Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_2002.81.5ON98598538640.0
TPHA0E040101.5ON965103510261e-123
Smik_3.141.5ON11133477204e-79
Suva_3.1521.5ON11403476871e-74
Skud_3.31.5ON11523436667e-72
NDAI0A001401.5ON10913306603e-71
KAFR0D001401.5ON10413636574e-71
NCAS0B091101.5ON10203636477e-70
SAKL0C00462g1.5ON11773326359e-68
YCL061C (MRC1)1.5ON10963456331e-67
KNAG0C002201.5ON11613236191e-65
TBLA0A075701.5ON12523555843e-61
ZYRO0F18480g1.5ON9603525662e-59
CAGL0B00330g1.5ON11363495673e-59
TDEL0C069701.5ON9413565332e-55
Ecym_10081.5ON11183225122e-52
KLTH0F00484g1.5ON9933264811e-48
KLLA0C00484g1.5ON9253004523e-45
AFR745W1.5ON10183224052e-39
Kwal_33.130051.5ON9703153944e-38
Suva_7.1976.209ON84665930.022
KLTH0D06556g2.522ON45654744.1
KNAG0A071302.558ON23440715.6
Suva_1.247.32ON84973719.7
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_2002.8
         (985 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON...  1493   0.0  
TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5...   399   e-123
Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON} ...   281   4e-79
Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {O...   269   1e-74
Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YC...   261   7e-72
NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}...   258   3e-71
KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON...   257   4e-71
NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_...   253   7e-70
SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {O...   249   9e-68
YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}  M...   248   1e-67
KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON...   243   1e-65
TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_...   229   3e-61
ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weak...   222   2e-59
CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {O...   223   3e-59
TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1...   209   2e-55
Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON} ...   201   2e-52
KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON...   189   1e-48
KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON...   178   3e-45
AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic...   160   2e-39
Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON...   156   4e-38
Suva_7.197 Chr7 (361661..364201) [2541 bp, 846 aa] {ON} YGL073W ...    40   0.022
KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {...    33   4.1  
KNAG0A07130 Chr1 complement(1119805..1120509) [705 bp, 234 aa] {...    32   5.6  
Suva_1.24 Chr1 (39893..42442) [2550 bp, 849 aa] {ON} YAL041W (REAL)    32   9.7  

>Kpol_2002.8 s2002 complement(11914..14871) [2958 bp, 985 aa] {ON}
           complement(11914..14871) [2958 nt, 986 aa]
          Length = 985

 Score = 1493 bits (3864), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 782/985 (79%), Positives = 782/985 (79%)

Query: 1   MDFVFDGLDALKGKKRTTYKKVTDGDVEDEPKISEFNIELPGLGQSILFNNSKLKQIRNR 60
           MDFVFDGLDALKGKKRTTYKKVTDGDVEDEPKISEFNIELPGLGQSILFNNSKLKQIRNR
Sbjct: 1   MDFVFDGLDALKGKKRTTYKKVTDGDVEDEPKISEFNIELPGLGQSILFNNSKLKQIRNR 60

Query: 61  LEGXXXXXXXXXXQAETQVIADTQIISNLYXXXXXXXXXXXRRFLQRTQIVEDHTQIIDA 120
           LEG          QAETQVIADTQIISNLY           RRFLQRTQIVEDHTQIIDA
Sbjct: 61  LEGNNNDSENDSSQAETQVIADTQIISNLYEGGEDLEEKEERRFLQRTQIVEDHTQIIDA 120

Query: 121 SVTYSSKTIESNKMDNTQKYINASDSEPTQIQISKVDKLLKITDNLDSQKKVLDXXXXXX 180
           SVTYSSKTIESNKMDNTQKYINASDSEPTQIQISKVDKLLKITDNLDSQKKVLD      
Sbjct: 121 SVTYSSKTIESNKMDNTQKYINASDSEPTQIQISKVDKLLKITDNLDSQKKVLDTTLETQ 180

Query: 181 XXXXXYGKTQVDKTQVDKTQVDKTQIFPTLVADDEIKHSSTAVQTVDDNTHSNSELKINE 240
                YGKTQVDKTQVDKTQVDKTQIFPTLVADDEIKHSSTAVQTVDDNTHSNSELKINE
Sbjct: 181 ELETQYGKTQVDKTQVDKTQVDKTQIFPTLVADDEIKHSSTAVQTVDDNTHSNSELKINE 240

Query: 241 IERQLDEEDQILKEKSMGTEYKRNIAPVMSKVKFSKNDFLEHFXXXXXXXXXXGVVKLSS 300
           IERQLDEEDQILKEKSMGTEYKRNIAPVMSKVKFSKNDFLEHF          GVVKLSS
Sbjct: 241 IERQLDEEDQILKEKSMGTEYKRNIAPVMSKVKFSKNDFLEHFDSSSSEEDEEGVVKLSS 300

Query: 301 TEPETAAMNLENSLPQFSKESKFIGLSNYENILKKDINKQNCIEFSDSEDETEVTSKVSR 360
           TEPETAAMNLENSLPQFSKESKFIGLSNYENILKKDINKQNCIEFSDSEDETEVTSKVSR
Sbjct: 301 TEPETAAMNLENSLPQFSKESKFIGLSNYENILKKDINKQNCIEFSDSEDETEVTSKVSR 360

Query: 361 ASKATILSIKANLSRHKPAQSSINNKNALGNLFSDLKKATKAQILDHKKEIMEQKGYKMX 420
           ASKATILSIKANLSRHKPAQSSINNKNALGNLFSDLKKATKAQILDHKKEIMEQKGYKM 
Sbjct: 361 ASKATILSIKANLSRHKPAQSSINNKNALGNLFSDLKKATKAQILDHKKEIMEQKGYKME 420

Query: 421 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXNGDQEEDFAISANELSDSE 480
                                                    NGDQEEDFAISANELSDSE
Sbjct: 421 EIEKEKEIVENLLEQEIERNRKIRIREKQKEELKKRKQRIENGDQEEDFAISANELSDSE 480

Query: 481 VPESDNDGEVMXXXXXXXXXXXXLRTQLDASTGIEKETEQDASRDSEKDSERDIDEENIL 540
           VPESDNDGEVM            LRTQLDASTGIEKETEQDASRDSEKDSERDIDEENIL
Sbjct: 481 VPESDNDGEVMSSNEEASDSDDELRTQLDASTGIEKETEQDASRDSEKDSERDIDEENIL 540

Query: 541 NIKNRKSKKIHXXXXXXXXXXXXXXXXQVEANHQPSLNTINLGHYGXXXXXXXXXXXXXX 600
           NIKNRKSKKIH                QVEANHQPSLNTINLGHYG              
Sbjct: 541 NIKNRKSKKIHVVSESDSDSDSGENSVQVEANHQPSLNTINLGHYGDNLSQENNNERNNI 600

Query: 601 XXXXXXXXXLYKEMVXXXXXXXXXXXXXXXXXXXXXXXXGITDMFEVEAEESEDEWHGIG 660
                    LYKEMV                        GITDMFEVEAEESEDEWHGIG
Sbjct: 601 DSDESEDEELYKEMVKKEIDRRRDQERKQRQKLRELKDKGITDMFEVEAEESEDEWHGIG 660

Query: 661 GVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAENKDMDLKMVNRILNDIKNGGFR 720
           GVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAENKDMDLKMVNRILNDIKNGGFR
Sbjct: 661 GVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAENKDMDLKMVNRILNDIKNGGFR 720

Query: 721 KRRNAXXXXXXXXXXXXXKAYRAKRRQLMKEKRLETDHNKKLMTNKKSHAFLESMVDDIV 780
           KRRNA             KAYRAKRRQLMKEKRLETDHNKKLMTNKKSHAFLESMVDDIV
Sbjct: 721 KRRNALEIELSDDEDDDLKAYRAKRRQLMKEKRLETDHNKKLMTNKKSHAFLESMVDDIV 780

Query: 781 EVKNPFDERDDNIMDDTPETDAEGDVNSNELLNKKKKFILSEAFVQKSLSFLSSSRNLEE 840
           EVKNPFDERDDNIMDDTPETDAEGDVNSNELLNKKKKFILSEAFVQKSLSFLSSSRNLEE
Sbjct: 781 EVKNPFDERDDNIMDDTPETDAEGDVNSNELLNKKKKFILSEAFVQKSLSFLSSSRNLEE 840

Query: 841 FEMNNNLAKEQHSHAATDMFALKSHCSIKSLESLPGSHNNSISSKLDLLHEEIVSTPFSG 900
           FEMNNNLAKEQHSHAATDMFALKSHCSIKSLESLPGSHNNSISSKLDLLHEEIVSTPFSG
Sbjct: 841 FEMNNNLAKEQHSHAATDMFALKSHCSIKSLESLPGSHNNSISSKLDLLHEEIVSTPFSG 900

Query: 901 LKQTSVXXXXXXXXXXXXXXXXGNKTVKVSKSYRTVGSAKASITYLGKARKLVXXXXXXX 960
           LKQTSV                GNKTVKVSKSYRTVGSAKASITYLGKARKLV       
Sbjct: 901 LKQTSVIKSFSSSIDIDSKFKDGNKTVKVSKSYRTVGSAKASITYLGKARKLVPPKKKEH 960

Query: 961 XXXXXXXXTASASRLFDEQDNSFEQ 985
                   TASASRLFDEQDNSFEQ
Sbjct: 961 KPHSHKSKTASASRLFDEQDNSFEQ 985

>TPHA0E04010 Chr5 (839903..842800) [2898 bp, 965 aa] {ON} Anc_1.5
           YCL061C
          Length = 965

 Score =  399 bits (1026), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 336/1035 (32%), Positives = 487/1035 (47%), Gaps = 121/1035 (11%)

Query: 1   MDFVFDGLDALKGKKRTTYKKVTDGDVEDEPKISEF-----NIELPGLGQSILFNNSKLK 55
           MD +FD L+  K KKRTTY K+    +E+E +  +        E+  L   ILF NS L 
Sbjct: 1   MDSLFDQLNHFK-KKRTTYDKIPHDLLEEEQESEDILKNKTAKEISQLDGGILFGNSILG 59

Query: 56  QIRNRL------------EGXXXXXXXXXXQAETQVIADTQIISNLYXXXXXXXXXXXRR 103
           QIRNRL            E           Q  TQ+   TQII+NLY             
Sbjct: 60  QIRNRLNNIDNEDKDKGKEASESITSKDNEQDSTQIFPQTQIINNLYDGGEDLENEIFHN 119

Query: 104 FLQRTQIVEDH----------------TQIIDASVTYSSKTIESNKMDNTQKYINASDSE 147
             ++TQI+ D+                TQ+I  +   S K ++   ++NTQ  +   +++
Sbjct: 120 SFKKTQIITDNILIETNTNDKSTQYEKTQVITINERLSDKPLDV--VNNTQTVLVIENTQ 177

Query: 148 P------TQIQISKVDKLLKITDNLDSQKKVLDXXXXXXXXXXXYGKTQVDKTQVDKTQV 201
           P      TQ+ +++V+  L +T    +                      +  TQ ++   
Sbjct: 178 PLPSEIKTQV-VNEVNSALPVTQPTQT----------------------IVATQANEVTY 214

Query: 202 DKTQIFPTLVADDEIKHSSTAVQTVDDNTHSNSELKINEIERQLDEEDQILKEKSMGTEY 261
           D  ++ PT                VDD    ++ LKI +IE++L+EE ++ KE   GTE+
Sbjct: 215 DTQELMPT----------------VDDVAMRSTGLKITDIEKELEEEQRLAKETEFGTEF 258

Query: 262 KRNIAPVMSKVKFSKNDFLEHFXXXXXXXXXXGVVKLSSTEPETAAMNLENSLPQFSKES 321
           K   +      KFSK DFL HF             +      ++  ++ +N      K  
Sbjct: 259 KFKESESKISKKFSKEDFLNHFDDSSSSEDETSKNEKGPNVDKSEVLHPDNKSKTLLKVK 318

Query: 322 KFIGLSNYENILKKDINKQNCIEFSDSEDETEVTSKVSRASKATILSIKANLSRHKPAQS 381
              GL NYE+ L++  N +  IEFS+S+++++     S ASKA IL+I+AN S+ +P  S
Sbjct: 319 SINGLGNYEHNLRRKANNEQIIEFSESDEDSDTNISPSYASKAVILNIRANKSKQQPKVS 378

Query: 382 SINNKNALGNLFSDLKKATKAQILDHKKEIMEQKGYKMXXXXXXXXXXXXXXXXXXXXXX 441
             +++  L  L+++LK+A+K QI+ ++KE+ME+KG  +                      
Sbjct: 379 QKSDQTTLLMLYNNLKRASKEQIVSYQKELMEKKGINLEELEKENEIVENLLEQEIARNQ 438

Query: 442 XXXXXXXXXXXXXXXXXXXXNGDQEEDFAISANELSDSEVP-----ESDNDGEVMXXXXX 496
                               N    E+F +SANEL DS++P     ES+N+ E       
Sbjct: 439 KIRQREKQKQKKENQDDLNSNP---EEFDLSANELEDSDIPGSDFAESNNNSEKDDEEEE 495

Query: 497 XXXXXXXLRTQLDASTGIEKETEQDASRDSEKDSERDIDEEN-ILNIKNRKSKKIHXXXX 555
                   +     ST                     +DEE+    I  RK KK      
Sbjct: 496 NDEEEEDEQEDAPKST---------------------VDEEDEGFAIGKRKHKKTEIVDD 534

Query: 556 XXXXXXXXXXXXQVEANHQPSLNTINLGHYGXXXXXXXXXXXXXXXXXXXXXXXLYKEMV 615
                        V++    + NTI+LGHYG                        Y  ++
Sbjct: 535 SDSEIEAQI----VDSKEIITANTIDLGHYGDNIIQQSRETLNETEESDEEDEERYNAII 590

Query: 616 XXXXXXXXXXXXXXXXXXXXXXXXGITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVE 675
                                   G++ MFEVEAEESEDEWHGIGGVD + SD YDSEVE
Sbjct: 591 SEGIRKQKELEKREAKRLKEMKTSGVSKMFEVEAEESEDEWHGIGGVDSDFSDAYDSEVE 650

Query: 676 KMIDDYSKENFNAGEIREKLAAENKDMDLKMVNRILNDIKNGGFRKR-RNAXXXXXXXXX 734
           KMIDDYS++NFN  EIRE LA ENK+ DL +VN+IL DIKNGGFR R R           
Sbjct: 651 KMIDDYSRQNFNPSEIREMLAKENKETDLALVNKILYDIKNGGFRTRKRRDRDLEFSDDD 710

Query: 735 XXXXKAYRAKRRQLMKEKRLETDHNKKLMTNKKSHAFLESMVDDIVEVKNPFDERDDNIM 794
               KAYRAKRR LM+EKRL+ + +KK++ N KS AF ES+VDDI+E KNPFD+ + +I 
Sbjct: 711 DDDLKAYRAKRRALMREKRLDIEGDKKIVKNPKSKAFFESIVDDIIETKNPFDDMNTSIE 770

Query: 795 D----DTPETDAEGDVN-SNELLNKKKKFILSEAFVQKSLSFLSSSRNLEEFEMNNNLAK 849
                +TP  D + D   +  +  KKKK ++SE FVQ+SLSFL+S R  +EFE+NN    
Sbjct: 771 QIVEKETPTVDIDNDEKLATNVTKKKKKIVISEEFVQRSLSFLNSCREQDEFEINNQHNG 830

Query: 850 EQHSHAATDMFALKSHCSIKSLESLPGSHNNSISSKLDLLHEEIVSTPFSGLKQTSVXXX 909
            + + +  D++ LK + SIK+L+S+  S ++SI+S L+    +   + F+ L++TSV   
Sbjct: 831 GEKATSTADLYTLKRYSSIKTLQSVTSSRSSSIASNLNEQPSQSSGSLFNDLRKTSVLNS 890

Query: 910 XXXXXXXXXXXXXGNKTVKVSKSYRTVGSAKASITYLGKARKLVXXXXXXXXXXXXXXXT 969
                        G K+VKVS +Y+TVGSA+ASITY+G +R+LV                
Sbjct: 891 FSSDVDINSKFKEGTKSVKVSNAYKTVGSARASITYMGTSRRLVAPKKSRLTTSSKANSR 950

Query: 970 ASASRLFDEQDNSFE 984
            + SRLFD Q+ SFE
Sbjct: 951 TTPSRLFDNQEGSFE 965

>Smik_3.14 Chr3 complement(20226..23567) [3342 bp, 1113 aa] {ON}
            YCL061C (REAL)
          Length = 1113

 Score =  281 bits (720), Expect = 4e-79,   Method: Compositional matrix adjust.
 Identities = 171/347 (49%), Positives = 212/347 (61%), Gaps = 38/347 (10%)

Query: 640  GITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAEN 699
            G+T+ FE+EAEES+DEWHGIGG DGE SDEYDS+VEKMIDDYSK NFN+ EIRE LAAEN
Sbjct: 737  GVTNFFEMEAEESDDEWHGIGGADGEGSDEYDSDVEKMIDDYSKNNFNSHEIREMLAAEN 796

Query: 700  KDMDLKMVNRILNDIKNGGFRKRR--NAXXXXXXXXXXXXXKAYRAKRRQLMKEKRLETD 757
            K+MD+KM+N+IL DIKNGGFR +R  N+             + YR KRR+LM+++RLE  
Sbjct: 797  KEMDVKMINKILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMRKRRLEIG 856

Query: 758  HNKKLMTNKKSHAFLESMVDDIVEVKNPFDERDDNIMDDTPETDAEGDVNSNELLN---- 813
               KL+ N KS AF ESMV+DI+E KNPF   +++  D T  T  + D   N  LN    
Sbjct: 857  DGTKLVKNPKSKAFFESMVEDIMEYKNPFRAEEESNQDIT-STATDLDTLDNNSLNVRDS 915

Query: 814  -----------KKKKFILSEAFVQKSLSFLSSSRNLEEFEMNNNLAKEQHSH---AATDM 859
                       K KK I+SE FVQKSLSFL S+ N  EFEM+  LAK QH +      D+
Sbjct: 916  TRNNEKGPVDDKSKKIIISEDFVQKSLSFLKSN-NYNEFEMDKELAKMQHGNDDEPIEDL 974

Query: 860  FALKSHCSIKSLESLPGSHNNSISSK-----LDLLH--------EEIVSTPFSGLKQTSV 906
            F LK H SIKS  +   S  +S +S+     +DL          E   S+  SG K  S+
Sbjct: 975  FTLKQHSSIKSFTN---SQTDSFTSRTVTTMIDLEKRTEDEDEMENGDSSLVSGFKHPSI 1031

Query: 907  XXXXXXXXXXXXXXXXGNKTVKVSKSYRTVGSAKASITYLGKARKLV 953
                            GNKTVK+SKSY+ VGS+KASITY+GK RKL+
Sbjct: 1032 VKSFASRTDINDKFKEGNKTVKISKSYKMVGSSKASITYMGKTRKLM 1078

 Score = 82.0 bits (201), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 81/266 (30%), Positives = 129/266 (48%), Gaps = 44/266 (16%)

Query: 192 DKTQVD----KTQVD-KTQI--FPTLVADDEIKHSSTAVQTVDDNT-HSNSELKINEIER 243
           D+TQ+D     TQ D KTQI   P     ++     T  QT+ D   H+   LKI EI+ 
Sbjct: 256 DETQLDVMPQNTQSDNKTQIDTIPQTTHYEDKTQMDTMSQTLQDGVPHT---LKIREIQN 312

Query: 244 QLDEEDQILKEKSMGTEYKRNIAPVMSKVKFSKNDFLEHFXXXXXXXXXXGVVKLSSTEP 303
           +L  ED   +E++   EY +    + +K+KFSK  FL  F            +K+ S  P
Sbjct: 313 ELALEDS-RRERASNVEYTKPQKTIATKLKFSKESFLADFDDSSSNEDAE--IKVESAHP 369

Query: 304 ETAA--------MNLENSLPQFSKES--KFIGLSNYENILKKDINKQNCIEFSDSEDET- 352
           +            N+E S+ + +K++  +   LS+Y N LK++I+   CI          
Sbjct: 370 KPLGNEEELHEDKNIEPSINEVTKKTDKRVPLLSSYANNLKREIDSSKCITLDLDSGSDD 429

Query: 353 --------------EVTSKVSRASKATILSIKANLSRHKP--AQSSINNKNAL---GNLF 393
                         E    +S+ SKATIL++KA LS+     +Q  +  ++A      LF
Sbjct: 430 DDNIVVDDRKLIKDEGALPISQLSKATILNLKARLSKQNQDISQRPLEGRDARLDHNKLF 489

Query: 394 SDLKKATKAQILDHKKEIMEQKGYKM 419
           + L+KA++ QILDH++E++E KG+K+
Sbjct: 490 NTLRKASRKQILDHQREVIETKGFKL 515

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 34/98 (34%), Positives = 50/98 (51%), Gaps = 8/98 (8%)

Query: 1  MDFVFDGLDALKGKKR-TTYKKVT-----DGDVEDEPKISEFNIELPGL-GQSILFNNSK 53
          MD   + L +L+ KKR TTYKKV      D D  D    +   +  P L G   LF N+ 
Sbjct: 1  MDDALNALSSLRSKKRVTTYKKVAIHIPDDNDNTDGNLYTNDIVAPPALTGNGFLFANAT 60

Query: 54 LKQIRNRLEGXXXXXXXXXXQ-AETQVIADTQIISNLY 90
          L +++NRLEG          +  E + ++ +Q+I+NLY
Sbjct: 61 LNRVKNRLEGGKAPEQEHDNKDDEDEDVSSSQLIANLY 98

>Suva_3.152 Chr3 complement(228665..232087) [3423 bp, 1140 aa] {ON}
            YCL061C (REAL)
          Length = 1140

 Score =  269 bits (687), Expect = 1e-74,   Method: Compositional matrix adjust.
 Identities = 172/347 (49%), Positives = 214/347 (61%), Gaps = 37/347 (10%)

Query: 640  GITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAEN 699
            G+T+ FE+EAEESEDEWHG+GG DGE SDEYDSEVEKMIDDYSK  FN+ EIRE LAAEN
Sbjct: 763  GVTNFFEMEAEESEDEWHGVGGADGEGSDEYDSEVEKMIDDYSKNKFNSHEIREMLAAEN 822

Query: 700  KDMDLKMVNRILNDIKNGGFRKRR--NAXXXXXXXXXXXXXKAYRAKRRQLMKEKRLETD 757
            K+MD+KM+N+IL DIKNGGFR +R  N+             + YR KRR+LM+++RLE  
Sbjct: 823  KEMDVKMINKILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMRKRRLEIG 882

Query: 758  HNKKLMTNKKSHAFLESMVDDIVEVKNPFD---ERDDNIMDDTPETDAE-------GDVN 807
             + KL+ N KS AF ESMV+DI+E KNPF    E D ++     + D +       GD  
Sbjct: 883  DDTKLVKNPKSKAFFESMVEDIMEFKNPFGAEKESDQDVTSTATDLDTQDNDNTKPGDNT 942

Query: 808  SNELLN-----KKKKFILSEAFVQKSLSFLSSSRNLEEFEMNNNLAKEQHSHA---ATDM 859
            SN   N     K KK I+SE FVQKSLSFL S+ N +EFEM+  LA+ QH +      D+
Sbjct: 943  SNNEHNKHVGDKSKKLIISEDFVQKSLSFLKSN-NYDEFEMDRELARIQHGNGEGDVVDL 1001

Query: 860  FALKSHCSIKSLESLPGSHNNSISSK-----LDLLH--------EEIVSTPFSGLKQTSV 906
            F LK H SIKS  +   S  NS+SS+     ++L          E    +   G K  SV
Sbjct: 1002 FTLKQHSSIKSFTN---SQTNSLSSRTMNTVINLEEHTEGNDEGENGDQSLIGGFKHPSV 1058

Query: 907  XXXXXXXXXXXXXXXXGNKTVKVSKSYRTVGSAKASITYLGKARKLV 953
                            GNKTVK+SKSY+TVGS+KASITY+GK RKL+
Sbjct: 1059 IKSFASRTDINDKFKEGNKTVKISKSYKTVGSSKASITYMGKTRKLM 1105

 Score = 82.4 bits (202), Expect = 4e-15,   Method: Compositional matrix adjust.
 Identities = 78/244 (31%), Positives = 122/244 (50%), Gaps = 40/244 (16%)

Query: 208 PTLVADDEIKHSSTAVQTVDDNTHSNSELKINEIERQLDEEDQILKEKSMGTEYKR--NI 265
           P  V DD  +  + A QT+ D       LKI+E++ +L  ED   ++K+  TEY++    
Sbjct: 293 PPTVHDDRTQMDTVA-QTMQDKVPPT--LKIHELQSELALED-FNRKKAQNTEYRKLQKT 348

Query: 266 APVMSKVKFSKNDFLEHFXXXXXXXXXXGVVKLSSTEPETA-----AMNLENSLPQFS-- 318
            P++ +  FSK  FL  F             KL S++P+        +++  S PQ +  
Sbjct: 349 IPIVKR--FSKESFLADFDNSSSDEDTN--FKLESSQPKQQQNGYEMIDISQSNPQPAEK 404

Query: 319 ---KESKFIGLSNYENILKKDINKQNCIEF---------------SDSEDETEVTSKVSR 360
              K+ K   LS Y N LK++I+   CI                 +D  +E E    +S+
Sbjct: 405 ENKKDKKVPLLSTYANNLKREIDSSKCITLDLDSGSDKDNDNHMDTDKLNEDESALPISQ 464

Query: 361 ASKATILSIKANLSRH--KPAQSSINNKNALGN---LFSDLKKATKAQILDHKKEIMEQK 415
            SKATI ++KA LS+   K AQ S  NK+   +   L + L+KA++ QILDH++EI+E K
Sbjct: 465 LSKATIFNLKARLSKQNQKLAQGSNKNKDFKSDHNKLINTLRKASRKQILDHQREIVETK 524

Query: 416 GYKM 419
           G+K+
Sbjct: 525 GFKL 528

 Score = 47.8 bits (112), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 34/99 (34%), Positives = 51/99 (51%), Gaps = 10/99 (10%)

Query: 1   MDFVFDGLDALKGKKR-TTYKKVTDGDVEDEPKISEFNIELPGL-------GQSILFNNS 52
           MD   + L +L  KKR TTYKKV    + DE   ++ N+ + G+       G   LF N+
Sbjct: 44  MDDALNALSSLTSKKRATTYKKVA-SPILDENYDTDGNLPIDGMNAPPALTGNGFLFGNA 102

Query: 53  KLKQIRNRLEGXXX-XXXXXXXQAETQVIADTQIISNLY 90
            L +++NRLEG           + E + +  TQ+I+NLY
Sbjct: 103 TLNRVKNRLEGRNELGQDGQDKENEDEDVFSTQLIANLY 141

>Skud_3.3 Chr3 complement(6855..10313) [3459 bp, 1152 aa] {ON} YCL061C
            (REAL)
          Length = 1152

 Score =  261 bits (666), Expect = 7e-72,   Method: Compositional matrix adjust.
 Identities = 167/343 (48%), Positives = 214/343 (62%), Gaps = 30/343 (8%)

Query: 640  GITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAEN 699
            GIT+ FE+EAEESEDEWHG+GG DGE S+EYDSEVEKMIDDYSK +FN+ EIRE LAAEN
Sbjct: 775  GITNFFEMEAEESEDEWHGVGGADGEGSEEYDSEVEKMIDDYSKNSFNSHEIREMLAAEN 834

Query: 700  KDMDLKMVNRILNDIKNGGFRKRR--NAXXXXXXXXXXXXXKAYRAKRRQLMKEKRLETD 757
            K+MD+KM+NRIL DIKNGGFR +R  N+             + YR KRR+LM+++RLE  
Sbjct: 835  KEMDVKMINRILYDIKNGGFRNKRAKNSLELELSDDEDDVLQQYRLKRRELMRKRRLEIG 894

Query: 758  HNKKLMTNKKSHAFLESMVDDIVEVKNPFDERDDNIMD--------DTPETDA--EGDVN 807
             + KL+ N KS AF ESMV+DI+E KNPF   +++  D        DT + D+   GD  
Sbjct: 895  DDTKLVKNPKSKAFFESMVEDIMEFKNPFKAEEESHQDLTSTATDLDTQDNDSIQIGDST 954

Query: 808  SN----ELLNKKKKFILSEAFVQKSLSFLSSSRNLEEFEMNNNLAKEQH---SHAATDMF 860
             N     + ++ KK I+SE FVQKSLSFL S+ N +EFEM+   A+ QH        D+F
Sbjct: 955  RNNEHRRVDDRSKKTIISEDFVQKSLSFLRSN-NYDEFEMDKERARIQHDIGDEGVEDLF 1013

Query: 861  ALKSHCSIKSLESLPGSHNNS--ISSKLDLLH--------EEIVSTPFSGLKQTSVXXXX 910
             LK H SIKS  + P    +S  ++S +DL          E    +   G K  S+    
Sbjct: 1014 TLKQHSSIKSFTNSPTDSLSSKRVNSMIDLEQPTEDNNEVENEDPSLIGGFKHPSIIKSF 1073

Query: 911  XXXXXXXXXXXXGNKTVKVSKSYRTVGSAKASITYLGKARKLV 953
                        GNKTVK+SK+Y+TVGS+KASITY+GK RKL+
Sbjct: 1074 ASRTDINDKFKEGNKTVKISKTYKTVGSSKASITYMGKTRKLM 1116

 Score = 73.2 bits (178), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 78/254 (30%), Positives = 121/254 (47%), Gaps = 42/254 (16%)

Query: 198 KTQVDKTQIFPTLVADDEIK-HSSTAVQTV-DDNTHSNSELKINEIERQLDEEDQILKEK 255
           KTQ+D      T  A DE K    T  QT+ DD +H+   LKI E++ +L  ED   +EK
Sbjct: 314 KTQLDTM----TQTAHDEGKTQVDTMPQTIHDDVSHT---LKIRELQSELALEDS-KREK 365

Query: 256 SMGTEYKRNIAPVMSKVKFSKNDFLEHFXXXXXXXXXXGVV---KLSSTEPETAAMNLEN 312
           +   EYK++   + + + FSK  FL  F            +   +L   + +      + 
Sbjct: 366 ARNVEYKKSRRNIPTMINFSKESFLADFDNSSSDEGTDVQLEKSQLKQQQDDNEVHENKP 425

Query: 313 SLPQFSKESK-----FIGLSNYENILKKDINKQNCIEFSDS-----------------ED 350
           S P   K S+        LS+Y N LK++I+   CI                      +D
Sbjct: 426 SEPNSVKNSRESYKNVPLLSSYANNLKREIDSSKCIILDLDSDSDDDGDDYMGGNMSIKD 485

Query: 351 ETEVTSKVSRASKATILSIKANLSRHKPAQSSINNKNALGN-----LFSDLKKATKAQIL 405
           E+ +   +SR SKA IL++KA LS+     + + NKN         LF+ L+KA++ QIL
Sbjct: 486 ESALP--ISRLSKAAILNLKARLSKQSQNLTQMPNKNKGAKVDHNKLFNILRKASRKQIL 543

Query: 406 DHKKEIMEQKGYKM 419
           DH++E++E KG+K+
Sbjct: 544 DHQREVIETKGFKL 557

 Score = 39.3 bits (90), Expect = 0.054,   Method: Compositional matrix adjust.
 Identities = 33/98 (33%), Positives = 48/98 (48%), Gaps = 8/98 (8%)

Query: 1   MDFVFDGLDALKGKKR-TTYKKVTDG----DVEDEPKISEFNIELPG--LGQSILFNNSK 53
           MD V + L +L  KKR TTYKK+       D + +  +   N+  P    G   LF N+ 
Sbjct: 56  MDNVLEVLSSLTSKKRVTTYKKIASPIPDGDDDVDGDLLSNNMGAPPALTGNGFLFGNAT 115

Query: 54  LKQIRNRLEGXXXXXXXXXXQ-AETQVIADTQIISNLY 90
           L +++NRLEG          +  E +    TQ+I+NLY
Sbjct: 116 LNRVKNRLEGIDVPEDDRQIKDNENEDAVSTQLIANLY 153

>NDAI0A00140 Chr1 complement(8373..11648) [3276 bp, 1091 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1091

 Score =  258 bits (660), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 168/330 (50%), Positives = 210/330 (63%), Gaps = 18/330 (5%)

Query: 640  GITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAEN 699
            G+T  FE+EAEESEDEWHGIGG+DGE+SDEYDS+VEKMIDDYSK NF+  EIRE LAAEN
Sbjct: 724  GVTKFFEMEAEESEDEWHGIGGIDGEMSDEYDSDVEKMIDDYSKANFDPNEIREMLAAEN 783

Query: 700  KDMDLKMVNRILNDIKNGGFRKRRNA--XXXXXXXXXXXXXKAYRAKRRQLMKEKRLE-T 756
            K+MDL M+N+IL DIKNGGFRKR+                 + Y  KR++LM+++RLE  
Sbjct: 784  KEMDLNMINKILYDIKNGGFRKRKRGGLELELSEDEDDDALREYHLKRKELMRKRRLELG 843

Query: 757  DHNKKLMTNKKSHAFLESMVDDIVEVKNPFDERD---------DNIMDDTPETDAE-GDV 806
            D  KKL+ N KS AF ESMV+DI + KN F++           +N  DD  E DA     
Sbjct: 844  DDEKKLVKNPKSKAFFESMVEDITDDKNAFNDEPLGETSTQEINNTQDDMKEEDAAVVKE 903

Query: 807  NSNELLNKKKKFILSEAFVQKSLSFLSSSRNLEEFEMNNNLAKEQHSHAATDMFALKSHC 866
            N +    KKKK I+SE FVQ++LSFL SSR  EEF MN NLAKEQH     ++ +LK   
Sbjct: 904  NGDSKRIKKKKTIISEEFVQRTLSFLKSSREDEEFAMNENLAKEQHGTKVENLLSLKQQS 963

Query: 867  SIKSLESLPGSHNNSISSKL---DLLHEEIVSTPFSGLKQTSVXXXXXXXXXXXXXXXXG 923
            SIK  +S   S+N+S   KL   +   ++   +P +  K  S+                G
Sbjct: 964  SIKVFQS--PSNNSSKVIKLDDINNDDDDDEDSPIALFKVPSILKSFGSKTDINEKFQDG 1021

Query: 924  NKTVKVSKSYRTVGSAKASITYLGKARKLV 953
            NKTV +SKSYRTVGS+KASITYLGK+RKL+
Sbjct: 1022 NKTVTISKSYRTVGSSKASITYLGKSRKLM 1051

 Score = 72.4 bits (176), Expect = 4e-12,   Method: Compositional matrix adjust.
 Identities = 78/229 (34%), Positives = 117/229 (51%), Gaps = 34/229 (14%)

Query: 219 SSTA-VQTV-DDNTHSNSELKINEIERQLDEEDQILKEKSMGTEYKRNIAPVMSK-VKFS 275
           SSTA V TV DD   S S L I++ +++L+EE+Q L   S   EYK    P+++  VKF+
Sbjct: 282 SSTALVGTVADDKLSSGSNLAIHKFQKELEEEEQ-LANNSKYKEYKGISKPILTNIVKFT 340

Query: 276 KNDFLEHFXXXXXXXXXXGVVKLSSTEPETAAMNLENSLPQFSKES-------------- 321
           K+ FL+ F             K+  T+         NS    +  S              
Sbjct: 341 KDSFLQGFDNSSSSSSEEEGDKVKETKRNGKENTSSNSYSTKNNNSTASSDGTTIKPKIK 400

Query: 322 ------KFIGLSNYENILKKDINKQNCIEFS---DSEDETEVTSKVSRASKATILSIKAN 372
                 K   LS YEN LK  +N +N ++     +S D+TE +  VSR SKATIL+IKA 
Sbjct: 401 SPKKFSKLNTLSRYENKLKTVLNSKNQLQLGSDDESSDDTENSLPVSRTSKATILTIKAR 460

Query: 373 LSRHKPAQS-----SINNKNALGNLFSDLKKATKAQILDHKKEIMEQKG 416
           LS+ K  ++     ++N    L  LF +LKK+++ QIL++++E++E KG
Sbjct: 461 LSKQKSKKNVQKDGTVNTN--LNKLFENLKKSSRKQILENQRELIENKG 507

>KAFR0D00140 Chr4 complement(13233..16358) [3126 bp, 1041 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1041

 Score =  257 bits (657), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 168/363 (46%), Positives = 213/363 (58%), Gaps = 29/363 (7%)

Query: 640  GITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAEN 699
            GIT+  E EAEESEDEWHGIGG+DGE+SDEYDSEVEKMIDDYSK NFN  EIR+ LA EN
Sbjct: 689  GITNFLEEEAEESEDEWHGIGGIDGEMSDEYDSEVEKMIDDYSKANFNPDEIRQMLADEN 748

Query: 700  KDMDLKMVNRILNDIKNGGFRKRR-NAXXXXXXXXXXXXXKAYRAKRRQLMKEKRLETDH 758
            K+ D+KMV +IL DIKNGGFRKRR  A             K YR KRR+LM++KRLE   
Sbjct: 749  KETDIKMVEKILYDIKNGGFRKRRKGAMDLELSDEEDDELKQYRLKRRELMRQKRLEVGE 808

Query: 759  NKKLMTNKKSHAFLESMVDDIVEVKNPF----DERDDNIMDDTPETDAEGDVNSNELL-- 812
             + L+ N KS AF ESMVDDIVEVKNPF     +R   I   T +   + + NSNE    
Sbjct: 809  AETLVKNPKSKAFFESMVDDIVEVKNPFAVFEPQRSGTI---TTDDGTQENANSNEGAAS 865

Query: 813  -NKKKKFILSEAFVQKSLSFLSSSRNLEEFEMNNNLAKEQHSHAATDMFALKSHCSIKSL 871
             N  KK +LSE FVQ++LSFL+SS+++++F    ++  E +     D+ ALK   SIKS 
Sbjct: 866  QNPSKKVMLSEEFVQRTLSFLNSSKDMDQFAPARSMRAEANDELIEDLTALKKQSSIKSF 925

Query: 872  ESLPGSHNNSIS--------SKLDLLHEEIVSTPFSGLKQTSVXXXXXXXXXXXXXXXXG 923
            ++   S +   +        S  DLL+  + +        +S+                G
Sbjct: 926  KTTRASVSQEPTDFDKENDDSFDDLLNSRVGT--------SSIMKTFSATVDINDKFQEG 977

Query: 924  NKTVKVSKSYRTVGSAKASITYLGKARKLVXXXXXXXXXXXX--XXXTASASRLFDEQDN 981
             KTVKVSK+Y++V S+KASITY+GK RKLV                  +  S+LF  QD 
Sbjct: 978  VKTVKVSKAYKSVSSSKASITYMGKMRKLVAPQKKVANLSSSDIKNTNSRTSKLFSRQDE 1037

Query: 982  SFE 984
            SFE
Sbjct: 1038 SFE 1040

 Score = 81.3 bits (199), Expect = 8e-15,   Method: Compositional matrix adjust.
 Identities = 78/252 (30%), Positives = 126/252 (50%), Gaps = 43/252 (17%)

Query: 188 KTQVDKTQVDKTQVDKTQIFPTLVADDEIKHSSTAVQTVDDNTHSNSELKINEIERQLDE 247
           KTQ D + V KTQ+D T               ++   TV D       LKI+EI+R+L+E
Sbjct: 265 KTQKDTSAVLKTQIDST------------TEGTSYSATVSDT------LKIHEIQRELEE 306

Query: 248 EDQILKEKSMGTEYKRNIAPVMSKVKFSKNDFLEHFXXXXXXXX--------XXGVVKLS 299
                K K++  EYK+++    + + F+K  + + F                   V  L 
Sbjct: 307 SQ---KTKTI-PEYKQHVRTPKNVIVFTKESYFDEFDSDDEEKEENLESEGDSQKVQLLK 362

Query: 300 STEPETAAMNLENSLPQFSKES-----KFIGLSNYENILKKDINKQNCIEFS-DSEDETE 353
           +T P   + N    LP  ++ S     K  GL+NYE  LK+ +N    I+ + DS+DE  
Sbjct: 363 NTSPSDKS-NDGKRLPDKTRTSPSFKPKLHGLNNYELKLKRQLNSDQQIDLNLDSDDEDG 421

Query: 354 V-----TSKVSRASKATILSIKANLSRHKP-AQSSINNKNALGNLFSDLKKATKAQILDH 407
           +        +S+ SKAT+  IKA LS+ +P  + S ++K  L  LF+ L+KA++ QI++H
Sbjct: 422 IDRMGEKGPISQMSKATVFDIKARLSKKRPIVKISNDSKTTLHTLFNKLQKASRQQIIEH 481

Query: 408 KKEIMEQKGYKM 419
           +KE++E+KG  +
Sbjct: 482 QKEVIEKKGLNL 493

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 40/91 (43%), Positives = 54/91 (59%), Gaps = 9/91 (9%)

Query: 1  MDFVFDGLDALKGKKRTTYKKVTDGDVEDEPKISEFNIELPGL-GQSILFNNSKLKQIRN 59
          MD +F  L ALK KKRTTYKK++D D+E++   SE N + P L G+  LF+N  L +I+ 
Sbjct: 1  MDGIFGNLQALKPKKRTTYKKISD-DLEND--TSESNNDPPALTGEGFLFDNPTLNRIKK 57

Query: 60 RLEGXXXXXXXXXXQAETQVIADTQIISNLY 90
          RL+G             T   + TQ+ISNLY
Sbjct: 58 RLDGEEKDVVQY-----TMNFSQTQLISNLY 83

>NCAS0B09110 Chr2 (1746358..1749420) [3063 bp, 1020 aa] {ON} Anc_1.5
            YCL061C
          Length = 1020

 Score =  253 bits (647), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 162/363 (44%), Positives = 206/363 (56%), Gaps = 37/363 (10%)

Query: 640  GITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAEN 699
            G+  +FE+EAEESEDEWHGIGG DGE+SDEYDSEVEKMIDDYSK NFN  EIR+ LA EN
Sbjct: 675  GVNKLFEMEAEESEDEWHGIGGADGEVSDEYDSEVEKMIDDYSKSNFNPDEIRQMLALEN 734

Query: 700  KDMDLKMVNRILNDIKN---GGFRKRRNAXXXXXXXXXXXXXKAYRAKRRQLMKEKRLET 756
            K+MDL M+ +IL DIKN      R+                 + Y  ++R+LMK++ LE 
Sbjct: 735  KEMDLNMITKILYDIKNGGFRKRRRGGLDLELSDDDEDDEELREYHKRKRELMKKRMLEI 794

Query: 757  DHNKKLMTNKKSHAFLESMVDDIVEVKNPF-------------DERDDNIMDDTPETDAE 803
              +KKL+ N KS AF ESMV+DIV+ KN F             D +++   D TP  D  
Sbjct: 795  GDDKKLIKNPKSKAFFESMVEDIVDEKNAFGDIESIEKSSTELDTQEEKEQDVTPGVD-- 852

Query: 804  GDVNSNELLNKKKKFILSEAFVQKSLSFLSSSRNLEEFEMNNNLAKEQHSHAATDMFALK 863
                       KKK ++SE FVQK+LSFL S R+LEEF +  +LAKEQH     D+F+LK
Sbjct: 853  -----------KKKNVISEEFVQKTLSFLRSGRDLEEFNIEEDLAKEQHGENVEDLFSLK 901

Query: 864  SHCSIKSLESLPGSHNNSISSKLDLLH--EEIVSTPFSGLKQTSVXXXXXXXXXXXXXXX 921
               +IK         N S ++ +DL++  E + S+P  G K  SV               
Sbjct: 902  QRSTIKEF------RNPSQTNTIDLINNVENVESSPLGGFKPPSVIKSFSSRTDINEKFK 955

Query: 922  XGNKTVKVSKSYRTVGSAKASITYLGKARKLVXXXXXXXXXXXXXXXTASASRLFDEQDN 981
             GNKTV +SK Y+TVGS+KASITYLGK+RKL+                 + S LF   D 
Sbjct: 956  DGNKTVTISKVYKTVGSSKASITYLGKSRKLMPPKKNKNREKIGSKIKPTRSSLFSSHDE 1015

Query: 982  SFE 984
            SFE
Sbjct: 1016 SFE 1018

 Score = 70.1 bits (170), Expect = 2e-11,   Method: Compositional matrix adjust.
 Identities = 62/192 (32%), Positives = 105/192 (54%), Gaps = 19/192 (9%)

Query: 236 LKINEIERQLDEEDQILKEKSMGTEYKRNIAPV-MSKVKFSKNDFLEHFXXXXX--XXXX 292
           LKI+EI+++L+ E    +      EYK+    + +  +KFSK   L+ F           
Sbjct: 278 LKIHEIQKELERE----RNSKELKEYKKPSKEIKVIPIKFSKTSLLDGFDNSSSDDELEV 333

Query: 293 XGVVKLSSTE--PETAAMNLENSLPQFSKESKFIGLSNYENILKKDINKQNCIEFSDSED 350
              +K++ T+  PE++            K  K  GL+ YEN LKK + ++  I+     D
Sbjct: 334 QKDMKITRTKEKPESSIK-------PKIKPKKLTGLNTYENKLKKKLLEKKHIQLDSDSD 386

Query: 351 ETEVTSK---VSRASKATILSIKANLSRHKPAQSSINNKNALGNLFSDLKKATKAQILDH 407
                +K   +SR SKAT+L++KA LS+ KP +S+ +   +L  LF +LK+A++ QILDH
Sbjct: 387 NDSDIAKRFPISRTSKATLLNLKARLSKKKPVKSNKSTNTSLDVLFQNLKQASRKQILDH 446

Query: 408 KKEIMEQKGYKM 419
           ++E++E +G+K+
Sbjct: 447 QRELVENRGFKL 458

 Score = 48.5 bits (114), Expect = 9e-05,   Method: Compositional matrix adjust.
 Identities = 29/92 (31%), Positives = 49/92 (53%), Gaps = 9/92 (9%)

Query: 1  MDFVFDGLDALKGKKRTTYKKVTDGDVEDEPKISEF--NIELPGLGQSILFNNSKLKQIR 58
          M+ +F+     K +++TTYKK+ +    DE  ++E    +  P +G   +F N+ + +IR
Sbjct: 1  MESIFEEFSLPKKQRKTTYKKIHEEPNNDEEALTEAVDVMAPPVIGNGFIFGNALIDKIR 60

Query: 59 NRLEGXXXXXXXXXXQAETQVIADTQIISNLY 90
          NRL+G          + +T V   TQ+I NLY
Sbjct: 61 NRLDG-------KENKEDTPVPTQTQMIDNLY 85

>SAKL0C00462g Chr3 complement(41257..44790) [3534 bp, 1177 aa] {ON}
            some similarities with uniprot|P25588 Saccharomyces
            cerevisiae YCL061C MRC1 S-phase checkpoint protein found
            at replication forks required for DNA replication also
            required for Rad53p activation during DNA replication
            stress where it forms a replication-pausing complex with
            Tof1p and is phosphorylated by Mec1p protein involved in
            replication checkpoint
          Length = 1177

 Score =  249 bits (635), Expect = 9e-68,   Method: Compositional matrix adjust.
 Identities = 150/332 (45%), Positives = 206/332 (62%), Gaps = 25/332 (7%)

Query: 640  GITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAEN 699
            G++ MFE+EAEESEDEWHG+GG DGELSDEYDSE+EKM+DDY+K  F+  EIR+ LAAE+
Sbjct: 814  GVSKMFEMEAEESEDEWHGVGGADGELSDEYDSELEKMVDDYTKTTFDPAEIRQMLAAED 873

Query: 700  KDMDLKMVNRILNDIKNGGFRKR-RNAXXXXXXXXXXXXXKAYRAKRRQLMKEKRLETDH 758
            K+ D K+VN+IL+DIKNGGFR+R + A             + Y AKRR+L+++K LE   
Sbjct: 874  KEYDEKIVNKILHDIKNGGFRRRGKGALDIELSDDEDDELQRYHAKRRELLRQKVLENGE 933

Query: 759  NKKLMTNKKSHAFLESMVDDIVEVKNPF------DERDDNI-----MDDTPETDAEGDVN 807
              KL++N KSHAF ESMV+D+VE KNPF      D     I     +D+  E   + D  
Sbjct: 934  ASKLVSNPKSHAFFESMVEDLVESKNPFSIGETADPDSGAISENDKVDNASEHGTQPDAG 993

Query: 808  SNELLNKKKKFILSEAFVQKSLSFLSSSRNLE-EFEMNNNLAKEQHSHAA------TDMF 860
               +  ++K+  +S+ FVQ+SLSFL+S   L+ EFE++  LAK QHS          D+F
Sbjct: 994  GQPVRTERKRIKISQEFVQRSLSFLNSKDELDNEFELDRRLAKHQHSTLGDDNDDLEDLF 1053

Query: 861  ALKSHCSIKSLESLPGSHNNSISSKLDLLHEEIVSTPFSGLKQTSVXXXXXXXXXXXXXX 920
             LK +  IK+L +   + + ++  ++D       ++P +G K  SV              
Sbjct: 1054 TLKQNSCIKTLHTPARTSSRTVDLEVD------GNSPANGFKLPSVISSFSSRIDINEKF 1107

Query: 921  XXGNKTVKVSKSYRTVGSAKASITYLGKARKL 952
              G KTVKVSKSY+T+G ++ASITYLGK RKL
Sbjct: 1108 KEGTKTVKVSKSYKTIGGSRASITYLGKVRKL 1139

 Score = 73.9 bits (180), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 87/305 (28%), Positives = 132/305 (43%), Gaps = 79/305 (25%)

Query: 187 GKTQVDKTQVDKTQ--VDKTQIFPTLVADD----EIKHSSTAVQT--------------- 225
           G+TQ    +VDKTQ  ++ T   PTL  +D     +   S AV T               
Sbjct: 213 GETQ----EVDKTQRILEATARDPTLSEEDFVAATVADGSEAVTTQLDTCVPDTSALGDV 268

Query: 226 ----VDDNTHSNSE-LKINEIERQLDEEDQILKEKSMGTEYKRNIAPVMSKVKFSKNDFL 280
                D + H NS+ L I+EIE+ LD E++  +EK + TE K +   ++ K KF K  FL
Sbjct: 269 QPTAPDQSAHRNSQRLLIHEIEKDLDAEEE--REKRI-TEAKPHDVVLVVKKKFDKEAFL 325

Query: 281 EHFXXXXXXXXXXGVVKLSS-----TEPETAAMNLENSLP---------------QFS-- 318
            +F             +        +EP +    L  S+P                F+  
Sbjct: 326 NNFDCSSSEGEEQEQEEQEEQTHLESEPASKRRKLFTSVPGNPLDSKDSEAGGSGNFASA 385

Query: 319 -------------------KESKFIGLSNYENILKKDINKQNCIEFSDSEDETEVTSKVS 359
                              +E+ ++ L++Y+N LK  ++ +  I+   S DE E +   S
Sbjct: 386 IAATIGTTTDEGRSTRKDKEEAGWVPLNSYKNQLKARLDSKEHIDLDSSSDEDENSVPAS 445

Query: 360 RASKATILSIKANLSRHKP-----AQSSINNKNALGNLFSDLKKATKAQILDHKKEIMEQ 414
           + SKA +L IKA  S+ +       Q S     +L  LFS LKKA K QILDH++EI E+
Sbjct: 446 KMSKAAVLEIKARTSKRQGIKKTRQQPSTPRAPSLKELFSSLKKANKKQILDHRREITEK 505

Query: 415 KGYKM 419
           +G  +
Sbjct: 506 RGLNL 510

>YCL061C Chr3 complement(18816..22106) [3291 bp, 1096 aa] {ON}
            MRC1S-phase checkpoint protein required for DNA
            replication; interacts with and stabilizes Pol2p at
            stalled replication forks during stress, where it forms a
            pausing complex with Tof1p and is phosphorylated by
            Mec1p; protects uncapped telomeres
          Length = 1096

 Score =  248 bits (633), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 162/345 (46%), Positives = 209/345 (60%), Gaps = 35/345 (10%)

Query: 640  GITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAEN 699
            G+T+ FE+EAEESEDEWHGIGG DGE SD+YDS++EKMIDDYSK NFN  EIRE LAAEN
Sbjct: 714  GVTNFFEMEAEESEDEWHGIGGADGEGSDDYDSDLEKMIDDYSKNNFNPHEIREMLAAEN 773

Query: 700  KDMDLKMVNRILNDIKNGGFRKRR---NAXXXXXXXXXXXXXKAYRAKRRQLMKEKRLET 756
            K+MD+KM+N+IL DIKNGGFR +R   +              + YR KRR+LM+++RLE 
Sbjct: 774  KEMDIKMINKILYDIKNGGFRNKRAKNSLELELSDDDEDDVLQQYRLKRRELMRKRRLEI 833

Query: 757  DHNKKLMTNKKSHAFLESMVDDIVEVKNPFDERDDNIMDDTPET-------------DAE 803
              + KL+ N KS AF ESMV+DI+E KNPF   ++  +D T                D  
Sbjct: 834  GDDAKLVKNPKSSAFFESMVEDIIEYKNPFGAEEEYNLDITSTATDLDTQDNSINVGDNT 893

Query: 804  GDVNSNELLNKKKKFILSEAFVQKSLSFLSSSRNLEEFEMNNNLAKEQHSH--AATDMFA 861
            G+     +  K KK I+SE FVQKSLSFL S+ N E+FE +  L++ QH +  A  D++ 
Sbjct: 894  GNNEQKPVDQKNKKVIISEDFVQKSLSFLKSN-NYEDFETDKELSRIQHGNDEAIEDLYT 952

Query: 862  LKSHCSIKSLESLPGSHNNSISSK-----LDLLHE-------EIVSTPFSGL-KQTSVXX 908
            LK + SIKS  +   S  +S +SK     +DL          E   T   G+ K  S+  
Sbjct: 953  LKQNSSIKSFTN---SQTDSTTSKTVNTIIDLEKRPEDEDEVENGDTSLVGVFKHPSIIK 1009

Query: 909  XXXXXXXXXXXXXXGNKTVKVSKSYRTVGSAKASITYLGKARKLV 953
                          GNKTVK+ KSY+TVGS+KASITY+GK RKL+
Sbjct: 1010 SFASRTDINDKFKEGNKTVKILKSYKTVGSSKASITYMGKTRKLI 1054

 Score = 75.5 bits (184), Expect = 5e-13,   Method: Compositional matrix adjust.
 Identities = 82/266 (30%), Positives = 122/266 (45%), Gaps = 43/266 (16%)

Query: 189 TQVDKTQVDKTQVDKTQIF--PTLVADDEIKHSSTAVQTVDDNT-HSNSELKINEIERQL 245
           TQ+D         DKTQ    P     ++     T  QT+ D   H+   LKI EI+ +L
Sbjct: 242 TQMDVPPQTAHDEDKTQAIGIPQATHQEQKTQIDTVAQTLQDEVPHT---LKIREIQSEL 298

Query: 246 DEEDQILKEKSMGTEYKRNIAPVMSKVKFSKNDFLEHFXXXXXXXXXXGVVKLSSTEP-- 303
             ED   +EK+   EYK+   P+ +K  FSK  FL               +KL +  P  
Sbjct: 299 ASEDS-KREKARNVEYKKPQKPIPTKKFFSKESFLA--DFDDSSSNEDDDIKLENAHPKP 355

Query: 304 --------ETAAMNLENSLPQFSKESKFIGLSNYENILKKDINKQNCI---------EFS 346
                   E  ++ L  +      E +   LS+Y N LK++I+   CI         E+ 
Sbjct: 356 VQNDDELHENKSVELNLTDETRINEKRVPLLSSYANNLKREIDSSKCITLDLDSDSDEYG 415

Query: 347 D--------SEDETEVTSKVSRASKATILSIKANLSRHKPAQSSINNKNALGN-----LF 393
           D        S+DE+ +   +S+ SKATIL++KA LS+     S   NK+         L 
Sbjct: 416 DDDMDSIKLSKDESVLP--ISQLSKATILNLKARLSKQNQKLSQRPNKSKDPKVDHNVLL 473

Query: 394 SDLKKATKAQILDHKKEIMEQKGYKM 419
           + L+KA++ QILDH+KE++E KG K+
Sbjct: 474 NTLRKASRKQILDHQKEVIETKGLKL 499

 Score = 42.4 bits (98), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 34/106 (32%), Positives = 50/106 (47%), Gaps = 25/106 (23%)

Query: 1  MDFVFDGLDALKGKKRTT-YKKV----------TDG----DVEDEPKISEFNIELPGLGQ 45
          MD     L +L  KKRTT YKKV          T+G    D+++ P+++         G 
Sbjct: 1  MDDALHALSSLTAKKRTTTYKKVAVPILDENDNTNGNGPNDIDNPPELT---------GN 51

Query: 46 SILFNNSKLKQIRNRLEGXXXXXXXXXX-QAETQVIADTQIISNLY 90
            LF N+ L +++NRLEG           +  ++    TQ+ISNLY
Sbjct: 52 GFLFANATLNRVKNRLEGKKAPEQNHNNGKDRSENSLPTQLISNLY 97

>KNAG0C00220 Chr3 complement(33011..36496) [3486 bp, 1161 aa] {ON}
            Anc_1.5 YCL061C
          Length = 1161

 Score =  243 bits (619), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 151/323 (46%), Positives = 200/323 (61%), Gaps = 12/323 (3%)

Query: 640  GITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAEN 699
            G+++ FE EAEESEDEWHGIGG+DGE+SDEYDSEVEKMIDDYS+ + +  EIR+ L +EN
Sbjct: 809  GVSNFFEEEAEESEDEWHGIGGIDGEVSDEYDSEVEKMIDDYSRADMDPEEIRKLLVSEN 868

Query: 700  KDMDLKMVNRILNDIKNGGFRKR-RNAXXXXXXXXXXXXXKAYRAKRRQLMKEKRLETDH 758
            K+MD+KMVN+IL DIKNG FRKR R+              + YR KR +LMK++ L+   
Sbjct: 869  KEMDVKMVNKILFDIKNGNFRKRGRDTLELELSDEEDDDLRQYRQKRNELMKQRLLDLGD 928

Query: 759  NKKLMTNKKSHAFLESMVDDIVEVKNPFDERDDNIMDDTPETDAEGDVNSNELLNKK--- 815
            +KKL+ N K+ AF +S+V+DIVEVKNPF    DN   DT ET          + NK+   
Sbjct: 929  DKKLVKNVKTKAFFDSLVEDIVEVKNPFGVMSDNETQDTDETTTIDTQTRESVSNKEEKP 988

Query: 816  -----KKFILSEAFVQKSLSFLSSSRNLEEFEMNNNLAKEQHSHAATDMFALKSHCSIKS 870
                 KK +LSE FVQ+SLSFL+S+RNL EFE N +LA+ QH    +D++ LK   S+KS
Sbjct: 989  TQEKGKKTVLSEEFVQRSLSFLNSNRNLTEFEQNQDLARLQHDDDVSDLYTLKKQSSVKS 1048

Query: 871  LESLPGSHNNSISSKLDLLHEEIVSTPFSGLKQTSVXXXXXXXXXXXXXXXXGNKTVKVS 930
             +S+ GS N  I+  +D       +   +  +  S+                G KTVK  
Sbjct: 1049 FKSV-GSKNEIIN--VDANDNSGTAVATATFRPPSIIKSFNSKLNVDDKFRNGKKTVKTF 1105

Query: 931  KSYRTVGSAKASITYLGKARKLV 953
            KSY+ VG +K S+TY+ K RKL 
Sbjct: 1106 KSYKAVGGSKTSVTYMNKVRKLT 1128

 Score = 85.9 bits (211), Expect = 4e-16,   Method: Compositional matrix adjust.
 Identities = 69/204 (33%), Positives = 106/204 (51%), Gaps = 15/204 (7%)

Query: 226 VDDNTHSNSELKINEIERQLDEEDQILKEKSMGTEYKRNIA-PVMSKVKFSKNDFLEHFX 284
            DD     + LKI+EI+ Q+DEE + +  +  G E++++   P   +V+F+K  F+  F 
Sbjct: 406 ADDVKSGGNTLKIHEIQTQIDEETRNMLNR--GVEHRKSRGVPSRVEVRFTKESFMADFE 463

Query: 285 XXXXXXXXXGVV-KLSSTEPETAAM-----NLENSLPQFSKESKFIGLSNYENILKKDIN 338
                        +++ T PET +      N      +  K  +  GLS+YE IL+  +N
Sbjct: 464 ESDSASDMESDSDQINDTTPETGSSQNSDSNKARKPTEAPKTKRVTGLSSYETILRNKVN 523

Query: 339 KQNCIEFSD-----SEDETEVTSKVSRASKATILSIKANLSRHKPAQSSIN-NKNALGNL 392
              C++        SE+E +  SKVS+ASKA +L+IKA   + K    + N NK  L +L
Sbjct: 524 DDECLDLGSDDTYSSEEEYDKESKVSQASKAAVLNIKAKALKKKAIVKAANTNKTTLDSL 583

Query: 393 FSDLKKATKAQILDHKKEIMEQKG 416
           FSDLKK  + QIL H+ EI+  KG
Sbjct: 584 FSDLKKKNRQQILSHQAEIIGTKG 607

 Score = 38.1 bits (87), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 27/94 (28%), Positives = 47/94 (50%), Gaps = 5/94 (5%)

Query: 1  MDFVFDGLDALKGKKRTTYKKVTDGDVEDEPKISEFNIELPGLGQSILFNNSKLKQIRNR 60
          MD + +  +++K K+RTTYKKV      DE    +  +     G   LF N+ + +I+NR
Sbjct: 1  MDDLLERFNSVKVKRRTTYKKVQQNST-DEAAGDDDCVPTSLAGNGFLFGNATVDKIKNR 59

Query: 61 L---EGXXXXXXXXXXQAETQV-IADTQIISNLY 90
          L   +            +E Q+ ++ +Q++S LY
Sbjct: 60 LNNEDHPNSSIDVTKSSSEDQIPVSQSQLLSTLY 93

>TBLA0A07570 Chr1 (1874419..1878177) [3759 bp, 1252 aa] {ON} Anc_1.5
            YCL061C
          Length = 1252

 Score =  229 bits (584), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 151/355 (42%), Positives = 193/355 (54%), Gaps = 50/355 (14%)

Query: 640  GITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAEN 699
            G + MF++EAEESEDEW GIGG DGE+SDEYDSEVEK+IDDYS+++FN  EIR KL  EN
Sbjct: 872  GASKMFDMEAEESEDEWFGIGGADGEVSDEYDSEVEKLIDDYSRQDFNPDEIRNKLMNEN 931

Query: 700  KDMDLKMVNRILNDIKNGGFRKR-RNAXXXXXXXXXXXXXKAYRAKRRQLMKEKRLETDH 758
            K+MD+KMVNRIL DIKNGGFRKR RN              + YR KRR++MK+KRLE  +
Sbjct: 932  KEMDIKMVNRILYDIKNGGFRKRNRNNIDLELSDDEDDELREYRIKRREIMKKKRLEVTN 991

Query: 759  NKKLMTNKKSHAFLESMVDDIVEVKNPFDERDDNIMDDTPETDAEGDVNSNELLNK---- 814
              K++   KS AF  SMVDDIVE  NPF       M   P  D   D N + + NK    
Sbjct: 992  TDKILKTSKSKAFFMSMVDDIVETSNPF-------MITQPSDDDSDDNNMDSISNKNHKD 1044

Query: 815  -----------------------KKKFILSEAFVQKSLSFLSSSRNLEEFEMNNNLAKEQ 851
                                   +KKF++SE FV K+LSFL+ S+ + EF+  N   K Q
Sbjct: 1045 ANNAKKDKKDKRTDDHARLSQSSRKKFVMSEDFVHKTLSFLTKSKEVNEFQHVNEHYKSQ 1104

Query: 852  HSHAATDMFALKSHCSIKSLESLP-GSHNNSI------SSKLDLLH-----EEIVSTPFS 899
                  D+ +LK   SIK++  L   S + ++          D++H     +     P S
Sbjct: 1105 IG-TINDIQSLKQKSSIKTMHVLSMMSQDTNVDLDASDKDDDDMIHHAGSFDNSFDDPLS 1163

Query: 900  GL-KQTSVXXXXXXXXXXXXXXXXGNKTVKVSKSYRTVGSAKASITYLGKARKLV 953
             + K  S+                GNKTV +S SY+TVG  K SIT  G+ RKLV
Sbjct: 1164 SVSKAPSIIKIFGSTHDINDKFKDGNKTVTISNSYKTVGGMKTSITSFGR-RKLV 1217

 Score = 64.3 bits (155), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/104 (42%), Positives = 62/104 (59%), Gaps = 1/104 (0%)

Query: 317 FSKESKFIGLSNYENILKKDINKQNCIE-FSDSEDETEVTSKVSRASKATILSIKANLSR 375
            +K  + + LS YEN LK+++   N I+ +SDSE+ T+     S ASKA IL I+  LS+
Sbjct: 571 IAKPKRKVILSQYENRLKENLLYNNSIDLYSDSEENTQSDILFSTASKAQILDIRHKLSK 630

Query: 376 HKPAQSSINNKNALGNLFSDLKKATKAQILDHKKEIMEQKGYKM 419
            KP       +  L  LF+ LKKA+K QI DH+K  +E KG K+
Sbjct: 631 KKPQVKKKTIQTNLDQLFNKLKKASKKQIFDHQKNAIESKGLKL 674

 Score = 49.3 bits (116), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 32/65 (49%), Positives = 38/65 (58%), Gaps = 5/65 (7%)

Query: 1  MDFVFDGLDALKGKKRTTYKKVTDGDVEDEPKISEFNIELP----GLGQSILFNNSKLKQ 56
          MD VFD LD LK KKRTTYKKV +  V  E   +   I  P     L +  LF N KL++
Sbjct: 3  MDAVFDSLDELKIKKRTTYKKVPE-QVATELDKAATTISNPVPSFNLSEGFLFANDKLEK 61

Query: 57 IRNRL 61
          I+NRL
Sbjct: 62 IKNRL 66

>ZYRO0F18480g Chr6 (1524051..1526933) [2883 bp, 960 aa] {ON} weakly
           similar to uniprot|P25588 Saccharomyces cerevisiae
           YCL061C MRC1 S-phase checkpoint protein found at
           replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 960

 Score =  222 bits (566), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 150/352 (42%), Positives = 204/352 (57%), Gaps = 23/352 (6%)

Query: 640 GITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAEN 699
           G+  M E+EAEESEDEW G+GGVDG+LSDE+DS++E+MIDD++K N N  ++R+ LA EN
Sbjct: 624 GLNKMLEMEAEESEDEWKGVGGVDGDLSDEHDSDLEEMIDDFTKSNENFDDVRQLLAKEN 683

Query: 700 KDMDLKMVNRILNDIKNGGFRKR-RNAXXXXXXXXXXXXXKAYRAKRRQLMKEKRLETDH 758
           K++D KMVN+IL DIKNGGFRKR RNA             + YR KRR+LMK+ R+E   
Sbjct: 684 KELDEKMVNKILYDIKNGGFRKRGRNALDLELSDDEDEDLRNYRLKRRELMKKSRIEGKD 743

Query: 759 NKKLMTNKKSHAFLESMVDDIVEVKNPFDERDDNIMDDTPETDAEGDVNSNELLNKKKKF 818
            +K   N KS AFLESMVDDI E KNPF + + ++ D+T     + D   N+    K+K 
Sbjct: 744 KEKAFRNAKSKAFLESMVDDIDESKNPFGDPEMDVEDNT-----DVDTQENDYPKNKEKN 798

Query: 819 ILSEAFVQKSLSFLSSSRNLEEFEMNNNLAKEQHSHAATDMFALKSHCSIKSLESLPGSH 878
            LS+ FVQ+SLSFLS++ +  EFE+   +          D+ +LK + SI +L      H
Sbjct: 799 TLSQEFVQRSLSFLSNNNSSREFELGEQIT---LGDEEQDVSSLKRNSSIHAL------H 849

Query: 879 NNSISSKLDL----LHEEIVSTPFSGLKQTSVXXXXXXXXXXXXXXXXGNKTVKVSKSYR 934
           N+S   K DL      E+ ++ P    K  S+                G KTV VSKSYR
Sbjct: 850 NSSSPIKEDLEKENQDEDFITLP--NFKPPSLIKSLAGGFDPNNKFQSGKKTVTVSKSYR 907

Query: 935 TVGSAKASITYLGKARKLVXXXXXXXXXXXXXXXTASAS--RLFDEQDNSFE 984
            VG +++SITY GK RKLV                +  +  +L++ Q NSF+
Sbjct: 908 AVGGSRSSITYFGKMRKLVGPKNRNSTLSKGPRPASKPTMGKLWESQQNSFD 959

 Score = 99.8 bits (247), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 122/450 (27%), Positives = 198/450 (44%), Gaps = 59/450 (13%)

Query: 1   MDFVFDGLDALKGKKRTTYKKVTDGDVEDEPKISEFNIELPGLGQSILFNNSKLKQIRNR 60
           MD + + LD L  K+RTTYKKV +   E+E +    +   P LG   LF NS + ++RNR
Sbjct: 1   MDSLLEKLDPLSSKRRTTYKKVFEPQEEEETQQISNSPPPPILGNGFLFQNSTIDKVRNR 60

Query: 61  LEGXXXXXXX------XXXQAETQVIADTQIISNLYXXXXXXXXXXXRRFL-----QRTQ 109
           L                  Q +   +  TQ+I++LY            R       + + 
Sbjct: 61  LRNAEDGANKVQQKEQEQEQEQETQLNQTQVIADLYEGAEELEEQNKERVRLPLSKKTSS 120

Query: 110 IVEDHTQIIDASVTYSSKTIESN-------KMDNTQKYIN--ASDSEPTQIQISKVDKLL 160
             ++ TQ+I  + T     +E+N         + TQ+  N  + D +   IQ  +  ++ 
Sbjct: 121 ASQEKTQVIPWAPTVEG--VENNVEQGTDIHEEKTQQVPNEISYDQKTQAIQSFQQTEVE 178

Query: 161 KITDNLDSQKKVLDXXXXXXXXXXXYGKTQVDKTQVDK----TQVDKTQIFPTLVADDEI 216
            +T  +   ++ LD           Y  T  D+    +    TQ+D +        D +I
Sbjct: 179 PLTQRISEPERTLDVPT--------YAATSEDQLDTQEQNPITQLDISNSLLFQATDSDI 230

Query: 217 KHSSTAVQTVDDNTHSNSELKINEIERQLDEEDQILKEKSMGTEYKRNIAPVMSKVKFSK 276
             S                LK+++IE++L+E+ Q  ++     EY+    PV  K  FSK
Sbjct: 231 PKSPP------------QRLKMHDIEKELEEKRQ-ERDHRRNIEYRAPEKPVNVKRVFSK 277

Query: 277 NDFLEHFXXXXXXXXXXGVVKLSSTE-----PETAAMNLENSLPQFSKESKFIGLSNYEN 331
             FL++F           +++L S +      E     LEN+     ++  F   S YE 
Sbjct: 278 EAFLKNFDEESSSEDE--LIELRSRDIEKKHTEKDKSTLENTTESSQRQRVF---SVYEY 332

Query: 332 ILKKDINKQNCIEFSDSEDETEVTS--KVSRASKATILSIKANLSRHKPAQSSINNKNAL 389
            LK +++ + CI+  D EDE++      +SR SKAT+L IKA  S+ +P       K  L
Sbjct: 333 KLKGELDSKRCIQLDDDEDESDEDVEVPLSRVSKATVLDIKARRSKQEPLSKIKQKKTTL 392

Query: 390 GNLFSDLKKATKAQILDHKKEIMEQKGYKM 419
            +L   LKKA+K QI DH+ E+M+ +GYK+
Sbjct: 393 NDLICTLKKASKKQITDHQNELMKSRGYKL 422

>CAGL0B00330g Chr2 complement(18031..21441) [3411 bp, 1136 aa] {ON}
            similar to uniprot|P25588 Saccharomyces cerevisiae
            YCL061c
          Length = 1136

 Score =  223 bits (567), Expect = 3e-59,   Method: Compositional matrix adjust.
 Identities = 155/349 (44%), Positives = 203/349 (58%), Gaps = 18/349 (5%)

Query: 640  GITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAEN 699
            G+   FE EAEES+DEW GIGGVDG+   EYDSEVEKMIDDYSK   +   +R+K+  EN
Sbjct: 802  GVNQYFEEEAEESDDEWRGIGGVDGDDFGEYDSEVEKMIDDYSKTEVDLTSLRQKIMDEN 861

Query: 700  KDMDLKMVNRILNDIKNGGFRKR-RNAXXXXXXXXXXXXXKAYRAKRRQLMKEKRLETDH 758
            K+MDLK+VN+IL DIKNGGFRKR RN              + +R KRR+LMK++ LE + 
Sbjct: 862  KEMDLKLVNKILYDIKNGGFRKRGRNDMELEFSDDEDAELQEFRRKRRELMKQRMLENED 921

Query: 759  NKKLMTNKKSHAFLESMVDDIVEVKNPFDERDDNI---MDDTPETDAEGDVNSNELLNKK 815
              KL  N KS AF ESM+ D+VE KN FD+  D I    ++  + D E + N  +  NK+
Sbjct: 922  TDKLTKNPKSKAFFESMIVDLVEDKNNFDDLSDQIELKEENITQEDNEKEYNEAK-SNKR 980

Query: 816  KKFILSEAFVQKSLSFLSSSRNLEEFEMNNNLAKEQHSHAATDMFALKSHCSIKSLESLP 875
             K  +SE FVQK+LSFL +  + +EF+ +  ++KE+      DM ALKS+ S+     L 
Sbjct: 981  GKIRISEDFVQKTLSFLHNDESTQEFQPSFIMSKEK---GIGDMNALKSNSSLSFCSKL- 1036

Query: 876  GSHNNSISSKLDLLHEEIVSTPFSGLKQTSVXXXXXXXXXXXXXXXXGNKTVKVSKSYRT 935
                 S S K+ +  EE V   F   K+ S+                GNK+VKVS SY+T
Sbjct: 1037 -----STSRKI-INDEEDVIEEFESFKRPSIIQSFSSKFTIDDKFKDGNKSVKVSTSYKT 1090

Query: 936  VGSAKASITYLGKARKLVXXXXXXXXXXXXXXXTASASRLFDEQDNSFE 984
            VG +KASITYLGK RKLV               T   SRLF+ Q++ F+
Sbjct: 1091 VGGSKASITYLGKTRKLVPPKNGPTVRKRNSNNT---SRLFNIQNDPFD 1136

 Score = 61.2 bits (147), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 30/63 (47%), Positives = 45/63 (71%)

Query: 354 VTSKVSRASKATILSIKANLSRHKPAQSSINNKNALGNLFSDLKKATKAQILDHKKEIME 413
           V  K+S  SKAT+L++K  LS+ KP +   N K++   LF++L+KATK QI+ H+KE+ME
Sbjct: 528 VIYKLSNKSKATLLNLKVRLSKKKPVKKVHNEKDSTNLLFNNLRKATKQQIMLHRKELME 587

Query: 414 QKG 416
            +G
Sbjct: 588 SRG 590

 Score = 37.0 bits (84), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/22 (72%), Positives = 19/22 (86%)

Query: 1  MDFVFDGLDALKGKKRTTYKKV 22
          MDF+FD L+ +K KKRTTYKKV
Sbjct: 1  MDFLFDELEQVKIKKRTTYKKV 22

>TDEL0C06970 Chr3 (1264155..1266980) [2826 bp, 941 aa] {ON} Anc_1.5
           YCL061C
          Length = 941

 Score =  209 bits (533), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 152/356 (42%), Positives = 207/356 (58%), Gaps = 32/356 (8%)

Query: 640 GITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAEN 699
           G+T+MF++EAEES+DEW G+GGVDGE  D+YDS++EKMIDD+S    NA +IR+ L AEN
Sbjct: 606 GVTNMFDMEAEESDDEWRGVGGVDGETIDDYDSDLEKMIDDFSNTTSNADQIRQLLMAEN 665

Query: 700 KDMDLKMVNRILNDIKNGGFRKRR-NAXXXXXXXXXXXXXKAYRAKRRQLMKEKRLETDH 758
           K+ DLK VN+IL+DIKNGGFRKRR N                Y+ ++ +LM+++RL+   
Sbjct: 666 KETDLKTVNKILHDIKNGGFRKRRQNNLQLELSDDEDDELLNYKKRKLELMRKRRLQFGA 725

Query: 759 -NKKLMTNKKSHAFLESMVDDIVEVKNPFDERDDNIMDDTPETD--AEGDVNSNELLNKK 815
            +KKL+ N +S AF ESMV+DI+++K+PF  +      +T E D  +EG V++    + K
Sbjct: 726 DDKKLLKNSRSKAFFESMVEDIIDLKDPFSNQ-----AETSEKDKKSEGLVDA----SNK 776

Query: 816 KKFILSEAFVQKSLSFLSSSRNLEEFEMNNNLAKEQHSHAATDMFALKSHCSIKSLESLP 875
           +K  +S  FVQ+SLSFLSSSR+  EFE+       Q     TD+ +LK   ++K+L    
Sbjct: 777 QKDTISHEFVQQSLSFLSSSRDFSEFEVAR---VSQEGERNTDLNSLKQDSTVKTL---- 829

Query: 876 GSHNNSISSKLDLLHEEI------VSTPFSGLKQTSVXXXXXXXXXXXXXXXXGNKTVKV 929
            + +N IS      HEE       V + +S     SV                G KTV V
Sbjct: 830 YAPSNIISESERADHEEFDNSVLPVESSYS-----SVVKSFGFDLNANDKLKEGRKTVTV 884

Query: 930 SKSYRTVGSAKASITYLGKARKLVXXXXXXXXXXXXXX-XTASASRLFDEQDNSFE 984
           SKSYRTVG  KASITYLGK RKLV                T   S++F   ++SFE
Sbjct: 885 SKSYRTVGGNKASITYLGKMRKLVAPKKSNAEVRTTSKLSTLGNSKIFRNFESSFE 940

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/96 (35%), Positives = 57/96 (59%), Gaps = 1/96 (1%)

Query: 325 GLSNYENILKKDIN-KQNCIEFSDSEDETEVTSKVSRASKATILSIKANLSRHKPAQSSI 383
            L+ Y+  LK+     +  +  S+S+DE ++    S  +KAT+L +KA LS+ +P   S 
Sbjct: 318 ALTAYQRELKEKAEIAKGVMLLSESDDEEDLAVSTSHEAKATVLKLKARLSKRRPPVESQ 377

Query: 384 NNKNALGNLFSDLKKATKAQILDHKKEIMEQKGYKM 419
           + K +L  L  +L+ +TK QILD +KE +E++G K 
Sbjct: 378 HGKASLSALMKNLRNSTKRQILDRQKEGIERQGLKF 413

 Score = 45.8 bits (107), Expect = 5e-04,   Method: Compositional matrix adjust.
 Identities = 30/90 (33%), Positives = 44/90 (48%), Gaps = 10/90 (11%)

Query: 1  MDFVFDGLDALKGKKRTTYKKVTDGDVEDEPKISEFNIELPGLGQSILFNNSKLKQIRNR 60
          MD +F+  D    K+R TY+K      ED+    +  +    LG   LFN+S L +++NR
Sbjct: 1  MDKLFESFDNAIKKRRATYQKAVQN--EDDEYTEDPLVPPAVLGNGFLFNSSTLDKVKNR 58

Query: 61 LEGXXXXXXXXXXQAETQVIADTQIISNLY 90
          L            +  TQ I  TQ++SNLY
Sbjct: 59 L--------NKDQEQGTQAIDTTQVLSNLY 80

>Ecym_1008 Chr1 complement(13340..16696) [3357 bp, 1118 aa] {ON}
            similar to Ashbya gossypii AFR745W
          Length = 1118

 Score =  201 bits (512), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 126/322 (39%), Positives = 180/322 (55%), Gaps = 27/322 (8%)

Query: 640  GITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAEN 699
            G+  M E+EA+ESEDEWHG+GGVD E SDEYDS+++KMIDDY+K  F+  EIR+ LA+E+
Sbjct: 781  GVNKMVELEADESEDEWHGVGGVDYEASDEYDSDLDKMIDDYNKNEFDPVEIRKILASED 840

Query: 700  KDMDLKMVNRILNDIKNGGFRKR-RNAXXXXXXXXXXXXXKAYRAKRRQLMKEKRLETDH 758
               D  MVN+IL+DIK GGFRKR R               ++YRAKR    K+K L+++H
Sbjct: 841  LQHDKNMVNKILHDIKTGGFRKRGRGELDLELSEDEDGILQSYRAKRWNEQKQKMLDSEH 900

Query: 759  NKKLMTNKKSHAFLESMVDDI-VEVKNPFDERDDNIMDDTPETDAEGDVNSNEL-LNKKK 816
            N  + +N KS  F ESMVD+  + V+             TP++      N  EL  N K+
Sbjct: 901  NTSVKSNPKSLPFFESMVDEFTIPVERAL---------GTPDSPPAQSTNVLELKQNTKQ 951

Query: 817  KFILSEAFVQKSLSFLSSSRNLEEFEMNNNLAKEQ-----HSHAATDMFALKSHCSIKSL 871
            K ++SE FV+++LSFL+S  N+       N+ K       +S    D++ LK   +IK L
Sbjct: 952  KIVISEHFVKQTLSFLTSDENMTNMRSEINVEKPNNDNDIYSSEVEDLYTLKETSTIKVL 1011

Query: 872  ESLPGSHNNSISSKLDLLHEEIVSTPFSGLKQTSVXXXXXXXXXXXXXXXXGNKTVKVSK 931
             +  G           +++E+     F G K  SV                G K+VK+S 
Sbjct: 1012 NTYSGK---------PIVNEDEDGAEF-GFKAPSVMQTFGSRNDVNDKFKDGFKSVKISN 1061

Query: 932  SYRTVGSAKASITYLGKARKLV 953
             Y+T+GS++A+IT+LGK RKL+
Sbjct: 1062 KYKTLGSSRAAITFLGKKRKLI 1083

 Score = 51.2 bits (121), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 38/109 (34%), Positives = 62/109 (56%), Gaps = 11/109 (10%)

Query: 317 FSKESK--FIGLSNYENILKKDINKQNCIEFSDSEDETEVTSKVSRASKATILSIKANLS 374
           +++E+K   + L + +N + +DI     ++ S  E+        S   KA +L+IKA +S
Sbjct: 399 YAEEAKPPLLPLQSMKNTVGQDI----ILDSSSDEEHASNQFATSTMVKAALLNIKAKIS 454

Query: 375 RH----KPAQSSINNKNALGNLFSDLKKATKAQILDHKKEIMEQKGYKM 419
           ++    K A+ SIN+   L  LF  LKKA K QILDH++EI E++G  +
Sbjct: 455 KNMNLSKNAEQSINSP-TLKQLFISLKKANKKQILDHRREITEKRGISL 502

>KLTH0F00484g Chr6 complement(37017..39998) [2982 bp, 993 aa] {ON}
           weakly similar to uniprot|P25588 Saccharomyces
           cerevisiae YCL061C MRC1 S-phase checkpoint protein found
           at replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 993

 Score =  189 bits (481), Expect = 1e-48,   Method: Compositional matrix adjust.
 Identities = 132/326 (40%), Positives = 176/326 (53%), Gaps = 37/326 (11%)

Query: 644 MFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAENKDMD 703
           + + EAEES+DEWHGIGGVDGE  D++DS++EKMIDDYS   F++ E+R++   E    D
Sbjct: 654 IIDYEAEESDDEWHGIGGVDGERFDDHDSDLEKMIDDYSNSRFDSSEVRKRQIEEEISED 713

Query: 704 LKMVNRILNDIKNGGFRKR-RNAXXXXXXXXXXXXXKAYRAKRRQLMKEKRLETDHNKKL 762
             MVN+IL+DI+ GGFRKR RNA               Y ++R++L+++K       K L
Sbjct: 714 KSMVNKILHDIETGGFRKRGRNALDLELSDDDDEELLKYHSRRKELLRQKVSAQGEAKLL 773

Query: 763 MTNKKSHAFLESMVDDIVEVKNPFDERDDNIMDD--TPETDAEGDVNSNELLN-----KK 815
             N KS AF E++V+DI         R    ++D   P       VN+ E  N     K 
Sbjct: 774 AENPKSKAFFETIVEDI---------RSKGALEDEGPPPVRGFSSVNAPEEKNSDSDKKG 824

Query: 816 KKFILSEAFVQKSLSFLSSSRNLEEFEMNNNLAKEQHSHAAT-------DMFALKSHCSI 868
           KK +LSEAFVQ++LSFL+S    EE    NNL     +H  +       D+FALK + SI
Sbjct: 825 KKTVLSEAFVQQTLSFLTSGEVGEEKGPENNLGS-LPTHVPSFNTEETQDIFALKQNSSI 883

Query: 869 KSLESLP--GSHNNSISSKLDLLHEEIVSTPFSGLKQTSVXXXXXXXXXXXXXXXXGNKT 926
           KSL S P   S N  I  + DLL  +   + F+   +                   G KT
Sbjct: 884 KSL-SAPTRNSSNMLIDDQEDLLSRKRACSFFARFTK---------RVDANEKFEEGKKT 933

Query: 927 VKVSKSYRTVGSAKASITYLGKARKL 952
           V+   SY+  GS+KASITYLGKARKL
Sbjct: 934 VRSLNSYKVAGSSKASITYLGKARKL 959

 Score = 39.7 bits (91), Expect = 0.042,   Method: Compositional matrix adjust.
 Identities = 24/59 (40%), Positives = 35/59 (59%), Gaps = 5/59 (8%)

Query: 363 KATILSIKANLSRHK-----PAQSSINNKNALGNLFSDLKKATKAQILDHKKEIMEQKG 416
           KA IL +KA LS+       P     +N ++   LF+ L+KA K+QILD++KE  + KG
Sbjct: 360 KAAILDLKARLSKKSQSLLIPRSKVTSNFSSHQILFASLRKANKSQILDYRKEKYQSKG 418

>KLLA0C00484g Chr3 complement(35397..38174) [2778 bp, 925 aa] {ON}
           weakly similar to uniprot|P25588 Saccharomyces
           cerevisiae YCL061C MRC1 S-phase checkpoint protein found
           at replication forks required for DNA replication also
           required for Rad53p activation during DNA replication
           stress where it forms a replication-pausing complex with
           Tof1p and is phosphorylated by Mec1p protein involved in
           replication checkpoint
          Length = 925

 Score =  178 bits (452), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 117/300 (39%), Positives = 164/300 (54%), Gaps = 35/300 (11%)

Query: 656 WHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAENKDMDLKMVNRILNDIK 715
           WHG+GG DGE SD+YDS+++ MIDD+SK  F+   IRE+LA ENK+MD +M+N+IL+DI 
Sbjct: 630 WHGVGGADGENSDDYDSDLDTMIDDFSKSKFDTASIRERLALENKEMDERMINKILHDIN 689

Query: 716 NGGFRKR-RNAXXXXXXXXXXXXXKAYRAKRRQLMKEKRLETDHNKKLMTNKKSHAFLES 774
            GGFRKR R A             + +R KRR++MK+K LE  +   ++ N KS AF +S
Sbjct: 690 TGGFRKRGRGALDLELSDDEDELLRQFREKRREIMKQKLLE--NVDGVVNNSKSKAFFDS 747

Query: 775 MVDDIVEVKNPFDERDDNIMDDTPETDAEGDVNSNELLNKKKKFILSEAFVQKSLSFLSS 834
           MV+DI     P      N  D+                  KKK ++SE FVQ SLSFLS+
Sbjct: 748 MVEDITRKSIPAVTSFSNTRDEM----------------GKKKIVISEEFVQSSLSFLSA 791

Query: 835 S-RNLEEFEMNNNLAKEQHSHAAT-DMFALKSHCSIKSLESLPGSHNNSISSKLDLLHEE 892
              ++ EFE+       + +H AT D+ +LK   +IKSL+S P  + NS         ++
Sbjct: 792 KDDDINEFEVT------EAAHDATEDLESLKQRSNIKSLDS-PQRNRNSA------FFDD 838

Query: 893 IVSTPFSGLKQTSVXXXXXXXXXXXXXXXXGNKTVKVSKSYRTVGSAKASITYLGKARKL 952
           +  T     K  S+                G KTV +SKSYR    ++++IT+LGK RKL
Sbjct: 839 VDGTSLD-FKLPSIVKSFSSNSDVNDKFKTGIKTVTISKSYRVASGSRSAITFLGKKRKL 897

 Score = 43.1 bits (100), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 31/86 (36%), Positives = 51/86 (59%), Gaps = 11/86 (12%)

Query: 340 QNCIEF---SDSEDETEVTSKVSRASKATILSIKANLSRHKPAQSS---INNKNALGNLF 393
           QN IE    S+SED+ +     S++SKA +L IKA  SR+K  ++    ++  ++L  LF
Sbjct: 319 QNVIELNSSSESEDDYK-----SQSSKAALLLIKAKRSRNKATKAKNMHVSTVDSLKELF 373

Query: 394 SDLKKATKAQILDHKKEIMEQKGYKM 419
           + LK   + QIL+ ++EI  +KG  +
Sbjct: 374 TSLKTKNRDQILEFRREISGKKGISL 399

>AFR745W Chr6 (1803046..1806102) [3057 bp, 1018 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL061C (MRC1)
          Length = 1018

 Score =  160 bits (405), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 119/322 (36%), Positives = 172/322 (53%), Gaps = 30/322 (9%)

Query: 640 GITDMFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAEN 699
           GIT M E+EAEESEDEWHGIGG D ELS++YDSEVEKMIDDYS  + NA  +R  LA   
Sbjct: 685 GITKMLEMEAEESEDEWHGIGGSDNELSEDYDSEVEKMIDDYSVHSSNADHLRAILAKNE 744

Query: 700 KDMDLKMVNRILNDIKNGGFRKR-RNAXXXXXXXXXXXXXKAYRAKRRQLMKEKRLETDH 758
           +  D  +VN+IL+DI  GGFR+R + A             + +R KRR+L+K+K LE   
Sbjct: 745 RQHDENIVNKILHDISTGGFRRRGKGALDLEMSENEDQELQQFRQKRRELLKQKILENGD 804

Query: 759 NKKLMTNKKSHAFLESMVDDIVEVK--NPFDERDDNIMDDTPETDAEGDVNSNELLNKKK 816
             KL++N KS+AF ++MVDD+ E    N FD      +D+  +  A G           +
Sbjct: 805 TSKLVSNPKSYAFFQTMVDDVTEASFGNTFDAN----IDEKTDPSAAG-----------R 849

Query: 817 KFILSEAFVQKSLSFLSSSRNLEEF--EMNNNLAKEQHSHAATDMFALKSHCSIKSLES- 873
           K ++SE FV+++LSFLSS     E   E  +  +         D+  LK + +IK L+  
Sbjct: 850 KIVISEQFVKETLSFLSSKSGDSEIPAETKSISSSTVEREEIQDLHTLKQNSNIKHLKGS 909

Query: 874 --LPGSHNNSISSKLDLLHEEIVSTPFSGLKQTSVXXXXXXXXXXXXXXXXGNKTVKVSK 931
             LP       +   +L   +     FS  +  S                 G K V++ K
Sbjct: 910 LELP-------AQMAELSSGDEGDYGFSLDRFRSAAKSFNNGTNVDDKFKSGTKAVRILK 962

Query: 932 SYRTVGSAKASITYLGKARKLV 953
           + +T+G +KA+IT++G+ R+L+
Sbjct: 963 ANKTIGGSKAAITFIGRKRRLI 984

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 69/253 (27%), Positives = 115/253 (45%), Gaps = 26/253 (10%)

Query: 186 YGKTQVD----KTQVDKTQVDKTQIFPTLVAD----DEIKHSSTAVQTVDDNTHSNSELK 237
           YG T+VD     TQ D       Q + T   D    D+ + +    QT+    H   +L 
Sbjct: 198 YGPTRVDDEVVATQQDSMGTADAQCWDTQTLDCALADDFQATIPDAQTLATARHE--KLF 255

Query: 238 INEIERQLDEEDQILKEKSMGTEYKRNIAPVMSKVK--FSKNDFLEHFXXXXXXXXXXGV 295
           I++IE ++  + Q  KE  M T+ K   AP + K K  F+K++FL+ F          G+
Sbjct: 256 IHQIEEEIATKTQ--KELPMMTQAKE--APYIPKQKLVFTKDNFLDSFDDDSETEIHGGL 311

Query: 296 ----VKLSSTEPETAAMNLENSLPQFSK----ESKFIGLSNYENILKKDINKQNCIEFSD 347
                ++S  + E      ++S P   +    +  +  L +     K     +  I    
Sbjct: 312 DGSDRQVSYNDREHTETGPQSSQPATGEGQDTQVLYPALQSLSITSKSYQEARQIILDES 371

Query: 348 SEDETEVTSKVSRASKATILSIKANLSRHKPAQSSINNKNALGN-LFSDLKKATKAQILD 406
           SED+T+V    S  SKA +L+IKA  S+    Q     K++  N LF+ L+KA + Q+L+
Sbjct: 372 SEDDTDVNLS-SAVSKAAVLAIKARNSKFITPQKIDETKSSKSNELFAKLRKANREQLLE 430

Query: 407 HKKEIMEQKGYKM 419
            ++  +E++G  M
Sbjct: 431 QRRNAIERRGINM 443

>Kwal_33.13005 s33 complement(36797..39709) [2913 bp, 970 aa] {ON}
           YCL061C (MRC1) - protein involved in replication
           checkpoint [contig 123] FULL
          Length = 970

 Score =  156 bits (394), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 115/315 (36%), Positives = 166/315 (52%), Gaps = 22/315 (6%)

Query: 644 MFEVEAEESEDEWHGIGGVDGELSDEYDSEVEKMIDDYSKENFNAGEIREKLAAENKDMD 703
           M + EAEES+DEW G+GG DGE SD YDSE+++MIDDYS    +   +R+KL  E K  D
Sbjct: 638 MIDFEAEESDDEWFGVGGADGENSDGYDSELDRMIDDYSNTKSDPEFLRKKLMEEEKLHD 697

Query: 704 LKMVNRILNDIKNGGFRKR-RNAXXXXXXXXXXXXXKAYRAKRRQLMKEKRLETDHNKKL 762
             MV+RIL+DI+NGGFRKR R A               Y A+R++L+ E++        L
Sbjct: 698 KDMVDRILHDIENGGFRKRGRYAMDLTLSDDEDDDLLRYHARRKELLNERKSGNQEISVL 757

Query: 763 MTNKKSHAFLESMVDDIVEVKNPFDERDDNIMDDTPETDAEGDVNSNELLNKKKKFILSE 822
            TN KS AF +S+ +D  ++K       +     +P   A+ +++       K++  +SE
Sbjct: 758 ATNPKSKAFFDSIFED--DLKGGIANLKEYQSHASPLKAAKDEISG------KRETRISE 809

Query: 823 AFVQKSLSFLSSSRNLEEFEMNNNLAKEQHSHA-----ATDMFALKSHCSIKSLESLPGS 877
            FVQK+LSFL S  + +      ++A  Q S +     ATD + LK    IKS  +   S
Sbjct: 810 QFVQKTLSFLKSKEDEQGDAEFVSVADTQESSSGDFAEATDFYRLKQLSGIKSFSAPLRS 869

Query: 878 HNNSISSKLDLLHEEIVSTPFSGLKQTSVXXXXXXXXXXXXXXXXGNKTVKVSKSYRTVG 937
                S +L + +++ V    SG   T++                G KTVK   SY+  G
Sbjct: 870 -----SIRLQVRNKDGV---LSGKANTTLVERFVRSVDTNEKFEEGRKTVKSLNSYKIAG 921

Query: 938 SAKASITYLGKARKL 952
           S++ASIT+LGKAR L
Sbjct: 922 SSRASITFLGKARSL 936

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 38/113 (33%), Positives = 65/113 (57%), Gaps = 8/113 (7%)

Query: 312 NSLPQFSKESKFIGLSNYENILKKDINKQNCIEFSDSEDETEVTSKVSRASKATILSIKA 371
           N LP  S+   F  L  Y  ILK+ +   N +EFS S+DE    ++ S +SKA IL +KA
Sbjct: 291 NVLPSISE--GFAPLQLYHTILKQRLTDANSVEFSSSDDEKSSEAR-SLSSKAAILDLKA 347

Query: 372 NLSRHKPAQSSINNKN-----ALGNLFSDLKKATKAQILDHKKEIMEQKGYKM 419
            +S+ K + +  ++K      +L +LFS L+KA + Q+++H+  ++  +G  +
Sbjct: 348 RMSKKKQSLAVTSSKETMPSASLRHLFSSLRKANRDQLVEHRNGLLLLRGVDL 400

>Suva_7.197 Chr7 (361661..364201) [2541 bp, 846 aa] {ON} YGL073W
           (REAL)
          Length = 846

 Score = 40.4 bits (93), Expect = 0.022,   Method: Compositional matrix adjust.
 Identities = 21/65 (32%), Positives = 41/65 (63%), Gaps = 2/65 (3%)

Query: 189 TQVDKTQVDKTQVDKTQIFPTLVADDEIKHSSTAVQTVDDNTHSNSELKINEIERQLDEE 248
           T+   +QV++   D ++   T+++DD++K  S A +  DDN H+ S+L ++ + R +DE+
Sbjct: 586 TRNPASQVNENAFDPSRF--TMLSDDDLKKDSHAHRIADDNKHNESDLFLDNVHRNIDEQ 643

Query: 249 DQILK 253
           D  L+
Sbjct: 644 DARLQ 648

>KLTH0D06556g Chr4 complement(570972..572342) [1371 bp, 456 aa] {ON}
           similar to uniprot|P38153 Saccharomyces cerevisiae
           YBR288C APM3 Mu3-like subunit of the yeast AP-3 complex
           which functions in transport of alkaline phosphatase to
           the vacuole via the alternate pathway clathrin
           associated protein medium chain
          Length = 456

 Score = 33.1 bits (74), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 19/54 (35%), Positives = 26/54 (48%), Gaps = 6/54 (11%)

Query: 839 EEFEMNNNLAKEQHSHAATDMF------ALKSHCSIKSLESLPGSHNNSISSKL 886
           +EFE+N N+A  QH+    D+        L S C IK L S  G   N  S+ +
Sbjct: 322 DEFEVNLNIAGSQHAKVVDDLVITLSFGPLPSECKIKVLRSTHGHFENCASNNI 375

>KNAG0A07130 Chr1 complement(1119805..1120509) [705 bp, 234 aa] {ON}
           Anc_2.558 YKL041W
          Length = 234

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 27/40 (67%), Gaps = 2/40 (5%)

Query: 661 GVDGELSDEYDSEVEKMIDDYSKENFN-AGEIRE-KLAAE 698
           G D EL +E D+EV K+++ Y+ E F+  G + E +LAAE
Sbjct: 153 GEDTELDEEVDAEVNKIVEQYTSEQFSKVGTVPEDRLAAE 192

>Suva_1.24 Chr1 (39893..42442) [2550 bp, 849 aa] {ON} YAL041W (REAL)
          Length = 849

 Score = 32.0 bits (71), Expect = 9.7,   Method: Compositional matrix adjust.
 Identities = 25/73 (34%), Positives = 41/73 (56%), Gaps = 13/73 (17%)

Query: 199 TQVDKTQIFPTLV-----ADDEIKHSSTAVQTVDDNTHSNSELKINEIERQLDEEDQILK 253
           T V+ ++IF  LV      DD I    TA+ +   NTHS+S L IN+I+ Q ++ D ++ 
Sbjct: 768 TNVNNSEIFTLLVERVWNFDDLI----TAINSKISNTHSSSALPINKIKYQDEDGDFVI- 822

Query: 254 EKSMGTEYKRNIA 266
              +G++   N+A
Sbjct: 823 ---LGSDEDWNVA 832

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.308    0.126    0.332 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 83,992,399
Number of extensions: 3497307
Number of successful extensions: 21919
Number of sequences better than 10.0: 149
Number of HSP's gapped: 22745
Number of HSP's successfully gapped: 190
Length of query: 985
Length of database: 53,481,399
Length adjustment: 119
Effective length of query: 866
Effective length of database: 39,836,145
Effective search space: 34498101570
Effective search space used: 34498101570
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 71 (32.0 bits)