          Length = 779

 Score = 67.4 bits (163), Expect = 4e-11,   Method: Compositional matrix adjust.
 Identities = 59/247 (23%), Positives = 104/247 (42%), Gaps = 33/247 (13%)

Query: 94  DEPVTGFNFTLMTYNCLAQALIRRKLFPDSGE-AVKWFRRSKVLLYEFQHYNSDVICLQE 152
           D  +T  +FT+++YN L Q     K++  +   A+ W  R   L  +   Y+ D++CLQE
Sbjct: 427 DHELTKKSFTVLSYNTLCQHYATPKMYRYTPSWALSWEYRRAKLRDQILSYSCDIMCLQE 486

Query: 153 IDHIQYQAFWKVEFEKLGYESQF----------HRIASKNHGVAIVWKREMFKMTDRMLI 202
           ++   ++ FW    EK GY   F          HR + K  G  + +KR  F++  +  +
Sbjct: 487 VEARTFEDFWLPLLEKHGYSGSFHAKTRAKLLQHRDSKKVDGCCVFFKRTKFRLIKKEEV 546

Query: 203 DFDK--------ETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXXXXXXXHLF 254
           DF          + + D   R    +    ++L F  + +++               HL 
Sbjct: 547 DFSSTWMKHEKFQRTEDFLNRAMNKDN---IALYFKLQHIAS------GEHIWVATTHLH 597

Query: 255 WHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQPFDSPYLS 314
           W P     +T Q  VLL+ ++  + + N  Q     D+       CGDFNS    + Y  
Sbjct: 598 WDPKFNDVKTFQVGVLLDHLQTLIRQDNPRQ-----DVKKAPVIICGDFNSYIDSAVYEL 652

Query: 315 MTSKPIE 321
           ++S  ++
Sbjct: 653 LSSGSVK 659

>KAFR0K00670 Chr11 complement(148398..150785) [2388 bp, 795 aa] {ON}
           Anc_7.78 YAL021C
          Length = 795

 Score = 65.9 bits (159), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 56/227 (24%), Positives = 94/227 (41%), Gaps = 39/227 (17%)

Query: 101 NFTLMTYNCLAQALIRRKLFPDSGE-AVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQ 159
           +FT+++YN L Q     K++  +   A++W  R + L  +   Y  D++CLQE++   Y+
Sbjct: 465 SFTILSYNTLCQHYATPKMYRYTPSWALRWDYRREKLKEQILSYGCDILCLQEVESKTYE 524

Query: 160 AFWKVEFEKLGYESQFH----------RIASKNHGVAIVWKREMFKMTDRMLIDFD---- 205
            FW    EK GY   FH          + + K  G  + +K+  FK+  +  +DF     
Sbjct: 525 DFWAPLLEKNGYTGYFHCKTRAKTMQAKDSKKVDGCCVFYKKSKFKLITKEALDFSGAWQ 584

Query: 206 -----KETSSDIPPRTRTNNTGLILSLKF--SDKILSTLPKNXXXXXXXXXXXHLFWHPF 258
                + T   +      +N  + + L+   S + L  +              HL W P 
Sbjct: 585 KHKRFQRTEDYLNRAMNKDNVAIYMKLQHVQSGEYLWVV------------TTHLHWDPK 632

Query: 259 GTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNS 305
               +T Q  VLL+ M+  +   N  Q     D+  +     GDFNS
Sbjct: 633 FNDVKTFQVGVLLDHMESIIKEENPKQ-----DVKKFPIIITGDFNS 674

>YAL021C Chr1 complement(110846..113359) [2514 bp, 837 aa] {ON}
           CCR4Component of the CCR4-NOT transcriptional complex,
           which is involved in regulation of gene expression;
           component of the major cytoplasmic deadenylase, which is
           involved in mRNA poly(A) tail shortening
          Length = 837

 Score = 65.5 bits (158), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 92/227 (40%), Gaps = 38/227 (16%)

Query: 102 FTLMTYNCLAQALIRRKLFPDSGE-AVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQA 160
           FT+++YN L Q     K++  +   A+ W  R   L  +   Y+SD++CLQE++   ++ 
Sbjct: 505 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFEE 564

Query: 161 FWKVEFEKLGYESQFHRIA----------SKNHGVAIVWKREMFKMTDRMLIDFD----- 205
           +W    +K GY   FH  A           K  G  I +KR+ FK+  +  +DF      
Sbjct: 565 YWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKRDQFKLITKDAMDFSGAWMK 624

Query: 206 ----KETSSDIPPRTRTNNTGLILSLKF---SDKILSTLPKNXXXXXXXXXXXHLFWHPF 258
               + T   +      +N  L L L+     D I +                HL W P 
Sbjct: 625 HKKFQRTEDYLNRAMNKDNVALFLKLQHIPSGDTIWAV-------------TTHLHWDPK 671

Query: 259 GTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNS 305
               +T Q  VLL+ ++  +       +    D+  +    CGDFNS
Sbjct: 672 FNDVKTFQVGVLLDHLETLLKEET--SHNFRQDIKKFPVLICGDFNS 716

>NDAI0H02520 Chr8 (614487..617183) [2697 bp, 898 aa] {ON} Anc_7.78
          Length = 898

 Score = 65.1 bits (157), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 91/224 (40%), Gaps = 35/224 (15%)

Query: 102 FTLMTYNCLAQALIRRKLFPDSGE-AVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQA 160
           FT+++YN L Q     K++  +   A+ W  R + L  +   Y SD++CLQE++   ++ 
Sbjct: 569 FTILSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKEQILSYQSDILCLQEVESKTFEE 628

Query: 161 FWKVEFEKLGYESQFH----------RIASKNHGVAIVWKREMFKMTDRMLIDFD----- 205
           FW    EK  Y+  FH          + + K  G  I +K+  FK+  +  +DF      
Sbjct: 629 FWGPLLEKYDYQGVFHIKTRAKTMQTKESKKVDGCCIFFKKSKFKLLAKEAMDFSGTWMK 688

Query: 206 ----KETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXXXXXXXHLFWHPFGTY 261
               + T   +      +N  L + L+    I S                HL W P    
Sbjct: 689 HKKFQRTEDYLNRAMNKDNVALYMKLQ---SITS-------GETVWVVTTHLHWDPKFND 738

Query: 262 ERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNS 305
            +T Q  +LL+ M+  +   N  Q+    ++       CGD NS
Sbjct: 739 VKTFQVGILLDHMETLLKEENPKQDVKKANV-----VICGDLNS 777

>Kwal_26.7112 s26 complement(221318..223546) [2229 bp, 742 aa] {ON}
           YAL021C (CCR4) - 95 kDa containng leucine rich tandem
           repeats [contig 47] FULL
          Length = 742

 Score = 64.7 bits (156), Expect = 3e-10,   Method: Compositional matrix adjust.
 Identities = 56/229 (24%), Positives = 96/229 (41%), Gaps = 38/229 (16%)

Query: 101 NFTLMTYNCLAQALIRRKLFPDSGE-AVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQ 159
           +FTL++YN L Q     K++  +   A+ W  R + L  +  +Y++D+ICLQE++   Y+
Sbjct: 409 SFTLLSYNTLCQHYATPKMYRFTPSWALSWDYRREKLKEQILYYSTDIICLQEVECKTYE 468

Query: 160 AFWKVEFEKLGYESQFH----------RIASKNHGVAIVWKREMFKMTDRMLIDFD---- 205
            FW     + GY   FH          + + K  G  + ++   FK+  +  +DF     
Sbjct: 469 DFWAPLLREEGYTGIFHAKTRARTMQGKDSKKVDGCCLFYRDSEFKLIFKDTVDFSSVWM 528

Query: 206 -----KETSSDIPPRTRTNNTGLILS---LKFSDKILSTLPKNXXXXXXXXXXXHLFWHP 257
                + T   +      +N  L++    LK  + + +                HL W P
Sbjct: 529 KHKKFQRTEDYLNRAMNKDNVALLVKLQHLKSGEHVWAA-------------TTHLHWDP 575

Query: 258 FGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQ 306
                +T Q  VLL+ M++ +   +   N    +L       CGDFNSQ
Sbjct: 576 QFNDVKTFQVGVLLDHMEKVIKEHSGYNNSQ--ELKKVPVIICGDFNSQ 622

>Smik_1.45 Chr1 complement(93751..96270) [2520 bp, 839 aa] {ON}
           YAL021C (REAL)
          Length = 839

 Score = 63.9 bits (154), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 92/227 (40%), Gaps = 38/227 (16%)

Query: 102 FTLMTYNCLAQALIRRKLFPDSGE-AVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQA 160
           FT+++YN L Q     K++  +   A+ W  R   L  +   Y+SD++CLQE++   ++ 
Sbjct: 507 FTVLSYNTLCQHYATPKMYRYTPSWALSWDYRRNKLKEQILSYDSDLLCLQEVESKTFED 566

Query: 161 FWKVEFEKLGYESQFHRIA----------SKNHGVAIVWKREMFKMTDRMLIDFD----- 205
           +W    +K GY   FH  A           K  G  I +K++ FK+  +  +DF      
Sbjct: 567 YWVPLLDKHGYTGIFHAKARAKTMHSKDSKKVDGCCIFFKKDQFKLITKDAMDFSGAWMK 626

Query: 206 ----KETSSDIPPRTRTNNTGLILSLKF---SDKILSTLPKNXXXXXXXXXXXHLFWHPF 258
               + T   +      +N  L L L+     D I +                HL W P 
Sbjct: 627 HKKFQRTEDYLNRAMNKDNVALFLKLQHIPSGDTIWAV-------------TTHLHWDPK 673

Query: 259 GTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNS 305
               +T Q  VLL+ ++  + R     N    D+       CGDFNS
Sbjct: 674 FNDVKTFQVGVLLDHLETLL-REETTHNFRQ-DIKKSPVLICGDFNS 718

>Skud_1.40 Chr1 complement(86326..88935) [2610 bp, 869 aa] {ON}
           YAL021C (REAL)
          Length = 869

 Score = 63.2 bits (152), Expect = 8e-10,   Method: Compositional matrix adjust.
 Identities = 60/228 (26%), Positives = 96/228 (42%), Gaps = 40/228 (17%)

Query: 102 FTLMTYNCLAQALIRRKLFPDSGE-AVKW-FRRSKVLLYEFQHYNSDVICLQEIDHIQYQ 159
           F++++YN L Q     K++  +   A+ W +RRSK L  +   Y+SDV+CLQE++   ++
Sbjct: 537 FSVLSYNTLCQHYATPKMYRYTPSWALTWDYRRSK-LKEQILSYDSDVLCLQEVESKTFE 595

Query: 160 AFWKVEFEKLGYESQFHRIA----------SKNHGVAIVWKREMFKMTDRMLIDFD---- 205
            +W    +K GY   F+  A           K  G  I +KR+ FK+  +  +DF     
Sbjct: 596 DYWVPLLDKHGYTGIFYAKARAKTMHSKDSKKVDGCCIFFKRDQFKLVTKDAMDFSGAWM 655

Query: 206 -----KETSSDIPPRTRTNNTGLILSLKF---SDKILSTLPKNXXXXXXXXXXXHLFWHP 257
                + T   +      +N  L L L+     D I                  HL W P
Sbjct: 656 KHKKFQRTEDYLNRAMNKDNVALFLKLQHVSSGDTIWVV-------------TTHLHWDP 702

Query: 258 FGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNS 305
                +T Q  VLL+ ++  + + +   N    D+       CGDFNS
Sbjct: 703 KFNDVKTFQVGVLLDHLESLL-KEDTTHNSRQ-DIKKSPVLICGDFNS 748

>ZYRO0D05302g Chr4 complement(453024..455597) [2574 bp, 857 aa] {ON}
           similar to uniprot|P31384 Saccharomyces cerevisiae
           YAL021C CCR4 Component of the CCR4-NOT transcriptional
           complex which is involved in regulation of gene
           expression component of the major cytoplasmic
           deadenylase which is involved in mRNA poly(A) tail
           shortening
          Length = 857

 Score = 63.2 bits (152), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 58/230 (25%), Positives = 95/230 (41%), Gaps = 20/230 (8%)

Query: 97  VTGFNFTLMTYNCLAQALIRRKLFPDSGE-AVKWFRRSKVLLYEFQHYNSDVICLQEIDH 155
           V   +FT+M+YN L Q     K++  +   A+ W  R + L  E   Y +D++CLQE++ 
Sbjct: 519 VAKRSFTIMSYNILCQHYATPKMYRYTPSWALSWDHRRQRLTEEVMSYMTDIVCLQEVEA 578

Query: 156 IQYQAFWKVEFEKLGYESQFH----------RIASKNHGVAIVWKREMFKMTDRMLIDFD 205
             Y+  W     K GY   FH          + + K  G  + +K   FK+  +  +DF 
Sbjct: 579 KTYEEHWAPLMLKQGYSGVFHAKTRAKTMHSKDSKKVDGCCVFYKESEFKLQFKDEVDF- 637

Query: 206 KETSSDIPPRTRTNNTGLILSLKFS-DKILSTLPKNXXXXXXXX--XXXHLFWHPFGTYE 262
              SS      +   T   L+   + D ++  +  N             HL W P     
Sbjct: 638 ---SSTWMKHKKFQRTEDYLNRAMNKDNVVIYIKLNHLKSGESVWIATTHLHWDPQFNDV 694

Query: 263 RTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQPFDSPY 312
           +T Q  +L++ ++E +       +  D   S  +   CGDFNSQ   + Y
Sbjct: 695 KTFQVGILMDHLEELIKEHGSPSSRQDPKKSPVI--ICGDFNSQKDSAVY 742

>KAFR0D01250 Chr4 (254384..255454) [1071 bp, 356 aa] {ON} Anc_7.90
           YOL042W
          Length = 356

 Score = 61.2 bits (147), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 59/237 (24%), Positives = 100/237 (42%), Gaps = 41/237 (17%)

Query: 101 NFTLMTYNCLAQALIRRKLFPDSGEAVK-WFRRSKVLLYE-FQHYNSDVICLQEIDHIQY 158
           +FTL+TYN L+Q+ +  +++       K W  R K+L YE  + YN+D+ICLQE+    Y
Sbjct: 21  SFTLLTYNILSQSYMWPQVYKYVPAKYKSWEYRHKLLEYEILKLYNADIICLQELTSRDY 80

Query: 159 QAFWKVEFEKLGYESQF---------HRIASKNHGVAIVWKREMF--------KMTDRML 201
           + +W+ +  K    S F          + A    GV I +  +MF        +++D ++
Sbjct: 81  EYYWRKKLSKFNKGSDFICKTPPKYWTKAADDLDGVGIFYNLDMFELIDSNGIRLSDFLI 140

Query: 202 IDFDKETSSDIPPR-----------TRTNNTGLILSLKFSDKILSTLPKNXXXXXXXXXX 250
            DF++     +  R            + +N   +L  K    +  TL             
Sbjct: 141 SDFEQPELDYLASRKLVLTDGEGRQIKVSNILDVLEEKNQVCLFMTLKHKRTGATVVVVT 200

Query: 251 XHLFWHPFGTYERTR--QCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNS 305
            HL+W     Y+  +  QC +++ ++ + M      Q   DG  S     F GD NS
Sbjct: 201 THLYWK----YDEIKLTQCMIIMRQLSKIMKD----QLKKDGS-SFVKVLFAGDLNS 248

>TPHA0H02680 Chr8 (627935..630553) [2619 bp, 872 aa] {ON} Anc_7.78
           YAL021C
          Length = 872

 Score = 59.7 bits (143), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 58/253 (22%), Positives = 98/253 (38%), Gaps = 32/253 (12%)

Query: 73  LDPDYPPELQFIKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGE-AVKWFR 131
           ++ D  P+ +F    +   H    +   +FT+++YN L Q     K++  +    + W  
Sbjct: 511 INADEEPQEEFDTMALSDSHISTEMLKKSFTVLSYNTLCQHYATPKMYRYTPSWVLSWDT 570

Query: 132 RSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFH----------RIASK 181
           R + L  +     SDVICLQE++   Y+ FW    +K GY   FH          + + K
Sbjct: 571 RREQLKNQILGIQSDVICLQEVEAQTYEDFWLPLLQKRGYLGIFHAKTRAKTMQSKDSKK 630

Query: 182 NHGVAIVWKREMFKMTDRMLIDFD---------KETSSDIPPRTRTNNTGLILSLKFSDK 232
             G  I +K   FK+  +  +DF          + T   +      +N  L + L+  + 
Sbjct: 631 VDGCCIFYKESEFKLQHQESVDFSGVWMKHKKFQRTEDYLNRAMNKDNVALFVKLEHINS 690

Query: 233 ILSTLPKNXXXXXXXXXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDL 292
             S                HL W P     +T Q  VLL+ ++  +   N     +  ++
Sbjct: 691 GESVW----------VVTTHLHWDPQFNDVKTFQVGVLLDHLESLLKDYN--NASSKQEI 738

Query: 293 SHWVPFFCGDFNS 305
                  CGD NS
Sbjct: 739 RKCPVIICGDLNS 751

>TDEL0H03730 Chr8 (623125..625518) [2394 bp, 797 aa] {ON} Anc_7.78
           YAL021C
          Length = 797

 Score = 59.3 bits (142), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 52/250 (20%), Positives = 101/250 (40%), Gaps = 32/250 (12%)

Query: 92  HQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGE-AVKWFRRSKVLLYEFQHYNSDVICL 150
           H    ++  +FT+++YN L Q     K++  +   A+ W  R + L  +   Y +DVICL
Sbjct: 454 HLSSELSKRSFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLTEQILSYMTDVICL 513

Query: 151 QEIDHIQYQAFWKVEFEKLGYESQFH----------RIASKNHGVAIVWKREMFKMTDRM 200
           QE++   ++ +W    +K GY   FH          + + K  G  + ++   FK+  + 
Sbjct: 514 QEVEAKTFEEYWAPLMQKHGYSGLFHAKTRAKTMHSKDSKKVDGCCVFYRENEFKLAYKD 573

Query: 201 LIDFD---------KETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXXXXXXX 251
            +DF          + T   +      +N  + L L+      S                
Sbjct: 574 AVDFSGVWQKHKKFQRTEDYLNRAMNKDNVAIYLKLQHIKSGESVW----------IVTT 623

Query: 252 HLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQPFDSP 311
           HL W P     +T Q  VL++ ++  +   +  Q+  +      +   CGD NS+   + 
Sbjct: 624 HLHWDPQFNDVKTFQVGVLMDHIENLLKEQSNAQSKQEAKKCPVI--LCGDLNSEIHSAV 681

Query: 312 YLSMTSKPIE 321
           Y  +++  ++
Sbjct: 682 YELLSTGRVQ 691

>TBLA0A04660 Chr1 complement(1156426..1159116) [2691 bp, 896 aa]
           {ON} Anc_7.78 YAL021C
          Length = 896

 Score = 58.5 bits (140), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 58/255 (22%), Positives = 104/255 (40%), Gaps = 36/255 (14%)

Query: 73  LDPDYPPELQF--IKRPMLHLHQDEPVTGFNFTLMTYNCLAQALIRRKLFPDSGE-AVKW 129
           ++ D  P+ ++  I+    HL +D  +   +FT+++YN L Q     K++  +   A+ W
Sbjct: 535 INTDGEPQTEYDSIEDATSHLSRD--LEKRSFTVLSYNTLCQHYATPKMYRYTPSWALSW 592

Query: 130 FRRSKVLLYEFQHYNSDVICLQEIDHIQYQAFWKVEFEKLGYESQFH----------RIA 179
             R   L  +   + SD++CLQE++   Y  FW+   +K GY+  FH          + +
Sbjct: 593 EYRRDKLKDQILSFKSDILCLQEVESRTYDDFWEPLLQKHGYKGIFHAKTRAKTMQTKDS 652

Query: 180 SKNHGVAIVWKREMFKMTDRMLIDFD---------KETSSDIPPRTRTNNTGLILSLKFS 230
            K  G  I +K   FK+  +  +DF          + T   +      +N  + + L+  
Sbjct: 653 KKVDGCCIFYKESEFKVLFKEAVDFSGIWMKHKNFQRTEDYLNRAMNKDNVAIYMKLQHI 712

Query: 231 DKILSTLPKNXXXXXXXXXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDG 290
                T               HL W P     +T Q  VLL+ ++  +   + + +    
Sbjct: 713 KSGEVTW----------IVTTHLHWDPQFNDVKTFQVGVLLDHLESLLKEHSNIHSKQ-- 760

Query: 291 DLSHWVPFFCGDFNS 305
           D+       CGD NS
Sbjct: 761 DVKKCPIIICGDLNS 775

>Kpol_1040.14 s1040 complement(42093..44447) [2355 bp, 784 aa] {ON}
           complement(42093..44447) [2355 nt, 785 aa]
          Length = 784

 Score = 57.8 bits (138), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 53/225 (23%), Positives = 89/225 (39%), Gaps = 32/225 (14%)

Query: 101 NFTLMTYNCLAQALIRRKLFPDSGE-AVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQ 159
           +FT+++YN L Q     K++  +   A+ W  R + L  +   + SDVICLQE++   Y+
Sbjct: 451 SFTVLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSFKSDVICLQEVESKSYE 510

Query: 160 AFWKVEFEKLGYESQFH----------RIASKNHGVAIVWKREMFKMTDRMLIDFD---- 205
            FW    +K GY   F+          + + K  G  I +K   F +  +  +DF     
Sbjct: 511 EFWLPLLQKNGYAGTFYAKTRAKTMQTKDSKKVDGCCIFYKESEFNVLYKDSVDFSGVWM 570

Query: 206 -----KETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXXXXXXXHLFWHPFGT 260
                + T   +      +N  L + L+      S                HL W P   
Sbjct: 571 KHKKFQRTEDYLNRAMNKDNVALYMKLEHIKSGESVW----------VVTTHLHWDPQFN 620

Query: 261 YERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNS 305
             +T Q  +LL+ ++E +   N     +  ++       CGD NS
Sbjct: 621 DVKTFQVGILLDHLEELLKDNN--NASSKQEIRKCPVIICGDLNS 663

>NCAS0F01640 Chr6 (330064..332631) [2568 bp, 855 aa] {ON} Anc_7.78
          Length = 855

 Score = 55.8 bits (133), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 60/236 (25%), Positives = 95/236 (40%), Gaps = 36/236 (15%)

Query: 102 FTLMTYNCLAQALIRRKLFPDSGE-AVKWFRRSKVLLYEFQHYNSDVICLQEIDHIQYQA 160
           FTL++YN L Q     K++  +   A+ W  R + L  +   Y SD++CLQE++   ++ 
Sbjct: 526 FTLLSYNTLCQHYATPKMYRYTPSWALSWDYRREKLKDQILSYQSDILCLQEVESKTFEE 585

Query: 161 FWKVEFEKLGYESQFH----------RIASKNHGVAIVWKREMFKMTDRMLIDFD----- 205
           FW    EK  Y+  FH          + + K  G  I +K+  FK+  +  +DF      
Sbjct: 586 FWSPLLEKYDYQGIFHIKTRAKTMQSKDSKKVDGCCIFFKKSKFKLLFKEAMDFSGTWMK 645

Query: 206 ----KETSSDIPPRTRTNNTGLILSLKFSDKILSTLPKNXXXXXXXXXXXHLFWHPFGTY 261
               + T   +      +N  L L L+      S                HL W P    
Sbjct: 646 HKKFQRTEDYLNRAMNKDNVALYLKLQSLTSGESVW----------VVTTHLHWDPKFND 695

Query: 262 ERTRQCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNSQPFDSPYLSMTS 317
            +T Q  +LL+ M+  +   N  Q+    ++       CGD NS  FDS    + S
Sbjct: 696 VKTFQVGILLDHMEALLKEENPKQDVKKANV-----VICGDLNSY-FDSAVYELLS 745

>ACR277C Chr3 complement(857936..859072) [1137 bp, 378 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YOL042W
           (NGL1)
          Length = 378

 Score = 52.4 bits (124), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 59/263 (22%), Positives = 110/263 (41%), Gaps = 49/263 (18%)

Query: 82  QFIKRPMLHLHQDEPVTGFN----FTLMTYNCLAQALIRRKLFPDSGEAVK-WFRRSKVL 136
           + I R +L ++      G      F L+TYN L+   +  +++    E  K W  R K+L
Sbjct: 18  RMINRQLLPVYSGSASAGCRSERRFNLLTYNMLSPYYMWPQVYTYVPEPFKKWEYRHKLL 77

Query: 137 LYE-FQHYNSDVICLQEIDHIQYQAFWKVEFE-KLGYESQF---------HRIASKNHGV 185
            YE F  Y++D++CLQE+    Y+ FW+ + + ++ +ESQ+          R   +  GV
Sbjct: 78  EYELFHKYHADILCLQELTGKDYEKFWRKQMKRRMNFESQYAQKPPPAYWKRSQEEMDGV 137

Query: 186 AIVWKREMFK--MTDRMLIDFDKETSSDIPPRTR----------TNNTGLILSLKFSDKI 233
              +  + F+   TD   +++  +T   + P  +          T+ TG ++  +    +
Sbjct: 138 GTFYNADKFEHVATD---LEYLSDTLGVLTPTEKEWMAQTQVEVTDATGHVVEKQSLKTV 194

Query: 234 LS---------TLPKNXXXXXXXXXXXHLFWHPFGTYERTR--QCYVLLNKMKEFMHRVN 282
           L+         TL               L+W     Y+  +  QC++++ ++K  + R  
Sbjct: 195 LTQRNQVCLFVTLLHKPTGSLFVVVNTQLYWK----YDEVKLAQCFIIMRRLKAIVKR-- 248

Query: 283 VLQNGNDGDLSHWVPFFCGDFNS 305
            L    D   S+      GD NS
Sbjct: 249 -LLTRKDTSYSNIKVLLSGDLNS 270

>KNAG0L00550 Chr12 (84534..85679) [1146 bp, 381 aa] {ON} Anc_7.90
           YOL042W
          Length = 381

 Score = 48.5 bits (114), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 58/236 (24%), Positives = 97/236 (41%), Gaps = 38/236 (16%)

Query: 102 FTLMTYNCLAQALIRRKLFPDSGEAVK-WFRRSKVLLYEF-QHYNSDVICLQEIDHIQYQ 159
           FTL+TYN L+ A +  +++    E  K W  R  +L  E    Y +D++C+QE+    YQ
Sbjct: 39  FTLLTYNILSPAYMWPQVYTYVPEQCKQWEFRHDLLEQELLGKYKADIMCIQEMTKRDYQ 98

Query: 160 AFWK-VEFEKLGYESQF---------HRIASKNHGVAIVWKREMFKMT-------DRMLI 202
            FW  +   K    S+F          R   +  GVAI + R+MF          ++ML 
Sbjct: 99  QFWSPIASGKCDMGSEFISKTAPKYWKREPDELDGVAIFYNRKMFDFVSSKGIYLNQMLD 158

Query: 203 DFD---------KETSSDIPPRTRTNNTGLILSLKFSDKI--LSTLPKNXXXXXXXXXXX 251
            F+         K+          T  T L+  LK  +++    +L              
Sbjct: 159 AFNDHELEYLGQKKLGLTDGAGNPTGETNLLNFLKLKNQVSLFVSLQHKSTGMYFVVINT 218

Query: 252 HLFWHPFGTYERTR--QCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNS 305
           HL+W     Y+  +  QC V++ ++ + +   ++L++  D         F GD NS
Sbjct: 219 HLYWK----YDEVKLTQCMVIMRELSQIID--DLLKDVPDVTKEKVKIIFTGDLNS 268

>Kpol_1044.6 s1044 (12595..13362,13366..13545,13548..13718) [1119
           bp, 372 aa] {ON}
           (12595..13362,13366..13545,13548..13718) [1119 nt, 373
           aa]
          Length = 372

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 65/255 (25%), Positives = 99/255 (38%), Gaps = 67/255 (26%)

Query: 97  VTGFNFTLMTYNCLAQALIRRKLF---PDSGEAVKWFRRSKVLLYEF-QHYNSDVICLQE 152
           + G  FTL+TYN L+   +  +++   PD  E   W  R  +L  E  + Y +DV+CLQE
Sbjct: 32  IPGHKFTLLTYNMLSPYYMWPQVYNYVPD--EFKDWKYRHMLLEDELLRTYKADVMCLQE 89

Query: 153 IDHIQYQAFWKVEFEK-LGYESQF---------HRIASKNHGVAIVW------------- 189
           +    Y ++WK  F K L Y S+F          +   +  G  I +             
Sbjct: 90  LTWEDYLSYWKPVFGKQLNYGSKFVAKTPPKYWDKTEQQMDGEGIFFNLDKFEYISSTRL 149

Query: 190 -----------------KREMFKMTDRMLIDFDKETSSDIPPRTRTNNTGLILSLKFSDK 232
                            KR++ K+TD       +ET  +I      N   L +SLK  + 
Sbjct: 150 FLNDVVNTFEEHELNYMKRKIVKLTDGAGNPVGEETLYEI--LKNRNQVCLFVSLKHKE- 206

Query: 233 ILSTLPKNXXXXXXXXXXXHLFWHPFGTYERTR--QCYVLLNKMKEFMHRVNVLQNGNDG 290
                              HL+W     Y+  +  QC +++ K+ +    +N L  G D 
Sbjct: 207 ---------TNNVFVVINTHLYW----KYDEVKLTQCMIIMRKLSQI---INELLIGADP 250

Query: 291 DLSHWVPFFCGDFNS 305
            LS  V F  GD NS
Sbjct: 251 SLSKDVIFITGDLNS 265

>Kwal_26.7170 s26 (247186..248304) [1119 bp, 372 aa] {ON} YOL042W
           (NGL1) - DNase/RNase (putative); CCR4 C-terminal
           homolog, homology to drosophila Angel gene [contig 47]
           FULL
          Length = 372

 Score = 47.0 bits (110), Expect = 6e-05,   Method: Compositional matrix adjust.
 Identities = 61/245 (24%), Positives = 94/245 (38%), Gaps = 43/245 (17%)

Query: 101 NFTLMTYNCLAQALIRRKLFPDSGEAVK-WFRRSKVLLYEFQH-YNSDVICLQEIDHIQY 158
            FT MTYN L+   +  +++    E  K W  R ++L  E  + Y +D++C+QE+    Y
Sbjct: 33  TFTFMTYNMLSPYYMWPQVYTYVPEKYKEWSYRHRLLEREILNLYRADIMCVQELTCKDY 92

Query: 159 QAFWKVEFE-KLGYESQF---------HRIASKNHGVAIVWKREMFKMTDRMLI------ 202
             FWK  F+ K+ Y S F          R   +  GV I +  + F+      I      
Sbjct: 93  DGFWKGHFKSKMNYGSSFISKTPPKYWQRPPDEMDGVGIFYNLDKFEHISTTSIYLNDLI 152

Query: 203 ------DFDKETSSDIPPRTRTNNTGL---------ILSLKFSDKILSTLPKNXXXXXXX 247
                 + +   S+ I   T TN  G          +L  +    +  +L          
Sbjct: 153 GLFNISELNYLKSTII---TLTNGAGEPVDKDSLLNVLHGRNQVSLFVSLMHKETRTLFV 209

Query: 248 XXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDG-DLSHWVPFFCGDFNSQ 306
               HL+W     Y+  + C   L  M++    +  L  G +G   S     F GD NS 
Sbjct: 210 VINTHLYW----KYDEVKLCQC-LTIMRKLHRVIKSLLMGREGVTYSKVKILFAGDLNSA 264

Query: 307 PFDSP 311
           P DSP
Sbjct: 265 P-DSP 268

>KLTH0D02574g Chr4 (257847..258953) [1107 bp, 368 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 368

 Score = 46.2 bits (108), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 61/246 (24%), Positives = 97/246 (39%), Gaps = 37/246 (15%)

Query: 97  VTGFNFTLMTYNCLAQALIRRKLFPDSGEAVK-WFRRSKVLLYEFQH-YNSDVICLQEID 154
           V+   FTLMTYN L+   +  +++    E  K W  R ++L  E  + Y +D++C+QE+ 
Sbjct: 25  VSRSTFTLMTYNMLSPYYMWPQVYTYVPEKYKDWSYRHRLLEREILNLYRADIMCVQELT 84

Query: 155 HIQYQAFWKVEFE-KLGYESQF---------HRIASKNHGVAIVWKREMFK--------M 196
              Y+ FWK  F+ K+ Y S +          R   +  GV I +    F+        +
Sbjct: 85  CKDYEGFWKNHFKTKMNYGSSYIAKTPPKYWKRPEDEMDGVGIFYNLNKFEHISTSSIYL 144

Query: 197 TDRM-LIDFDKETSSDIPPRTRTNNTGL---------ILSLKFSDKILSTLPKNXXXXXX 246
            D + L +  +         T TN  G          +L  +    +  +L         
Sbjct: 145 NDLIGLFNISELNYLKSTIITLTNGAGEPIDKDSLLNVLHGRNQVSLFVSLLHKETRTLF 204

Query: 247 XXXXXHLFWHPFGTYERTRQCYVLLNKMKEFMHRVNVLQNGNDG-DLSHWVPFFCGDFNS 305
                HL+W     Y+  + C   L  M++    +  L  G +G   S     F GD NS
Sbjct: 205 VVVNTHLYW----KYDEVKLCQC-LTIMRKLHRVIKSLLMGMEGVTYSKVKILFAGDLNS 259

Query: 306 QPFDSP 311
            P DSP
Sbjct: 260 AP-DSP 264

>TPHA0L00530 Chr12 (91623..92798) [1176 bp, 391 aa] {ON} Anc_7.90
           YOL042W
          Length = 391

 Score = 45.8 bits (107), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 55/240 (22%), Positives = 103/240 (42%), Gaps = 40/240 (16%)

Query: 102 FTLMTYNCLAQALIRRKLFPDSGEAVK-WFRRSKVLLYEF-QHYNSDVICLQEIDHIQYQ 159
           FT++TYN L+   +  +++    +  K W  R K+L +E  Q Y +D++CLQE+    Y 
Sbjct: 48  FTMLTYNMLSPHYMWPQVYTYVPDQYKDWKYRHKLLEFELMQKYKADIMCLQELTWEDYI 107

Query: 160 AFWKVEF-EKLGYESQF---------HRIASKNHGVAIVWKREMFKMTDRML-------- 201
           ++WK +  EK+ Y S+F          +   +  G  I + +E F+              
Sbjct: 108 SYWKPKCNEKMNYGSKFVAKTPPAYWEKTKQEMDGEGIFFNQEKFEYISSTKLFLNDVVG 167

Query: 202 ------IDFDKE---TSSDIPPR-TRTNNTGLILSLKFSDKILSTLPKNXXXXXXXXXXX 251
                 I++ K+   T +D   + T TNN   + + +    +  +L              
Sbjct: 168 TFEEHEIEYMKKKIVTLTDGAGKPTGTNNLFTVATTRNQVCLFVSLRHKATNTVFVVINT 227

Query: 252 HLFWHPFGTYERTR--QCYVLLNKMKEFMHRVNVLQNG---NDGDLSHWVP-FFCGDFNS 305
           HL+W     Y+  +  QC +++ K+   ++ + +  N    ++  +S  V   F GD NS
Sbjct: 228 HLYWK----YDEVKLTQCMIIMRKLSHIINELLIGSNAKIVDNSTISKDVKIIFSGDLNS 283

>CAGL0F01001g Chr6 (106796..107875) [1080 bp, 359 aa] {ON} highly
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042w
          Length = 359

 Score = 45.8 bits (107), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 55/237 (23%), Positives = 93/237 (39%), Gaps = 40/237 (16%)

Query: 102 FTLMTYNCLAQALIRRKLFPDSGEAVK-WFRRSKVLLYEF-QHYNSDVICLQEIDHIQYQ 159
           FTL++YN L+ + +  +++    E  K W  R K+L  E    Y +D++CLQE+    Y 
Sbjct: 22  FTLLSYNLLSPSYMWPQVYTYVPEKYKDWNYRHKLLEQELLDKYRADIMCLQELTSEDYS 81

Query: 160 AFWKVEFE-KLGYESQF---------HRIASKNHGVAIVWKREMFKMTDRMLIDFDKETS 209
            FWK   +  + Y S +          R   +  GV I +  + F+   R  I  ++   
Sbjct: 82  NFWKKALQTNMNYGSNYIAKTPPQYWKRPVEQMDGVGIFYNLDKFEFISRSGIYLNQLLG 141

Query: 210 S---------DIPPRTRTNNTG---------LILSLKFSDKILSTLPKNXXXXXXXXXXX 251
                     +  P T T+  G          IL  K    +  +L              
Sbjct: 142 VFSNNELEYLEKKPVTLTDGAGNQVGEQSLLQILKSKNQVALFVSLKHKETGNVFVVINT 201

Query: 252 HLFWHPFGTYERTR--QCYVLLNKMKEFMHRVNV-LQNGNDGDLSHWVPFFCGDFNS 305
           HL+W     Y+  +  QC +++ ++   + +  V L+N  D  +      F GD NS
Sbjct: 202 HLYW----KYDDVKLTQCMIIMRELARIIEKHLVGLENVTDDKIK---ILFTGDLNS 251

>SAKL0B09768g Chr2 complement(823496..824602) [1107 bp, 368 aa] {ON}
           similar to uniprot|Q08213 Saccharomyces cerevisiae
           YOL042W
          Length = 368

 Score = 45.1 bits (105), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 34/114 (29%), Positives = 54/114 (47%), Gaps = 12/114 (10%)

Query: 94  DEPVTGFNFTLMTYNCLAQALIRRKLFPDSGEAVK-WFRRSKVLLYE-FQHYNSDVICLQ 151
           ++P     FTL+TYN L+   +  +++    E  K W  R ++L  E F+ Y +D++CLQ
Sbjct: 22  NKPFFNNKFTLLTYNMLSPCYMWPQVYTYVPEKFKEWGYRHRLLEDELFKTYKADIMCLQ 81

Query: 152 EIDHIQYQAFWKVEF-EKLGYESQF---------HRIASKNHGVAIVWKREMFK 195
           E+    Y  FW  +  E L Y S F          R   +  GV I +  + F+
Sbjct: 82  ELTTKDYHNFWDKQMKETLNYGSNFISKTPPKYWKRPTDEMDGVGIFYNLDKFE 135

>ZYRO0D05588g Chr4 (482402..483472) [1071 bp, 356 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 356

 Score = 44.7 bits (104), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 33/107 (30%), Positives = 53/107 (49%), Gaps = 16/107 (14%)

Query: 102 FTLMTYNCLAQALIRRKLF---PDSGEAVKWFRRSKVLLYE-FQHYNSDVICLQEIDHIQ 157
            +++TYN L+   +  +++   PD  E  KW  R K+L  E    Y +D++CLQE+  + 
Sbjct: 22  LSVLTYNMLSPYYMWPQVYTYVPD--EYKKWNYRHKLLQKEILGLYRADIMCLQELTSLD 79

Query: 158 YQAFW-KVEFEKLGYESQF---------HRIASKNHGVAIVWKREMF 194
           YQ +W KV  EK  Y S++          R  S+  GV + +    F
Sbjct: 80  YQQYWNKVLMEKYNYGSKYIAKPPPKYWERSLSEMDGVGVFYDLNKF 126

>KLLA0F07733g Chr6 (731317..732432) [1116 bp, 371 aa] {ON} similar
           to uniprot|Q08213 Saccharomyces cerevisiae YOL042W
          Length = 371

 Score = 44.3 bits (103), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 27/77 (35%), Positives = 43/77 (55%), Gaps = 3/77 (3%)

Query: 102 FTLMTYNCLAQALIRRKLFPDSGEAVK-WFRRSKVLLYE-FQHYNSDVICLQEIDHIQYQ 159
           FT++TYN L+   +  +++    +  K W  R ++L +E F  Y SD+ICLQE+    Y 
Sbjct: 34  FTMLTYNMLSPYYMWPQVYTYVKDEYKDWDYRHRLLEHELFYKYKSDIICLQELTTNDYN 93

Query: 160 AFWKVE-FEKLGYESQF 175
            FWK +   ++ Y S F
Sbjct: 94  EFWKKQMMNRMNYGSNF 110

>TBLA0E02260 Chr5 complement(556705..557871) [1167 bp, 388 aa] {ON}
           Anc_7.90 YOL042W
          Length = 388

 Score = 42.7 bits (99), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 59/257 (22%), Positives = 102/257 (39%), Gaps = 38/257 (14%)

Query: 87  PMLHLHQDEPVT-GFNFTLMTYNCLAQALIRRKLFPDSGEAVK-WFRRSKVLLYE-FQHY 143
           P+   HQ  P      FT ++YN L+   +  +++    +  K W  R  +L  E    Y
Sbjct: 28  PIQQPHQTLPAAKNPTFTFLSYNMLSPHYMWPQVYTYVPQEYKDWKYRHNLLEKEILDKY 87

Query: 144 NSDVICLQEIDHIQYQAFWKVEFEK-LGYESQFHRIASKNH---------GVAIVWKREM 193
            SD++C+QE+  I Y +FW+    K   Y S+F      N+         GV I +  +M
Sbjct: 88  RSDIMCVQELTTIDYYSFWRDSLRKGFNYGSRFIAKNPPNYWTKSLVEMDGVGIFYNLDM 147

Query: 194 FKMTDRMLID-------FDKETSSDIPPR--TRTNNTGLI--------LSLKFSDKILST 236
           F       I+       FD++    +  +  T  N  G +        L+L  +   L  
Sbjct: 148 FDYIGSRSINLNDLASTFDRKELDYMAAKEITILNGNGDVTGKESLYELALSKNQVCLFV 207

Query: 237 LPKNXXXXXX-XXXXXHLFWHPFGTYERTR--QCYVLLNKMKEFMHRVNVLQNGNDGDLS 293
           + ++            HL+W     YE  +  QC +++ K+ + ++ +       D + +
Sbjct: 208 MVEHKISKDVFVIINTHLYW----KYEEVKLTQCMIIMRKLAKIVNELLFNAESRDMNYN 263

Query: 294 HWVPFFCGDFNSQPFDS 310
                F GD N   FDS
Sbjct: 264 KVKILFSGDLNDG-FDS 279

>Ecym_2636 Chr2 complement(1225559..1226662) [1104 bp, 367 aa] {ON}
           similar to Ashbya gossypii ACR277C
          Length = 367

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 43/77 (55%), Gaps = 3/77 (3%)

Query: 102 FTLMTYNCLAQALIRRKLFPDSGEAVK-WFRRSKVLLYE-FQHYNSDVICLQEIDHIQYQ 159
            +++TYN L+   +  +++    +  K W  R K+L YE F  + +D++CLQE+    Y 
Sbjct: 30  LSVLTYNMLSPYYMWPQVYTYVPDKFKDWNYRHKLLEYELFYKHKADILCLQELTTEDYN 89

Query: 160 AFWKVEFE-KLGYESQF 175
            FW+ + + +L Y S F
Sbjct: 90  QFWRKQMKRRLSYGSNF 106

>NCAS0I00500 Chr9 (81492..82661) [1170 bp, 389 aa] {ON} Anc_7.90
           YOL042W
          Length = 389

 Score = 39.7 bits (91), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 31/95 (32%), Positives = 50/95 (52%), Gaps = 8/95 (8%)

Query: 102 FTLMTYNCLAQALIRRKLFPDSGEAVK-WFRRSKVLLYEF-QHYNSDVICLQEIDHIQYQ 159
           FTL+TYN L+ + +  +++    +  K W  R K+L  E    Y +D++CLQE+    Y 
Sbjct: 30  FTLLTYNMLSPSYMWPQVYTYVPDPYKDWQYRHKLLESELLGSYKADIMCLQEMTSRDYN 89

Query: 160 AFWK-VEFEKLGYESQFHRIASKNHGVAIVWKREM 193
             WK +    +GY S+F  IA       + W+RE+
Sbjct: 90  ENWKRLLGSGIGYGSKF--IAKSP---PLYWEREV 119

>TDEL0H03600 Chr8 complement(593714..594814) [1101 bp, 366 aa] {ON}
           Anc_7.90 YOL042W
          Length = 366

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 59/248 (23%), Positives = 95/248 (38%), Gaps = 62/248 (25%)

Query: 102 FTLMTYNCLAQALIRRKLF---PDSGEAVKWFRRSKVLLYE-FQHYNSDVICLQEIDHIQ 157
           FT MTYN L+   +  +++   PD  E   W  R K+L  E    Y +D++CLQE+    
Sbjct: 29  FTFMTYNMLSPHYMWPQVYTYVPD--EYKDWNYRHKLLEKEILNSYRADIMCLQELTASD 86

Query: 158 YQAFWKVEFEK-LGYESQF---------HRIASKNHGVAIVWKREMFKMTDRMLI----- 202
           Y  +W+   ++   Y S+F          + A    GV I +    F       I     
Sbjct: 87  YHQYWEEVIDRDFHYGSRFIAKPPPQYWQKDAKDVDGVGIFYNLNKFDYISSTSIHLNDL 146

Query: 203 --DFDKETSSDI-------------PPRTRT--------NNTGLILSLKFSDKILSTLPK 239
              FD +  S +             P   +T        N  GL ++LK  D     +  
Sbjct: 147 IGSFDLDELSYLKSKQVKLTDGAGNPKGEKTLLEILKSRNQVGLFVALKHKDTNTIFVVI 206

Query: 240 NXXXXXXXXXXXHLFWHPFGTYERTR--QCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVP 297
           N           HL+W     Y+  +  QC +++ K+ + +  + V ++G   +    V 
Sbjct: 207 N----------THLYW----KYDEVKLTQCLIIMRKLAKIIRDLLVGEHGTTYNKMKVV- 251

Query: 298 FFCGDFNS 305
            F GD NS
Sbjct: 252 -FAGDLNS 258

>Smik_15.125 Chr15 (215988..217079) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 39.3 bits (90), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 21/64 (32%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 102 FTLMTYNCLAQALIRRKLFPDSGEAVK-WFRRSKVLLYEFQH-YNSDVICLQEIDHIQYQ 159
           FTL+TYN L+ + +  +++    E  K W  R K+L  E  + + +D++CLQE+    Y+
Sbjct: 27  FTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHKLLERELLNTFKADIMCLQEMTARDYE 86

Query: 160 AFWK 163
            +W+
Sbjct: 87  DYWR 90

>Skud_15.115 Chr15 (208773..209864) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 38.9 bits (89), Expect = 0.023,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 102 FTLMTYNCLAQALIRRKLFPDSGEAVK-WFRRSKVLLYEF-QHYNSDVICLQEIDHIQYQ 159
           FTL+TYN L+ + +  +++    E  K W  R K+L  E    + +D++CLQE+    Y+
Sbjct: 27  FTLLTYNMLSPSYMWPQVYTYVAERYKSWSYRHKLLEKELLNSFKADIMCLQEMTRRDYE 86

Query: 160 AFW 162
            +W
Sbjct: 87  DYW 89

>NDAI0A08530 Chr1 complement(1963920..1965017) [1098 bp, 365 aa]
           {ON} Anc_7.90 YOL042W
          Length = 365

 Score = 38.1 bits (87), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 50/236 (21%), Positives = 97/236 (41%), Gaps = 41/236 (17%)

Query: 102 FTLMTYNCLAQALIRRKLFPDSGEAVK-WFRRSKVLLYEF-QHYNSDVICLQEIDHIQYQ 159
           FT+++YN L+ + +  +++    +  K W  R  +L  E    Y +D++C+QE+    Y 
Sbjct: 30  FTVLSYNMLSPSYMWPQVYTYVPDQYKDWNYRHTLLELELLDKYKADIMCVQEMTKRDYI 89

Query: 160 AFWKVEF-EKLGYESQFHRIASKNH---------GVAIVWKREMFKMT-------DRMLI 202
            +W+++    +GY S+F   +   +         GVAI +  + F          +  L 
Sbjct: 90  DYWQLKLGTTIGYGSKFIAKSPPKYWERHLLDLDGVAIFYNLQKFDFISSSGIYLNEFLD 149

Query: 203 DFDKETSSDIPPRT--RTNNTGL---------ILSLKFSDKILSTLPKNXXXXXXXXXXX 251
            F+ E    +  +T   T+  G+         ILS+K    +   L              
Sbjct: 150 VFNPEELQYLKEKTLELTDGAGIKIDEKTLFEILSVKNQVSLFVCLKHKETGQVFIIINT 209

Query: 252 HLFWHPFGTYERTR--QCYVLLNKMKEFMHRVNVLQNGNDGDLSHWVPFFCGDFNS 305
           HL+W     Y+  +  QC +++ ++ + +    +LQ+     +      F GD NS
Sbjct: 210 HLYW----KYDEVKLSQCIIIMRELSKIIDE--LLQDVRHSKVK---IIFAGDLNS 256

>Suva_15.127 Chr15 (222266..223357) [1092 bp, 363 aa] {ON} YOL042W
           (REAL)
          Length = 363

 Score = 37.7 bits (86), Expect = 0.055,   Method: Compositional matrix adjust.
 Identities = 21/63 (33%), Positives = 36/63 (57%), Gaps = 2/63 (3%)

Query: 102 FTLMTYNCLAQALIRRKLFPDSGEAVK-WFRRSKVLLYEF-QHYNSDVICLQEIDHIQYQ 159
           FTL+TYN L+ + +  +++    E  K W  R K+L  E    + +D++CLQE+    Y+
Sbjct: 27  FTLLTYNMLSPSYMWPQVYTYVAERYKNWNYRHKLLEKELLTTFKADIMCLQEMTTRDYE 86

Query: 160 AFW 162
            +W
Sbjct: 87  NYW 89

>YOL042W Chr15 (249825..250916) [1092 bp, 363 aa] {ON}  NGL1Putative
           endonuclease, has a domain similar to a
           magnesium-dependent endonuclease motif in mRNA
           deadenylase Ccr4p; the authentic, non-tagged protein is
           detected in highly purified mitochondria in
           high-throughput studies
          Length = 363

 Score = 37.4 bits (85), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 20/63 (31%), Positives = 37/63 (58%), Gaps = 2/63 (3%)

Query: 102 FTLMTYNCLAQALIRRKLFPDSGEAVK-WFRRSKVLLYEFQH-YNSDVICLQEIDHIQYQ 159
           FTL+TYN L+ + +  +++    E  K W  R ++L  E  + + +D++CLQE+    Y+
Sbjct: 27  FTLLTYNMLSPSYMWPQVYTYVAEPYKNWSYRHRLLEKELLNTFKADIMCLQEMTARDYE 86

Query: 160 AFW 162
            +W
Sbjct: 87  DYW 89

>NDAI0E02105 Chr5 complement(429293..430519) [1227 bp, 408 aa] {ON}
          Length = 408

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 13/32 (40%), Positives = 22/32 (68%), Gaps = 2/32 (6%)

Query: 156 IQYQAFWKVEFEKLGYESQFHRIASKNHGVAI 187
           ++ +A+W+V+FE +G   QF  +  +NHG AI
Sbjct: 267 VRRKAYWEVKFEGIGLGDQFAEL--ENHGAAI 296

>Smik_16.191 Chr16 (342583..344979) [2397 bp, 798 aa] {ON} YPL045W
           (REAL)
          Length = 798

 Score = 31.6 bits (70), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 18/73 (24%), Positives = 39/73 (53%), Gaps = 5/73 (6%)

Query: 144 NSDVICLQEIDHIQYQAFWKVEFEKLGYESQFHRIASKNHGVAIVW-----KREMFKMTD 198
           N+D+I L ++DH+   +       KL  +S +H++   + G   ++     K ++FK   
Sbjct: 161 NNDIIILLDVDHVYEVSTLNGTLLKLIADSSWHKVTISSRGFICLYNMKYNKLQIFKDPA 220

Query: 199 RMLIDFDKETSSD 211
           R+L++ D +++ D
Sbjct: 221 RILMEHDLDSTPD 233

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.320    0.136    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 51,449,985
Number of extensions: 2092808
Number of successful extensions: 4543
Number of sequences better than 10.0: 79
Number of HSP's gapped: 4472
Number of HSP's successfully gapped: 79
Length of query: 503
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 389
Effective length of database: 40,409,475
Effective search space: 15719285775
Effective search space used: 15719285775
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 68 (30.8 bits)