Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_2002.91.6ON33831014160.0
SAKL0C00484g1.6ON33931113020.0
TPHA0E040001.6ON31631012990.0
NDAI0A001501.6ON31731012911e-180
CAGL0B00352g1.6ON33731012921e-179
NCAS0B091001.6ON32731012881e-179
Smik_3.151.6ON31631112751e-177
Kwal_33.130111.6ON33431112761e-177
YCL059C (KRR1)1.6ON31631112731e-177
TDEL0C069601.6ON35031012691e-176
Ecym_10091.6ON33631012651e-175
Suva_3.1531.6ON31631112631e-175
Skud_3.41.6ON31631112621e-175
KNAG0C002301.6ON34931012641e-175
KLLA0C00506g1.6ON33031012611e-175
KLTH0F00506g1.6ON33231112441e-172
KAFR0D001501.6ON34430812321e-170
TBLA0A049401.6ON31631012271e-170
ZYRO0F18458g1.6ON31431012151e-168
AFR744W1.6ON34331011981e-165
SAKL0G03740g5.482ON2661461022e-04
Ecym_45525.482ON2711461032e-04
Kpol_543.135.482ON2681461022e-04
NCAS0A119605.482ON2701931013e-04
Kwal_47.188645.482ON2711461014e-04
KLTH0G02574g5.482ON2711461004e-04
CAGL0K09460g5.482ON261146996e-04
KLLA0C06446g5.482ON274146988e-04
TPHA0J028205.482ON268146970.001
ZYRO0D11440g5.482ON269146960.001
TDEL0A034605.482ON272146960.002
Suva_8.1975.482ON274148950.002
KNAG0C046105.482ON277176950.002
NDAI0A043105.482ON274146930.003
Skud_15.3105.482ON276148910.007
YOR145C (PNO1)5.482ON274148900.009
KAFR0E036005.482ON276146890.011
Smik_15.3265.482ON274148890.011
AAR002W1.420ON178166860.014
TBLA0D018905.482ON271146870.018
TBLA0H018305.375ON40664712.1
ZYRO0E04356g1.420ON186104702.1
KAFR0B030308.309ON46754712.2
AGL183C8.309ON50724712.7
TBLA0D00760na 1ON53965703.3
KLTH0E14014g8.798ON48699693.9
YJR060W (CBF1)1.508ON35149694.1
Smik_10.3501.508ON35049684.5
KNAG0G023508.309ON49724685.1
KLLA0D02398g1.290ON120583686.9
Suva_12.1491.508ON35749677.0
Skud_10.2841.508ON35349668.1
Suva_10.5404.301ON71378678.8
TBLA0D007708.783ON54064669.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_2002.9
         (338 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON...   550   0.0  
SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON...   506   0.0  
TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6 ...   504   0.0  
NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON} ...   501   e-180
CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON...   502   e-179
NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1....   500   e-179
Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON} YC...   495   e-177
Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON...   496   e-177
YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}  KRR...   494   e-177
TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1...   493   e-176
Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON} s...   491   e-175
Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}...   491   e-175
Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON} YCL...   490   e-175
KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}...   491   e-175
KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}...   490   e-175
KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}...   483   e-172
KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}...   479   e-170
TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {...   477   e-170
ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highl...   472   e-168
AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic ...   466   e-165
SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {O...    44   2e-04
Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar ...    44   2e-04
Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON} ...    44   2e-04
NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {...    44   3e-04
Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR14...    44   4e-04
KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {O...    43   4e-04
CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {...    43   6e-04
KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {O...    42   8e-04
TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {O...    42   0.001
ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {O...    42   0.001
TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON...    42   0.002
Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}...    41   0.002
KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.48...    41   0.002
NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.48...    40   0.003
Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {O...    40   0.007
YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}  ...    39   0.009
KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.48...    39   0.011
Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {O...    39   0.011
AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic hom...    38   0.014
TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.48...    38   0.018
TBLA0H01830 Chr8 complement(433992..435212) [1221 bp, 406 aa] {O...    32   2.1  
ZYRO0E04356g Chr5 complement(332059..332619) [561 bp, 186 aa] {O...    32   2.1  
KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.3...    32   2.2  
AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON} S...    32   2.7  
TBLA0D00760 Chr4 (201951..203570) [1620 bp, 539 aa] {ON}               32   3.3  
KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} simi...    31   3.9  
YJR060W Chr10 (548759..549814) [1056 bp, 351 aa] {ON}  CBF1Dual ...    31   4.1  
Smik_10.350 Chr10 (537706..538758) [1053 bp, 350 aa] {ON} YJR060...    31   4.5  
KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.3...    31   5.1  
KLLA0D02398g Chr4 complement(202446..206063) [3618 bp, 1205 aa] ...    31   6.9  
Suva_12.149 Chr12 (226538..227611) [1074 bp, 357 aa] {ON} YJR060...    30   7.0  
Skud_10.284 Chr10 (506276..507337) [1062 bp, 353 aa] {ON} YJR060...    30   8.1  
Suva_10.540 Chr10 (933675..935816) [2142 bp, 713 aa] {ON} YLR424...    30   8.8  
TBLA0D00770 Chr4 (204726..206348) [1623 bp, 540 aa] {ON} Anc_8.7...    30   9.6  

>Kpol_2002.9 s2002 complement(17681..18697) [1017 bp, 338 aa] {ON}
           complement(17681..18697) [1017 nt, 339 aa]
          Length = 338

 Score =  550 bits (1416), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/310 (87%), Positives = 270/310 (87%)

Query: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60
           MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV
Sbjct: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60

Query: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120
           TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD
Sbjct: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180

Query: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFXXXXXXXXXXXXX 240
           KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMF             
Sbjct: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFKKRNVARKKAAKP 240

Query: 241 XXXXXXYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVXXXXXXXXXXXXXXXXXXXXXSK 300
                 YTPFPPAQQPRKVDLEIESGEYFLSKKEKEV                     SK
Sbjct: 241 KKEKKVYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVKRLQERREEQSQKQIEKEKERSK 300

Query: 301 DYVAPMEEEY 310
           DYVAPMEEEY
Sbjct: 301 DYVAPMEEEY 310

>SAKL0C00484g Chr3 complement(45059..46078) [1020 bp, 339 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 339

 Score =  506 bits (1302), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 249/311 (80%), Positives = 260/311 (83%), Gaps = 1/311 (0%)

Query: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60
           M STHNKDKPWDT +IDKWK+EEFKPEDNASGLPFAEESSFMTLFPKYRE YLKSVWNDV
Sbjct: 1   MPSTHNKDKPWDTPEIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120
           T+ALDK HIACTLDLVEGSM+VKTTRKT+DP  ILKARDLIKLLARSVPFPQA+KILEDD
Sbjct: 61  TRALDKHHIACTLDLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFXXXX-XXXXXXXX 239
           KE+RRVVEDCMKNVHPIYHIKELMIKRELAKRPELA+EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKA 240

Query: 240 XXXXXXXYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVXXXXXXXXXXXXXXXXXXXXXS 299
                  YTPFPPAQ PRKVDLEIESGEYFLSKKEKEV                     +
Sbjct: 241 KAKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEVKKLQERRQEQAEKQAQKEEERA 300

Query: 300 KDYVAPMEEEY 310
           KDYVAP E EY
Sbjct: 301 KDYVAPEEAEY 311

>TPHA0E04000 Chr5 (838446..839396) [951 bp, 316 aa] {ON} Anc_1.6
           YCL059C
          Length = 316

 Score =  504 bits (1299), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 243/310 (78%), Positives = 262/310 (84%)

Query: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60
           MVSTHNK+KPWDTEDIDKWK+E+FKPEDNASG+PF+EESSFMTLFPKYRE+YLKSVW DV
Sbjct: 1   MVSTHNKEKPWDTEDIDKWKLEDFKPEDNASGMPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120
           TKALDK H+ACTL+LV+GSMTV TTRKT+DPY ILKARDLIKLLARSVPFPQA+KIL+DD
Sbjct: 61  TKALDKHHVACTLNLVDGSMTVSTTRKTYDPYIILKARDLIKLLARSVPFPQAVKILDDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFXXXXXXXXXXXXX 240
           KEIRRVVED M+NVHPIYHIKELMIKRELAK+PELA+EDWSRFLPMF             
Sbjct: 181 KEIRRVVEDAMRNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 241 XXXXXXYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVXXXXXXXXXXXXXXXXXXXXXSK 300
                 YTPFPP+Q PRKVDLEIESGEYFLSKKEKEV                     SK
Sbjct: 241 KREKKVYTPFPPSQLPRKVDLEIESGEYFLSKKEKEVKRLHERRDQQAEKQAEKDIERSK 300

Query: 301 DYVAPMEEEY 310
           +Y+AP EE+Y
Sbjct: 301 NYIAPKEEKY 310

>NDAI0A00150 Chr1 complement(12040..12993) [954 bp, 317 aa] {ON}
           Anc_1.6 YCL059C
          Length = 317

 Score =  501 bits (1291), Expect = e-180,   Method: Compositional matrix adjust.
 Identities = 242/310 (78%), Positives = 259/310 (83%)

Query: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60
           MVSTHN+DKPWDTE+I+KWK+EEFKPEDNASGLPFAEESSFMTLFPKYRE YLKSVWNDV
Sbjct: 1   MVSTHNRDKPWDTEEINKWKIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120
           T+AL+  ++AC LDLVEGSMTVKTTRKT+DP  ILKARDLIKLLARSVPFPQA+KILEDD
Sbjct: 61  TRALNTHNLACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFKGL 180

Query: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCMKN+HPIYHIKELMIKRELAK+PELA+EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 241 XXXXXXYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVXXXXXXXXXXXXXXXXXXXXXSK 300
                 YTPFPPAQ PRKVDLEIESGEYFLSK+EKE+                     +K
Sbjct: 241 KKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLNERREQQAEKQVEKETERNK 300

Query: 301 DYVAPMEEEY 310
           DYVAP E  Y
Sbjct: 301 DYVAPSEPTY 310

>CAGL0B00352g Chr2 complement(22171..23184) [1014 bp, 337 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059c KRR1
          Length = 337

 Score =  502 bits (1292), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 242/310 (78%), Positives = 256/310 (82%)

Query: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60
           MVST+NKDKPWDTEDIDKWK+EEFKPEDN SG PFAEESSFMTLFPKYRE YLKS+WNDV
Sbjct: 1   MVSTYNKDKPWDTEDIDKWKIEEFKPEDNKSGQPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120
           T+ALDK HI CTLDLVEGSMTVKTTRKTFDP  ILKARDLIKLLARSVPFPQA+KIL+DD
Sbjct: 61  TRALDKHHIGCTLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180
           +ACDVIKIGN V NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 IACDVIKIGNTVANKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFXXXXXXXXXXXXX 240
           KEIRRVV DCMKNVHPIYHIKELMIKRELAKRPELA+EDWSRFLPMF             
Sbjct: 181 KEIRRVVLDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPSKV 240

Query: 241 XXXXXXYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVXXXXXXXXXXXXXXXXXXXXXSK 300
                 YTPFPPAQ PRKVDL+IESGEYFLSKKEKE+                      K
Sbjct: 241 KAEKKVYTPFPPAQLPRKVDLQIESGEYFLSKKEKEIKKLHEQREKQAEKQILKDEERRK 300

Query: 301 DYVAPMEEEY 310
           DY+AP E+EY
Sbjct: 301 DYIAPKEDEY 310

>NCAS0B09100 Chr2 (1745144..1746127) [984 bp, 327 aa] {ON} Anc_1.6
           YCL059C
          Length = 327

 Score =  500 bits (1288), Expect = e-179,   Method: Compositional matrix adjust.
 Identities = 240/310 (77%), Positives = 258/310 (83%)

Query: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60
           MVSTHN+DKPWDT D+DKW +EEFKPEDNASGLPFAEESSFMTLFPKYRE YLKSVWNDV
Sbjct: 1   MVSTHNRDKPWDTPDVDKWHIEEFKPEDNASGLPFAEESSFMTLFPKYRETYLKSVWNDV 60

Query: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120
           T+AL+K ++ C LDLVEGSMTVKTTRKTFDP  ILKARDLIKLLARSVPFPQA+KIL+DD
Sbjct: 61  TRALNKHNLGCVLDLVEGSMTVKTTRKTFDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPF+GL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPFQGL 180

Query: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCMKNVHPIYHIKELMIKRELAK+PELA+EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKV 240

Query: 241 XXXXXXYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVXXXXXXXXXXXXXXXXXXXXXSK 300
                 YTPFPPAQ PRKVDLEIESGEYFLSK+EKE+                     +K
Sbjct: 241 RKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEMKKLHERREQQAEKQAEKEVERNK 300

Query: 301 DYVAPMEEEY 310
           +Y+AP EE Y
Sbjct: 301 NYIAPEEETY 310

>Smik_3.15 Chr3 complement(23880..24830) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  495 bits (1275), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 241/311 (77%), Positives = 259/311 (83%), Gaps = 1/311 (0%)

Query: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60
           MVSTHN+DKPWDT+DIDKWK+EEFK EDNASG PFAEESSFMTLFPKYRE YLK++WNDV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120
           T+ALDK +IAC LDLVEGSMTVKTTRKT+DP  ILKARDLIKLLARSVPFPQA+KIL+DD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFXXXXXXXXX-XXX 239
           KE+RRVVEDCMKNVHPIYHIKELMIKRELAKRPELA+EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXXYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVXXXXXXXXXXXXXXXXXXXXXS 299
                  YTPFPPAQ PRKVDLEIESGEYFLSK+EK++                     +
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLSEQKEKQMEREIERQEERA 300

Query: 300 KDYVAPMEEEY 310
           KD++AP EE Y
Sbjct: 301 KDFIAPEEETY 311

>Kwal_33.13011 s33 complement(39946..40950) [1005 bp, 334 aa] {ON}
           YCL059C (KRR1) - involved in cell division and spore
           germination [contig 123] FULL
          Length = 334

 Score =  496 bits (1276), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 240/311 (77%), Positives = 257/311 (82%), Gaps = 1/311 (0%)

Query: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60
           M STHNKDKPWDT DIDKWK+EEFKPEDN SGLPF+EESSFMTLFPKYRE+YLKSVW DV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNTSGLPFSEESSFMTLFPKYREVYLKSVWKDV 60

Query: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120
           T+AL+K  I+C LDLVEGSMTVKTTRKT+DP  ILKARDLIKLLARSVPFPQA+KIL+DD
Sbjct: 61  TRALEKHSISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELL+KCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLSKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFXXXXXXXXX-XXX 239
           KE+RRVVEDCMKNVHPIYHIKELMIKRELAKRP+LA+EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 240 XXXXXXXYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVXXXXXXXXXXXXXXXXXXXXXS 299
                  YTPFPP QQPRKVDL+IESGEYFLSKKEKE                      +
Sbjct: 241 KSKEAKVYTPFPPVQQPRKVDLQIESGEYFLSKKEKEAKKLDERKKEQAEKQIEKDKERA 300

Query: 300 KDYVAPMEEEY 310
           KDYVAP E+EY
Sbjct: 301 KDYVAPSEKEY 311

>YCL059C Chr3 complement(22429..23379) [951 bp, 316 aa] {ON}
           KRR1Essential nucleolar protein required for the
           synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 316

 Score =  494 bits (1273), Expect = e-177,   Method: Compositional matrix adjust.
 Identities = 240/311 (77%), Positives = 259/311 (83%), Gaps = 1/311 (0%)

Query: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60
           MVSTHN+DKPWDT+DIDKWK+EEFK EDNASG PFAEESSFMTLFPKYRE YLK++WNDV
Sbjct: 1   MVSTHNRDKPWDTDDIDKWKIEEFKEEDNASGQPFAEESSFMTLFPKYRESYLKTIWNDV 60

Query: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120
           T+ALDK +IAC LDLVEGSMTVKTTRKT+DP  ILKARDLIKLLARSVPFPQA+KIL+DD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFXXXXXXXXX-XXX 239
           KE+RRVVEDCMKN+HPIYHIKELMIKRELAKRPELA+EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXXYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVXXXXXXXXXXXXXXXXXXXXXS 299
                  YTPFPPAQ PRKVDLEIESGEYFLSK+EK++                     +
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREIERQEERA 300

Query: 300 KDYVAPMEEEY 310
           KD++AP EE Y
Sbjct: 301 KDFIAPEEEAY 311

>TDEL0C06960 Chr3 (1262869..1263921) [1053 bp, 350 aa] {ON} Anc_1.6
           YCL059C
          Length = 350

 Score =  493 bits (1269), Expect = e-176,   Method: Compositional matrix adjust.
 Identities = 238/310 (76%), Positives = 256/310 (82%)

Query: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60
           MVSTHN+DKPWDTEDIDKW+VEEFKPEDNASGLPFAEESSFMTLFPKYRE YLKS+WNDV
Sbjct: 1   MVSTHNRDKPWDTEDIDKWQVEEFKPEDNASGLPFAEESSFMTLFPKYREPYLKSIWNDV 60

Query: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120
           T+AL+  HIAC LDL+EGSMTVKTTRKTFDP  IL+ARDLIKLLARSVPF QA+KILE+D
Sbjct: 61  TRALNAHHIACVLDLMEGSMTVKTTRKTFDPAIILRARDLIKLLARSVPFAQAVKILEED 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 VACDVIKIGNVVANKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVED M+NVHPIY IKELMIKRELAKRPELA+EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDTMRNVHPIYQIKELMIKRELAKRPELAEEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXXYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVXXXXXXXXXXXXXXXXXXXXXSK 300
                 YTPFPPAQQPRK+DLEIESGEYFLSKKEKE+                     SK
Sbjct: 241 RAEKKVYTPFPPAQQPRKIDLEIESGEYFLSKKEKEINKLKERREKQAEKQEEKEEARSK 300

Query: 301 DYVAPMEEEY 310
           DY+AP E+ Y
Sbjct: 301 DYIAPKEDVY 310

>Ecym_1009 Chr1 complement(16963..17973) [1011 bp, 336 aa] {ON}
           similar to Ashbya gossypii AFR744W
          Length = 336

 Score =  491 bits (1265), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 238/310 (76%), Positives = 258/310 (83%), Gaps = 1/310 (0%)

Query: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60
           MVSTHNKDKPWDT DIDKWK+EEFKPEDNASGLPFAEESSFMTLFPKYRE YLKS WNDV
Sbjct: 1   MVSTHNKDKPWDTPDIDKWKIEEFKPEDNASGLPFAEESSFMTLFPKYREAYLKSTWNDV 60

Query: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120
           T+ALDK H+AC L+LVEGSMTVKTTRKT+DP  ILKARDLIKLLARSVPFPQA+KILEDD
Sbjct: 61  TRALDKHHLACELNLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180
           +ACDVIKIGNF +NK+RFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 VACDVIKIGNFSSNKDRFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCMKNVHPIYHIKELMIKRELAK+PELAD+DWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELADQDWSRFLPMF-KKRNIARKKPKK 239

Query: 241 XXXXXXYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVXXXXXXXXXXXXXXXXXXXXXSK 300
                 YTPFPPAQ PRKVDLEIE+GEYFLSK EK++                     ++
Sbjct: 240 IKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKNEKKMKKLEEHRNRQTEKQLEKAKERAE 299

Query: 301 DYVAPMEEEY 310
           DY+AP E+EY
Sbjct: 300 DYIAPDEKEY 309

>Suva_3.153 Chr3 complement(232200..233150) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  491 bits (1263), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 238/311 (76%), Positives = 258/311 (82%), Gaps = 1/311 (0%)

Query: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60
           MVSTHN+DKPWDT+D+DKW +EEFK EDNASG PFAEESSFMTLFPKYRE YLK++WNDV
Sbjct: 1   MVSTHNRDKPWDTDDVDKWTIEEFKEEDNASGQPFAEESSFMTLFPKYRENYLKTIWNDV 60

Query: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120
           T+ALDK +I+C LDLVEGSMTVKTTRKT+DP  ILKARDLIKLLARSVPFPQA+KIL+DD
Sbjct: 61  TRALDKHNISCVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFXXXXXXXXX-XXX 239
           KE+RRVVEDCMKNVHPIYHIKELMIKRELAKRPELA+EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXXYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVXXXXXXXXXXXXXXXXXXXXXS 299
                  YTPFPPAQ PRKVDLEIESGEYFLSK+EK++                     +
Sbjct: 241 RNIEKKVYTPFPPAQLPRKVDLEIESGEYFLSKREKQMKKLNEQKEKQMEREVERQEERA 300

Query: 300 KDYVAPMEEEY 310
           K++VAP EE Y
Sbjct: 301 KNFVAPQEEAY 311

>Skud_3.4 Chr3 complement(10422..11372) [951 bp, 316 aa] {ON}
           YCL059C (REAL)
          Length = 316

 Score =  490 bits (1262), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 238/311 (76%), Positives = 257/311 (82%), Gaps = 1/311 (0%)

Query: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60
           MVSTHN++KPWDT+DIDKWK+EEFK EDN SG PFAEESSFMTLFPKYRE YLK++WNDV
Sbjct: 1   MVSTHNREKPWDTDDIDKWKIEEFKEEDNGSGQPFAEESSFMTLFPKYREGYLKTIWNDV 60

Query: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120
           T+ALDK +IAC LDLVEGSMTVKTTRKT+DP  ILKARDLIKLLARSVPFPQA+KIL+DD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180
           MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFXXXXXXXXX-XXX 239
           KE+RRVVEDCMKN+HPIYHIKELMIKRELAKRPELA+EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 240 XXXXXXXYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVXXXXXXXXXXXXXXXXXXXXXS 299
                  YTPFPPAQ PRKVDLEIESGEYFLSK++K+V                     +
Sbjct: 241 RNVEKKVYTPFPPAQLPRKVDLEIESGEYFLSKRDKQVKKLNEQKEKQMERELERQEERA 300

Query: 300 KDYVAPMEEEY 310
           KD+ AP EE Y
Sbjct: 301 KDFTAPEEESY 311

>KNAG0C00230 Chr3 complement(36795..37844) [1050 bp, 349 aa] {ON}
           Anc_1.6 YCL059C
          Length = 349

 Score =  491 bits (1264), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 238/310 (76%), Positives = 252/310 (81%)

Query: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60
           MVSTHNKDKPWDT+DIDKW +EEFKPEDNASG PFAEESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MVSTHNKDKPWDTDDIDKWHIEEFKPEDNASGQPFAEESSFMTLFPKYRETYLKSVWKDV 60

Query: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120
           TKALD  HIACTLDLVEGSMTVKTTRKT+DP  ILKARDLIKLLARSVPFPQA+KIL++D
Sbjct: 61  TKALDSHHIACTLDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAVKILQED 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180
            ACDVIKIGN VTNKERFVKRRQRLVGP+GNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 TACDVIKIGNIVTNKERFVKRRQRLVGPDGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCM NVHPIYHIKELMIKRELAK+PELA+EDWSRFLPMF             
Sbjct: 181 KELRRVVEDCMHNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXXYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVXXXXXXXXXXXXXXXXXXXXXSK 300
                 YTPFPPAQ PRKVDLEIESGEYFL+KKEK+                       K
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLNKKEKQFKKLEERKEIQAEKQRVKDEERRK 300

Query: 301 DYVAPMEEEY 310
           DY AP E+ Y
Sbjct: 301 DYTAPKEKAY 310

>KLLA0C00506g Chr3 complement(38584..39576) [993 bp, 330 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 330

 Score =  490 bits (1261), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 237/310 (76%), Positives = 257/310 (82%), Gaps = 1/310 (0%)

Query: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60
           MVSTHNKDKPWDT+++DKW +EEFKPEDN SGLPFAEESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MVSTHNKDKPWDTDEVDKWNIEEFKPEDNKSGLPFAEESSFMTLFPKYREAYLKSVWKDV 60

Query: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120
           T++LD  HIAC L+LVEGSMTVKTTRKT+DP  ILKARDLIKLLARSVPFPQA+KILEDD
Sbjct: 61  TRSLDAHHIACELNLVEGSMTVKTTRKTYDPAVILKARDLIKLLARSVPFPQAVKILEDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180
           +ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 VACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSVMGPYKGL 180

Query: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCMKNVHPIYHIKELMIKRELAK+PELA+EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELAKKPELAEEDWSRFLPMF-KKRNVARKKPKK 239

Query: 241 XXXXXXYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVXXXXXXXXXXXXXXXXXXXXXSK 300
                 YTPFPPAQ PRKVDLEIESGEYFLSK+EKEV                     +K
Sbjct: 240 IKEKKIYTPFPPAQLPRKVDLEIESGEYFLSKREKEVKKLHERREQQAAKHAEKESERAK 299

Query: 301 DYVAPMEEEY 310
           D++AP E +Y
Sbjct: 300 DFIAPKETDY 309

>KLTH0F00506g Chr6 complement(40222..41220) [999 bp, 332 aa] {ON}
           highly similar to uniprot|P25586 Saccharomyces
           cerevisiae YCL059C KRR1 Essential nucleolar protein
           required for the synthesis of 18S rRNA and for the
           assembly of 40S ribosomal subunit
          Length = 332

 Score =  483 bits (1244), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 238/311 (76%), Positives = 258/311 (82%), Gaps = 1/311 (0%)

Query: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60
           M STHNKDKPWDT DIDKWK+EEFKPEDN SG+PFAEESSFMTLFPKYRE YLKSVWNDV
Sbjct: 1   MPSTHNKDKPWDTPDIDKWKIEEFKPEDNVSGMPFAEESSFMTLFPKYREAYLKSVWNDV 60

Query: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120
           T+ALDK +IAC LDLVEGSMTVKTTR+T+DP  ILKARDLIKLLARSVPFPQA+KIL+DD
Sbjct: 61  TRALDKHNIACVLDLVEGSMTVKTTRRTYDPAIILKARDLIKLLARSVPFPQAVKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180
            ACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 TACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFXXXXXXXXX-XXX 239
           KE+RRVVEDCM+N+HPIYHIKELMIKRELAKRP+LA+EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPDLAEEDWSRFLPMFKKRNVARKKPKNI 240

Query: 240 XXXXXXXYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVXXXXXXXXXXXXXXXXXXXXXS 299
                  YTPFPPAQQPRK+DL+IESGEYFL+KKEKE                      +
Sbjct: 241 KPKENKVYTPFPPAQQPRKIDLQIESGEYFLTKKEKEAKKLEERKREQAEKQVEKNKERA 300

Query: 300 KDYVAPMEEEY 310
           KDYVAP+E+ Y
Sbjct: 301 KDYVAPIEKGY 311

>KAFR0D00150 Chr4 complement(16573..17607) [1035 bp, 344 aa] {ON}
           Anc_1.6 YCL059C
          Length = 344

 Score =  479 bits (1232), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 243/308 (78%), Positives = 255/308 (82%)

Query: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60
           MVST+NK+KPWDTEDIDKW+ EEFKPEDNASGLPFAEESSFMTLFPKYRE YLKSVW DV
Sbjct: 1   MVSTYNKEKPWDTEDIDKWQTEEFKPEDNASGLPFAEESSFMTLFPKYRESYLKSVWKDV 60

Query: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120
           TKAL+K HIAC LDLVEGSMTVKTTRKT+DP  ILKARDLIKLLARSVPFPQAIKILED+
Sbjct: 61  TKALEKHHIACILDLVEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPFPQAIKILEDN 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180
           MACDVIKIGNFV+NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 MACDVIKIGNFVSNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCM NVHPIYHIKELMIKRELAK+PELA+EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMLNVHPIYHIKELMIKRELAKKPELANEDWSRFLPMFKKRNVARKKPKKI 240

Query: 241 XXXXXXYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVXXXXXXXXXXXXXXXXXXXXXSK 300
                 YTPFPP Q PRKVDLEIESGEYFLSKKEKEV                      K
Sbjct: 241 RKEKKVYTPFPPTQLPRKVDLEIESGEYFLSKKEKEVKKLEERKEEQAKKQEEKEKERKK 300

Query: 301 DYVAPMEE 308
           +Y+AP EE
Sbjct: 301 NYIAPKEE 308

>TBLA0A04940 Chr1 complement(1218143..1219093) [951 bp, 316 aa] {ON}
           Anc_1.6 YCL059C
          Length = 316

 Score =  477 bits (1227), Expect = e-170,   Method: Compositional matrix adjust.
 Identities = 235/310 (75%), Positives = 256/310 (82%)

Query: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60
           MVSTHN+DKPWDT DI+KW+++EFKPEDNASGLPF EESSFMTLFPKYRE YL+ VW DV
Sbjct: 1   MVSTHNRDKPWDTPDINKWEIQEFKPEDNASGLPFTEESSFMTLFPKYRETYLREVWGDV 60

Query: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120
           TK+LDK H+ACTLDL+EGSMTVKTTRKT+DP  ILKARDLIKLLARSVP+PQAI+IL+DD
Sbjct: 61  TKSLDKYHVACTLDLIEGSMTVKTTRKTYDPAIILKARDLIKLLARSVPYPQAIRILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180
           +ACDVIKIGN V NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGPFKGL
Sbjct: 121 IACDVIKIGNVVNNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPFKGL 180

Query: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCMKNVHPIYHIKELMIKREL+KRPELA+EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMKNVHPIYHIKELMIKRELSKRPELANEDWSRFLPMFKKRNVARKKSKKP 240

Query: 241 XXXXXXYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVXXXXXXXXXXXXXXXXXXXXXSK 300
                 YTPFPPAQ PRKVDLEIESGEYFLSKKEKE+                      K
Sbjct: 241 KKEKKVYTPFPPAQLPRKVDLEIESGEYFLSKKEKEIKKLKERREKQEEKQVEKEKERRK 300

Query: 301 DYVAPMEEEY 310
           D++AP E+EY
Sbjct: 301 DFIAPSEKEY 310

>ZYRO0F18458g Chr6 (1522841..1523785) [945 bp, 314 aa] {ON} highly
           similar to uniprot|P25586 Saccharomyces cerevisiae
           YCL059C KRR1 Essential nucleolar protein required for
           the synthesis of 18S rRNA and for the assembly of 40S
           ribosomal subunit
          Length = 314

 Score =  472 bits (1215), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 230/310 (74%), Positives = 247/310 (79%)

Query: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60
           MVSTHNKDKPWDT +IDKW  +EFK EDNASGLPFAEESSFMTLFPKYRE YLKS+WNDV
Sbjct: 1   MVSTHNKDKPWDTGEIDKWHQDEFKEEDNASGLPFAEESSFMTLFPKYREAYLKSIWNDV 60

Query: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120
           TKAL+K H+AC LDLVEGSMTVKTTRKT DP  ILKARDLIKLLARSVPFPQA+KILED+
Sbjct: 61  TKALNKYHVACVLDLVEGSMTVKTTRKTCDPAIILKARDLIKLLARSVPFPQAVKILEDN 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180
            ACDVIKIGN V NKERF KRRQRLVGPNGNTLKALELLTKCYILVQGNTV+ MG +KGL
Sbjct: 121 TACDVIKIGNTVANKERFQKRRQRLVGPNGNTLKALELLTKCYILVQGNTVAAMGNYKGL 180

Query: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVED MKN+HPIYHIKELMIKRELAKRPELA+EDWSRFLP F             
Sbjct: 181 KEVRRVVEDTMKNIHPIYHIKELMIKRELAKRPELANEDWSRFLPNFKKRNVARKKPMKI 240

Query: 241 XXXXXXYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVXXXXXXXXXXXXXXXXXXXXXSK 300
                 YTPFPPAQ PRKVDLEIESGEYFL+K+EKE                       K
Sbjct: 241 RKEKKVYTPFPPAQTPRKVDLEIESGEYFLNKREKEAKKLEERREKQAEKQEERQKERRK 300

Query: 301 DYVAPMEEEY 310
           D++ P EE+Y
Sbjct: 301 DFLPPKEEDY 310

>AFR744W Chr6 (1801815..1802846) [1032 bp, 343 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL059C (KRR1)
          Length = 343

 Score =  466 bits (1198), Expect = e-165,   Method: Compositional matrix adjust.
 Identities = 231/310 (74%), Positives = 252/310 (81%), Gaps = 1/310 (0%)

Query: 1   MVSTHNKDKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDV 60
           MVST NKDKPWDT D+DKW +EEF PED+ASGLPFAEESSFMTLFPKYRE YLKS+W +V
Sbjct: 1   MVSTPNKDKPWDTPDVDKWAIEEFNPEDSASGLPFAEESSFMTLFPKYRETYLKSIWKEV 60

Query: 61  TKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQAIKILEDD 120
           T+AL+K HIAC L+LVEGSM+VKTTRKT+DP  ILKARDLIKLLARSVP PQAIKIL+DD
Sbjct: 61  TRALEKHHIACELNLVEGSMSVKTTRKTYDPAIILKARDLIKLLARSVPLPQAIKILQDD 120

Query: 121 MACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGL 180
           +ACDVIKIGN V +KERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVS MGP+KGL
Sbjct: 121 IACDVIKIGNIVASKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSAMGPYKGL 180

Query: 181 KEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADEDWSRFLPMFXXXXXXXXXXXXX 240
           KE+RRVVEDCM+N+HPIYHIKELMIKRELAKRPELA+EDWSRFLPMF             
Sbjct: 181 KEVRRVVEDCMRNIHPIYHIKELMIKRELAKRPELAEEDWSRFLPMF-KKRNVARKKPKK 239

Query: 241 XXXXXXYTPFPPAQQPRKVDLEIESGEYFLSKKEKEVXXXXXXXXXXXXXXXXXXXXXSK 300
                 YTPFPPAQ PRKVDLEIE+GEYFLSKKEKE                      +K
Sbjct: 240 IKEKKVYTPFPPAQLPRKVDLEIETGEYFLSKKEKEAKKLEARRAQQAEKQSEKEKERAK 299

Query: 301 DYVAPMEEEY 310
           DY+AP E EY
Sbjct: 300 DYIAPAEPEY 309

>SAKL0G03740g Chr7 complement(309922..310722) [801 bp, 266 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 266

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREIYLKSVWNDVTKAL-DKRHIACTLDLVEGSMTVKTTRK-TFDPYAILKARDLIKL 103
           P +R   L++ W  +   L D   +   ++L   S+ ++T  K T DP A+ K  D IK 
Sbjct: 94  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 153

Query: 104 LARSVPFPQAIKILE-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
            A       AI +L  DD+  +  ++ +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 154 FALGFDLDDAIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 213

Query: 162 CYILVQGNTVSCMGPFKGLKEIRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 214 TRIVLADSKIHILGGFTHIRMAREAV 239

>Ecym_4552 Chr4 (1087732..1088547) [816 bp, 271 aa] {ON} similar to
           Ashbya gossypii AFR390C
          Length = 271

 Score = 44.3 bits (103), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREIYLKSVWNDVTKAL-DKRHIACTLDLVEGSMTVKTT-RKTFDPYAILKARDLIKL 103
           P +R   L++ W  +   L D   +   ++L   S+ ++T  + T DP A+ K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTVDPGALQKGADFIKT 158

Query: 104 LARSVPFPQAIKILE-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L  DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSCMGPFKGLKEIRRVV 187
             I++  + +  +G F  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARETI 244

>Kpol_543.13 s543 complement(30976..31782) [807 bp, 268 aa] {ON}
           complement(30976..31782) [807 nt, 269 aa]
          Length = 268

 Score = 43.9 bits (102), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREIYLKSVWNDVTKAL-DKRHIACTLDLVEGSMTVKTT-RKTFDPYAILKARDLIKL 103
           P +R   L++ W  +   L D   +   ++L   S+ ++T  + T DP A+ K  D IK 
Sbjct: 96  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAIKILE-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L  DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSCMGPFKGLKEIRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 216 TRIVLADSKIHILGGFTHIRMAREAV 241

>NCAS0A11960 Chr1 complement(2371549..2372361) [813 bp, 270 aa] {ON}
           Anc_5.482 YOR145C
          Length = 270

 Score = 43.5 bits (101), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 45/193 (23%), Positives = 83/193 (43%), Gaps = 10/193 (5%)

Query: 4   THNKDKPWDTED-----IDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWN 58
           TH+  +P   ++     +D+     F   + A G     ES  + + P +R   L++ W 
Sbjct: 52  THDDTQPTQKKEAKGVVLDEEGKPRFSSANKAEGAKVKLESRKVPV-PPHRMTPLRNSWT 110

Query: 59  DVTKAL-DKRHIACTLDLVEGSMTVKTTRK-TFDPYAILKARDLIKLLARSVPFPQAIKI 116
            +   L D   +   ++L   S+ ++T  K T DP A+ K  D IK          +I +
Sbjct: 111 KIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIAL 170

Query: 117 LE-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCM 174
           L  DD+  +  +I +  T   +   +   R+ G +G T  A+E  T+  I++    +  +
Sbjct: 171 LRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADTKIHIL 230

Query: 175 GPFKGLKEIRRVV 187
           G F  ++  R  V
Sbjct: 231 GGFTHIRMAREAV 243

>Kwal_47.18864 s47 (1004428..1005243) [816 bp, 271 aa] {ON} YOR145C
           - Protein required for cell viability [contig 189] FULL
          Length = 271

 Score = 43.5 bits (101), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREIYLKSVWNDVTKAL-DKRHIACTLDLVEGSMTVKTTRK-TFDPYAILKARDLIKL 103
           P +R   L++ W  +   L D   +   ++L   ++ ++T  K T DP A+ K  D IK 
Sbjct: 99  PPHRLTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAIKILE-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    AI +L  DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSCMGPFKGLKEIRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>KLTH0G02574g Chr7 complement(201390..202205) [816 bp, 271 aa] {ON}
           similar to uniprot|Q7LHP7 Saccharomyces cerevisiae
           YOR145C PNO1 Partner of Nob1 Protein required for cell
           viability
          Length = 271

 Score = 43.1 bits (100), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREIYLKSVWNDVTKAL-DKRHIACTLDLVEGSMTVKTTRK-TFDPYAILKARDLIKL 103
           P +R   L++ W  +   L D   +   ++L   ++ ++T  K T DP A+ K  D IK 
Sbjct: 99  PPHRMTPLRNNWTKIYPPLVDHLKLQVRMNLKTKTVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAIKILE-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    AI +L  DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDAIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSCMGPFKGLKEIRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESV 244

>CAGL0K09460g Chr11 complement(935326..936111) [786 bp, 261 aa] {ON}
           highly similar to uniprot|Q99216 Saccharomyces
           cerevisiae YOR145c
          Length = 261

 Score = 42.7 bits (99), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREIYLKSVWNDVTKAL-DKRHIACTLDLVEGSMTVKTTRK-TFDPYAILKARDLIKL 103
           P +R   L++ WN +   L D   +   ++L   ++ ++T  K T DP A+ K  D IK 
Sbjct: 89  PPHRMTPLRNSWNKIYPPLVDHLKLQVRMNLKTRTVELRTHPKHTTDPGALQKGADFIKA 148

Query: 104 LARSVPFPQAIKILE-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L  DD+  +  ++ +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 149 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 208

Query: 162 CYILVQGNTVSCMGPFKGLKEIRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 209 TRIVLADSKIHILGGFTHIRMAREAV 234

>KLLA0C06446g Chr3 complement(566371..567195) [825 bp, 274 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability,
          Length = 274

 Score = 42.4 bits (98), Expect = 8e-04,   Method: Compositional matrix adjust.
 Identities = 37/146 (25%), Positives = 68/146 (46%), Gaps = 4/146 (2%)

Query: 46  PKYREIYLKSVWNDVTKAL-DKRHIACTLDLVEGSMTVKTT-RKTFDPYAILKARDLIKL 103
           P +R   LK+ W+ +   L D   +   ++L   S+ ++T  + T DP A+ K  D IK 
Sbjct: 102 PPHRMTPLKNNWSKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAIKILE-DDMACDVIKIGNFVTNKERFVKRR-QRLVGPNGNTLKALELLTK 161
                    +I +L  DD+  +  +I +  T +   + R   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLQGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSCMGPFKGLKEIRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 222 TRIVLADSKIHILGGFTHIRMARESV 247

>TPHA0J02820 Chr10 complement(627383..628189) [807 bp, 268 aa] {ON}
           Anc_5.482 YOR145C
          Length = 268

 Score = 42.0 bits (97), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREIYLKSVWNDVTKAL-DKRHIACTLDLVEGSMTVKTT-RKTFDPYAILKARDLIKL 103
           P +R   L++ W+ +   L D   +   ++L   S+ ++T  + T DP A+ K  D IK 
Sbjct: 96  PPHRMTPLRNSWSKIYPPLVDHLKLQVRMNLKSKSVELRTHPKHTTDPGALQKGADFIKA 155

Query: 104 LARSVPFPQAIKILE-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L  DD+  +  +I +  T + +   +   R+ G +G T  A+E  T+
Sbjct: 156 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLHGDHLSRAIGRIAGKDGKTKFAIENATR 215

Query: 162 CYILVQGNTVSCMGPFKGLKEIRRVV 187
             I++    +  +G F  ++  R  V
Sbjct: 216 TRIVLADTKIHILGGFTHIRMAREAV 241

>ZYRO0D11440g Chr4 complement(964606..965415) [810 bp, 269 aa] {ON}
           highly similar to uniprot|Q7LHP7 Saccharomyces
           cerevisiae YOR145C PNO1 Partner of Nob1 Protein required
           for cell viability
          Length = 269

 Score = 41.6 bits (96), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREIYLKSVWNDVTKAL-DKRHIACTLDLVEGSMTVKTT-RKTFDPYAILKARDLIKL 103
           P +R   L++ W  +   L +   +   ++L   S+ +++  R+T DP A+ K  D IK 
Sbjct: 97  PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRSHPRQTTDPGALQKGADFIKA 156

Query: 104 LARSVPFPQAIKILE-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L  DD+  +  ++ +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 157 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 216

Query: 162 CYILVQGNTVSCMGPFKGLKEIRRVV 187
             I++    +  +G F  ++  R  V
Sbjct: 217 TRIVLADAKIHILGGFTHIRMAREAV 242

>TDEL0A03460 Chr1 complement(617779..618597) [819 bp, 272 aa] {ON}
           Anc_5.482 YOR145C
          Length = 272

 Score = 41.6 bits (96), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/146 (23%), Positives = 67/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREIYLKSVWNDVTKAL-DKRHIACTLDLVEGSMTVKTT-RKTFDPYAILKARDLIKL 103
           P +R   L++ W  +   L +   +   ++L   S+ ++T  + T DP A+ K  D IK 
Sbjct: 100 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKHTTDPGALQKGADFIKA 159

Query: 104 LARSVPFPQAIKILE-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L  DD+  +  +I +  T N +   +   R+ G +G T  A+E  T+
Sbjct: 160 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLNGDHLSRAIGRIAGKDGKTKFAIENATR 219

Query: 162 CYILVQGNTVSCMGPFKGLKEIRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 220 TRIVLADSKIHILGGFTHIRMAREAV 245

>Suva_8.197 Chr8 complement(354586..355410) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/148 (23%), Positives = 68/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREIYLKSVWNDVTKAL-DKRHIACTLDLVEGSMTVKTTRK-TFDPYAILKARDLI 101
           + P +R   L++ W  +   L +   +   ++L   S+ ++T  K T DP A+ K  D I
Sbjct: 100 MVPPHRLTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAIKILE-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELL 159
           K  A       +I +L  DD+  +  ++ +  T   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFALGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSCMGPFKGLKEIRRVV 187
           T+  I++  + +  +G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMAREFV 247

>KNAG0C04610 Chr3 (905301..906134) [834 bp, 277 aa] {ON} Anc_5.482
           YOR145C
          Length = 277

 Score = 41.2 bits (95), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 40/176 (22%), Positives = 78/176 (44%), Gaps = 5/176 (2%)

Query: 16  IDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREIYLKSVWNDVTKAL-DKRHIACTLD 74
           +D+     F   + AS      ES  + + P +R   L++ W  +   L D   +   ++
Sbjct: 76  LDEQGKPRFSSANKASETKIKAESRKVAV-PPHRMTPLRNNWTKIYPPLVDHLKLQVRMN 134

Query: 75  LVEGSMTVKTT-RKTFDPYAILKARDLIKLLARSVPFPQAIKILE-DDMACDVIKIGNFV 132
           L   S+ ++T  + T DP A+ K  D IK          +I +L  DD+  +  ++ +  
Sbjct: 135 LKTKSVELRTHPKHTTDPGALQKGADFIKAFTLGFDLDDSIALLRLDDLYIETFEVKDVK 194

Query: 133 T-NKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGLKEIRRVV 187
           T + +   +   R+ G +G T  A+E  T+  I++  + +  +G F  ++  R  V
Sbjct: 195 TLHGDHLSRAIGRIAGKDGKTKFAIENATRTRIVLADSKIHILGGFTHIRMARESV 250

>NDAI0A04310 Chr1 (970952..971776) [825 bp, 274 aa] {ON} Anc_5.482
           YOR145C
          Length = 274

 Score = 40.4 bits (93), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 36/146 (24%), Positives = 65/146 (44%), Gaps = 4/146 (2%)

Query: 46  PKYREIYLKSVWNDVTKAL-DKRHIACTLDLVEGSMTVKTTRK-TFDPYAILKARDLIKL 103
           P +R   L++ W  +   L D   +   ++L   S+ ++T  K T DP A+ K  D IK 
Sbjct: 102 PPHRMTPLRNSWTKIYPPLVDHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 161

Query: 104 LARSVPFPQAIKILE-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L  DD+  +  +I +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 162 FTLGFDLDDSIALLRLDDLYIETFEIKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 221

Query: 162 CYILVQGNTVSCMGPFKGLKEIRRVV 187
             I++    +  +G F  ++  R  V
Sbjct: 222 TRIVLADTKIHILGGFTHIRMARESV 247

>Skud_15.310 Chr15 complement(554002..554832) [831 bp, 276 aa] {ON}
           YOR145C (REAL)
          Length = 276

 Score = 39.7 bits (91), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 67/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREIYLKSVWNDVTKAL-DKRHIACTLDLVEGSMTVKTTRK-TFDPYAILKARDLI 101
           + P +R   L++ W  +   L +   +   ++L   S+ ++T  K T DP A+ K  D I
Sbjct: 102 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 161

Query: 102 KLLARSVPFPQAIKILE-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          +I +L  DD+  +  ++ +  T   +   +   R+ G +G T  A+E  
Sbjct: 162 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 221

Query: 160 TKCYILVQGNTVSCMGPFKGLKEIRRVV 187
           T+  I++  + +  +G F  ++  R  V
Sbjct: 222 TRTRIVLADSKIHILGGFTHIRMARESV 249

>YOR145C Chr15 complement(605347..606171) [825 bp, 274 aa] {ON}
           PNO1Essential nucleolar protein required for pre-18S
           rRNA processing, interacts with Dim1p, an 18S rRNA
           dimethyltransferase, and also with Nob1p, which is
           involved in proteasome biogenesis; contains a KH domain
          Length = 274

 Score = 39.3 bits (90), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 67/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREIYLKSVWNDVTKAL-DKRHIACTLDLVEGSMTVKTTRK-TFDPYAILKARDLI 101
           + P +R   L++ W  +   L +   +   ++L   S+ ++T  K T DP A+ K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAIKILE-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          +I +L  DD+  +  ++ +  T   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSCMGPFKGLKEIRRVV 187
           T+  I++  + +  +G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESV 247

>KAFR0E03600 Chr5 (724338..725168) [831 bp, 276 aa] {ON} Anc_5.482
           YOR145C
          Length = 276

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/146 (23%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREIYLKSVWNDVTKAL-DKRHIACTLDLVEGSMTVKTTRK-TFDPYAILKARDLIKL 103
           P +R   L++ W  +   L +   +   ++L   S+ ++T  K T DP A+ K  D IK 
Sbjct: 104 PPHRMTPLRNNWTKIYPPLVEHLKLQVRMNLKTKSVELRTHPKHTTDPGALQKGADFIKA 163

Query: 104 LARSVPFPQAIKILE-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L  DD+  +  ++ +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 164 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 223

Query: 162 CYILVQGNTVSCMGPFKGLKEIRRVV 187
             I++  + +  +G F  ++  R  V
Sbjct: 224 TRIVLADSKIHILGGFTHIRMAREAV 249

>Smik_15.326 Chr15 complement(561176..562000) [825 bp, 274 aa] {ON}
           YOR145C (REAL)
          Length = 274

 Score = 38.9 bits (89), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 34/148 (22%), Positives = 67/148 (45%), Gaps = 4/148 (2%)

Query: 44  LFPKYREIYLKSVWNDVTKAL-DKRHIACTLDLVEGSMTVKTTRK-TFDPYAILKARDLI 101
           + P +R   L++ W  +   L +   +   ++L   S+ ++T  K T DP A+ K  D I
Sbjct: 100 MVPPHRMTPLRNSWTKIYPPLVEHLKLQVRMNLKTKSVELRTNPKFTTDPGALQKGADFI 159

Query: 102 KLLARSVPFPQAIKILE-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELL 159
           K          +I +L  DD+  +  ++ +  T   +   +   R+ G +G T  A+E  
Sbjct: 160 KAFTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENA 219

Query: 160 TKCYILVQGNTVSCMGPFKGLKEIRRVV 187
           T+  I++  + +  +G F  ++  R  V
Sbjct: 220 TRTRIVLADSKIHILGGFTHIRMARESV 247

>AAR002W Chr1 (341790..342326) [537 bp, 178 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCR003W (MRPL32)
          Length = 178

 Score = 37.7 bits (86), Expect = 0.014,   Method: Compositional matrix adjust.
 Identities = 45/166 (27%), Positives = 69/166 (41%), Gaps = 35/166 (21%)

Query: 54  KSVWNDVTKALDKRHIACTLDLVEGSMTVKTTRKTFDPYAILKARDLIKLLARSVPFPQA 113
           ++VW +V +AL +    CT  L          R      +++  R L++LL R+    QA
Sbjct: 4   QAVWGNVGRALSE----CTAALF--------PRLELGSGSVIAPRTLLELLRRAGGSQQA 51

Query: 114 --IKILEDDMACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTV 171
               +  D +   V K       K    KRRQ+L GP    L+ +  L KC         
Sbjct: 52  GTAAVGADGLVLAVPK------KKVSHQKRRQKLYGPGKKQLQMVHHLGKC--------P 97

Query: 172 SCMGPFKGLKEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELAD 217
           SC G +K L  +      CM  V  I HI ++  + + A+ P+  D
Sbjct: 98  SC-GHYKRLNTL------CMYCVGEIRHIWKVYTQTKPAEPPQEQD 136

>TBLA0D01890 Chr4 (461527..462342) [816 bp, 271 aa] {ON} Anc_5.482
           YOR145C
          Length = 271

 Score = 38.1 bits (87), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 33/146 (22%), Positives = 66/146 (45%), Gaps = 4/146 (2%)

Query: 46  PKYREIYLKSVWNDVTKAL-DKRHIACTLDLVEGSMTVKTT-RKTFDPYAILKARDLIKL 103
           P +R   L++ W  +   L D   +   ++L   S+ ++T  + T DP A+ K  D IK 
Sbjct: 99  PPHRMTPLRNNWPKIYPPLVDHLKLQVRMNLRTKSVELRTHPKHTTDPGALQKGADFIKA 158

Query: 104 LARSVPFPQAIKILE-DDMACDVIKIGNFVT-NKERFVKRRQRLVGPNGNTLKALELLTK 161
                    +I +L  DD+  +  ++ +  T   +   +   R+ G +G T  A+E  T+
Sbjct: 159 FTLGFDLDDSIALLRLDDLYIETFEVKDVKTLTGDHLSRAIGRIAGKDGKTKFAIENATR 218

Query: 162 CYILVQGNTVSCMGPFKGLKEIRRVV 187
             I++  + +  +G F  ++  R  +
Sbjct: 219 TRIVLADSKIHILGGFTHIRMARESI 244

>TBLA0H01830 Chr8 complement(433992..435212) [1221 bp, 406 aa] {ON}
           Anc_5.375 YDR331W
          Length = 406

 Score = 32.0 bits (71), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 20/64 (31%), Positives = 34/64 (53%), Gaps = 3/64 (4%)

Query: 79  SMTVKTTRKTFDPYAILKARDLIKLLAR-SVPFPQAIKILEDDMACDVIKI--GNFVTNK 135
           ++ V T+R  F+   +  A  + +   R  VP  Q I +L DD+AC+   +  G+   NK
Sbjct: 30  AVIVSTSRFWFNYRHMANALSMYRTFKRLGVPDSQIILMLSDDVACNSRNLFPGSVFNNK 89

Query: 136 ERFV 139
           +RF+
Sbjct: 90  DRFL 93

>ZYRO0E04356g Chr5 complement(332059..332619) [561 bp, 186 aa] {ON}
           similar to uniprot|P25348 Saccharomyces cerevisiae
           YCR003W MRPL32 Mitochondrial ribosomal protein of the
           large subunit
          Length = 186

 Score = 31.6 bits (70), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 24/104 (23%), Positives = 44/104 (42%), Gaps = 12/104 (11%)

Query: 116 ILEDDMACDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMG 175
           I+E+D   +  ++      K    K+RQRL  P    LK +  L KC         +C+ 
Sbjct: 57  IVEEDFFSNNGRLLAVPKKKVTHQKKRQRLYAPGKKQLKFIHELNKCPSCGHYKRANCL- 115

Query: 176 PFKGLKEIRRVVEDCMKNVHPIYHIKELMIKRELAKRPELADED 219
                         C+++V  I+  + +  ++E ++  EL+D D
Sbjct: 116 -----------CMHCVQHVRHIWKTQTVKERQEPSQEQELSDLD 148

>KAFR0B03030 Chr2 (632585..633988) [1404 bp, 467 aa] {ON} Anc_8.309
           YLR116W
          Length = 467

 Score = 32.0 bits (71), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 18/54 (33%), Positives = 27/54 (50%), Gaps = 5/54 (9%)

Query: 145 LVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGLKEIRRVVEDCMKNVHPIY 198
           L+GP GNTL+ L+  +KC I ++G      G  K  K    + E  M    P++
Sbjct: 151 LLGPRGNTLRKLQEQSKCKIAIRG-----RGSVKEGKHANDLPEGAMNMEDPLH 199

>AGL183C Chr7 complement(352996..354519) [1524 bp, 507 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR116W
           (MSL5)
          Length = 507

 Score = 32.0 bits (71), Expect = 2.7,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 18/24 (75%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I+++G
Sbjct: 169 LLGPRGNTLKQLQQQSGCKIVIRG 192

>TBLA0D00760 Chr4 (201951..203570) [1620 bp, 539 aa] {ON} 
          Length = 539

 Score = 31.6 bits (70), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 17/65 (26%), Positives = 35/65 (53%), Gaps = 1/65 (1%)

Query: 33  LPFAEESSFMTLFPKYREIYLKSVWNDVTKALDKRHIACTLDLVEGSMTVKTTRKTFDPY 92
           +P   + +F T F  + ++YLK+ + D+    D R++ C L  V G +++ ++   +  Y
Sbjct: 316 IPPLPDKTFKTKFDNFVQVYLKNSF-DIFAFKDMRYLFCVLGTVMGEVSICSSITYWGTY 374

Query: 93  AILKA 97
           +I K 
Sbjct: 375 SISKG 379

>KLTH0E14014g Chr5 (1239444..1240904) [1461 bp, 486 aa] {ON} similar
           to uniprot|Q12096 Saccharomyces cerevisiae YOR320C GNT1
           N-acetylglucosaminyltransferase capable of modification
           of N-linked glycans in the Golgi apparatus
          Length = 486

 Score = 31.2 bits (69), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 26/99 (26%), Positives = 40/99 (40%), Gaps = 20/99 (20%)

Query: 137 RFV-KRRQRLVGPNGNTLKALELLTKCYILVQGNTVSCMGPFKGLKEIRRVVEDCMKNVH 195
           RF+ KRR RLVG  G  +  + L  KC +  Q N        + ++  R        N+H
Sbjct: 2   RFLFKRRLRLVGAIGAVVLLISLTAKCVVQFQLN--------REIEHYRTFFRKHKDNIH 53

Query: 196 PIYH-----------IKELMIKRELAKRPELADEDWSRF 223
            IY            I+ L   R+    P+ +  DW ++
Sbjct: 54  DIYDPLNIKQIPYETIESLYQLRKTGDVPKKSPIDWGKY 92

>YJR060W Chr10 (548759..549814) [1056 bp, 351 aa] {ON}  CBF1Dual
           function helix-loop-helix protein; binds the motif
           CACRTG present at several sites including MET gene
           promoters and centromere DNA element I (CDEI); affects
           nucleosome positioning at this motif; associates with
           other transcription factors such as Met4p and Isw1p to
           mediate transcriptional activation or repression;
           associates with kinetochore proteins and required for
           efficient chromosome segregation
          Length = 351

 Score = 31.2 bits (69), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/49 (38%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 9   KPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREI-YLKSV 56
           K  D  +I+KW +++   E NAS L  A E     L   Y+EI Y+K V
Sbjct: 271 KETDEANIEKWTLQKLLSEQNASQLASANEKLQEELGNAYKEIEYMKRV 319

>Smik_10.350 Chr10 (537706..538758) [1053 bp, 350 aa] {ON} YJR060W
           (REAL)
          Length = 350

 Score = 30.8 bits (68), Expect = 4.5,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 9   KPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREI-YLKSV 56
           K  D  +I+KW +++   E NAS L  A E     L   Y+EI Y+K +
Sbjct: 270 KETDEANIEKWTLQKLLSEQNASQLASANEKLQEELGNAYKEIEYMKRI 318

>KNAG0G02350 Chr7 (542717..544210) [1494 bp, 497 aa] {ON} Anc_8.309
           YLR116W
          Length = 497

 Score = 30.8 bits (68), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 12/24 (50%), Positives = 17/24 (70%)

Query: 145 LVGPNGNTLKALELLTKCYILVQG 168
           L+GP GNTLK L+  + C I ++G
Sbjct: 148 LLGPRGNTLKQLQKQSNCKIAIRG 171

>KLLA0D02398g Chr4 complement(202446..206063) [3618 bp, 1205 aa] {ON}
            similar to uniprot|P06105 Saccharomyces cerevisiae
            YJL080C SCP160 May be required during cell division for
            faithful partitioning of the ER-nuclear envelope
            membranes involved in control of mitotic chromsome
            transmission,
          Length = 1205

 Score = 30.8 bits (68), Expect = 6.9,   Method: Compositional matrix adjust.
 Identities = 22/83 (26%), Positives = 42/83 (50%), Gaps = 9/83 (10%)

Query: 112  QAIKILEDDMA-CDVIKIGNFVTNKERFVKRRQRLVGPNGNTLKALELLTKCYILV---- 166
            +A K++ED +A   ++    FV +K+   K+   +VGPNG  ++ +   TK  I V    
Sbjct: 1120 KASKLIEDRIAEAKLVNTEGFVWSKD--AKKFNSIVGPNGRNIREIRNATKTVIHVPRKS 1177

Query: 167  --QGNTVSCMGPFKGLKEIRRVV 187
                N +  +G  +G+K+   ++
Sbjct: 1178 DKVNNVIYVLGSEEGVKKAAELI 1200

>Suva_12.149 Chr12 (226538..227611) [1074 bp, 357 aa] {ON} YJR060W
           (REAL)
          Length = 357

 Score = 30.4 bits (67), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 9   KPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREI-YLKSV 56
           K  D  +I+KW +++   E NAS L  A E     L   Y+EI Y+K +
Sbjct: 277 KETDEANIEKWTLQKLLSEQNASQLASANEKLQEELGNAYKEIEYMKRI 325

>Skud_10.284 Chr10 (506276..507337) [1062 bp, 353 aa] {ON} YJR060W
           (REAL)
          Length = 353

 Score = 30.0 bits (66), Expect = 8.1,   Method: Compositional matrix adjust.
 Identities = 18/49 (36%), Positives = 26/49 (53%), Gaps = 1/49 (2%)

Query: 9   KPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLFPKYREI-YLKSV 56
           K  D  +I+KW +++   E NAS L  A E     L   Y+EI Y+K +
Sbjct: 273 KETDEANIEKWTLQKLLSEQNASQLASANEKLQEELGNAYKEIEYIKRI 321

>Suva_10.540 Chr10 (933675..935816) [2142 bp, 713 aa] {ON} YLR424W
           (REAL)
          Length = 713

 Score = 30.4 bits (67), Expect = 8.8,   Method: Compositional matrix adjust.
 Identities = 19/78 (24%), Positives = 36/78 (46%), Gaps = 12/78 (15%)

Query: 8   DKPWDTEDIDKWKVEEFKPEDNASGLPFAEESSFMTLF------------PKYREIYLKS 55
           D+ W+  +   +++E++K ED+  G    E+ S    F            PK  E+ ++ 
Sbjct: 465 DELWERHNDPIFELEDWKEEDDNGGEEAIEKESGFFYFVKKMRNYAHYFHPKQYELLIRG 524

Query: 56  VWNDVTKALDKRHIACTL 73
            +N + K L + HI C +
Sbjct: 525 TFNSINKVLYQWHIYCAV 542

>TBLA0D00770 Chr4 (204726..206348) [1623 bp, 540 aa] {ON} Anc_8.783
           YOR306C
          Length = 540

 Score = 30.0 bits (66), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 15/64 (23%), Positives = 32/64 (50%), Gaps = 1/64 (1%)

Query: 34  PFAEESSFMTLFPKYREIYLKSVWNDVTKALDKRHIACTLDLVEGSMTVKTTRKTFDPYA 93
           P   ++SF T    + ++Y+K+ + D     DKR++ C +  + G +++  +   +  Y 
Sbjct: 317 PVLPDNSFRTKMNNFIQVYIKNSF-DANAFKDKRYLFCVIGTIMGEISICCSITYWGTYC 375

Query: 94  ILKA 97
           I K 
Sbjct: 376 ISKG 379

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.136    0.407 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,211,508
Number of extensions: 1180924
Number of successful extensions: 3077
Number of sequences better than 10.0: 54
Number of HSP's gapped: 3151
Number of HSP's successfully gapped: 54
Length of query: 338
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 228
Effective length of database: 40,868,139
Effective search space: 9317935692
Effective search space used: 9317935692
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 66 (30.0 bits)