Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_2002.71.4ON47447420610.0
TDEL0C069801.4ON4264805124e-59
ZYRO0F18502g1.4ON4505005041e-57
Suva_3.1511.4ON4213104312e-47
YCL063W (VAC17)1.4ON4234824287e-47
Skud_3.21.4ON4263074279e-47
Smik_3.131.4ON4253024252e-46
SAKL0C00440g1.4ON4624974052e-43
TPHA0E040201.4ON5403604083e-43
NDAI0A001301.4ON4785143333e-33
NCAS0B091201.4ON4335083218e-32
KNAG0C001901.4ON4423673121e-30
CAGL0B00308g1.4ON4303103023e-29
KLLA0C00462g1.4ON4604972742e-25
TBLA0A075801.4ON5133192353e-20
Kwal_33.130031.4ON4494911901e-14
KAFR0D001201.4ON3994901516e-10
KLTH0F00462g1.4ON4512781482e-09
NOTE: 2 genes in the same pillar as Kpol_2002.7 were not hit in these BLAST results
LIST: AFR746C Ecym_1007

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_2002.7
         (474 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON} (10372.....   798   0.0  
TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa] ...   201   4e-59
ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]...   198   1e-57
Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W ...   170   2e-47
YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}  VAC17Phospho...   169   7e-47
Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)      169   9e-47
Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)   168   2e-46
SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly s...   160   2e-43
TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {O...   161   3e-43
NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4 YCL...   132   3e-33
NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa] ...   128   8e-32
KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4 Y...   124   1e-30
CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar ...   120   3e-29
KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly s...   110   2e-25
TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa] ...    95   3e-20
Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W ...    78   1e-14
KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4 YC...    63   6e-10
KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly s...    62   2e-09

>Kpol_2002.7 s2002 (10372..11796) [1425 bp, 474 aa] {ON}
           (10372..11796) [1425 nt, 475 aa]
          Length = 474

 Score =  798 bits (2061), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/474 (85%), Positives = 405/474 (85%)

Query: 1   MPYSNIDDLSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDENDLEKVTDTYNLYMSQL 60
           MPYSNIDDLSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDENDLEKVTDTYNLYMSQL
Sbjct: 1   MPYSNIDDLSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDENDLEKVTDTYNLYMSQL 60

Query: 61  NSLYIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLAX 120
           NSLYIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLA 
Sbjct: 61  NSLYIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLAS 120

Query: 121 XXXXXXXXXXXXXXXXXIGSFQPKPLKISLKRNKSLKEQNKKTVTFDVEEVTDLNINSVI 180
                            IGSFQPKPLKISLKRNKSLKEQNKKTVTFDVEEVTDLNINSVI
Sbjct: 121 SRRRCSSSKSSSSRSSSIGSFQPKPLKISLKRNKSLKEQNKKTVTFDVEEVTDLNINSVI 180

Query: 181 SLPGSPLRNEQSSPPMNHHLRQAKSYDTGLNXXXXXXXXXXXXXXVYDSTFKNTQRLSIS 240
           SLPGSPLRNEQSSPPMNHHLRQAKSYDTGLN              VYDSTFKNTQRLSIS
Sbjct: 181 SLPGSPLRNEQSSPPMNHHLRQAKSYDTGLNSKRSIKPKKSKIDSVYDSTFKNTQRLSIS 240

Query: 241 LFDIDTNENDITNISDQETVISSSSLTMDEPLEIIDDQKNNLKPLRRYNSHESILSTKIR 300
           LFDIDTNENDITNISDQETVISSSSLTMDEPLEIIDDQKNNLKPLRRYNSHESILSTKIR
Sbjct: 241 LFDIDTNENDITNISDQETVISSSSLTMDEPLEIIDDQKNNLKPLRRYNSHESILSTKIR 300

Query: 301 PISISKRFQIGPFRXXXXXXXXXXXXXXXXXXXVKADDFYKPNLSNSTTSKDILSMYSIK 360
           PISISKRFQIGPFR                   VKADDFYKPNLSNSTTSKDILSMYSIK
Sbjct: 301 PISISKRFQIGPFRSVSTTTTSTNYDTTASNTDVKADDFYKPNLSNSTTSKDILSMYSIK 360

Query: 361 NDVQNSNRGXXXXXXXXXXXXXXXXXXWNIFNFPLIASSEVGSKQENNTTAKHFGSQRKK 420
           NDVQNSNRG                  WNIFNFPLIASSEVGSKQENNTTAKHFGSQRKK
Sbjct: 361 NDVQNSNRGNIINNKKESNSSTSFFNKWNIFNFPLIASSEVGSKQENNTTAKHFGSQRKK 420

Query: 421 QISSLSYNKANYSTMTIGPNGSMFCSPTIYEPTFSNTVSFQELHDALNTELDLA 474
           QISSLSYNKANYSTMTIGPNGSMFCSPTIYEPTFSNTVSFQELHDALNTELDLA
Sbjct: 421 QISSLSYNKANYSTMTIGPNGSMFCSPTIYEPTFSNTVSFQELHDALNTELDLA 474

>TDEL0C06980 Chr3 complement(1267077..1268357) [1281 bp, 426 aa]
           {ON} Anc_1.4 YCL063W
          Length = 426

 Score =  201 bits (512), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 168/480 (35%), Positives = 239/480 (49%), Gaps = 72/480 (15%)

Query: 6   IDDLSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDENDLEKVTDTYNLYMSQLNSLYI 65
           ++DLSERLL RSQEAILQL+LWIQRQQ   E +D    + ++K+ + YN+Y++QLNSL +
Sbjct: 3   LEDLSERLLTRSQEAILQLELWIQRQQHLRELED----SSIDKLGNQYNVYIAQLNSLCV 58

Query: 66  RSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLAXXXXXX 125
           RS+ VRDKLN +++ R + I          N +  IEDL+FEFQDIT KLN LA      
Sbjct: 59  RSEYVRDKLNKERERRMSII----------NDRKYIEDLVFEFQDITVKLNELA-QSQSI 107

Query: 126 XXXXXXXXXXXXIGSFQPKPLKISLKRN---KSLKE---QNK---KTVTF-DVEEVTDLN 175
                       +GSFQP+PLK++ +     K+L+E   +NK   K+V F  + +  +  
Sbjct: 108 DSTPSSKSTRSSLGSFQPRPLKLTERHGPNVKALRESPLKNKSVIKSVKFSGLHDSKEEA 167

Query: 176 INSVISLPGSPLRNEQSSPPMNHHLRQAKSYDTGLNXXXXXXXXXXXXXXVYDSTFKNTQ 235
           ++  +SLPGSP+R   + P     +R AKSYDTGLN              V  S F+  Q
Sbjct: 168 VSKCLSLPGSPVR--VTGP--TRSIRMAKSYDTGLNSKNTKKSKGSRDYDV-PSIFRENQ 222

Query: 236 RLSISLFDIDTNENDITNISDQETVISSSSLTMDEPLEIIDDQKNNLKPLRRYNSHESIL 295
           RLSI++FD D +E D  + SDQ+TVIS         L   DD K    PLRR+NSHESIL
Sbjct: 223 RLSITVFD-DFDE-DADSTSDQDTVIS---------LVPADDGKG--LPLRRFNSHESIL 269

Query: 296 STKIRPISISKRFQIGPFRXXXXXXXXXXXXXXXXXXXVKADDFYKPNLSNSTTSKDILS 355
           STK++PIS    F                           A  F K   S   +S+D+LS
Sbjct: 270 STKVQPISSLPLF-------SSFLLPSSNRPSMKSVRVSSAPVFSK--TSAPASSRDLLS 320

Query: 356 MYSIKNDVQNSNRGXXXXXXXXXXXXXXXXXXWNIFNFPLIASSEVGSKQENNTTAKHFG 415
            +  +    ++  G                  WN F  P  AS ++              
Sbjct: 321 TFVTRPGKASNATG------IKQENKLGFFANWNFFKGPSSASHDIR------------A 362

Query: 416 SQRKKQISSLSYNKANYSTMTIGPNGSMFCSP--TIYEPTFSNTVSFQELHDALNTELDL 473
           +++K   S    N A+  + T+        SP   +  P F + +S+++L +AL+TE+ L
Sbjct: 363 TKQKASASRPESNSADCRSKTLEKMAPRRFSPRSPVKAPVFDSLISYEDLREALSTEIIL 422

>ZYRO0F18502g Chr6 complement(1527109..1528461) [1353 bp, 450 aa]
           {ON} similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 450

 Score =  198 bits (504), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 173/500 (34%), Positives = 240/500 (48%), Gaps = 77/500 (15%)

Query: 1   MPYSNIDDLSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDENDLEKVTDTYNLYMSQL 60
           MP  ++DD+SERL +RSQEA+LQL+LWI+RQQ  +E +  H     +K+ D YNLYM+QL
Sbjct: 1   MP--SLDDISERLFIRSQEAVLQLELWIRRQQHLSEIEHEHAR---DKIADQYNLYMAQL 55

Query: 61  NSLYIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLAX 120
           NSL +RS+ VRDKLN   ++R   I         +N Q+ IEDL++EFQDIT KLN LA 
Sbjct: 56  NSLCVRSEYVRDKLNAGYQNRKPPI---------VNEQNYIEDLVYEFQDITVKLNELA- 105

Query: 121 XXXXXXXXXXXXXXXXXIGSFQPKPLKISLKRNKSLKEQNK---------KTVTFDVEEV 171
                            + SFQP+PLKI+ +    +    +         K V F  E +
Sbjct: 106 QNQKEQVTPSSKHSNGSVNSFQPRPLKITERYRTDIGATRQSPTRINGKLKNVNFVEESL 165

Query: 172 TDLNINS-VISLPGSPLRNEQSSPPMNHHLRQAKSYDTGLNXXXXXXXXXXXXXXVYDST 230
            +L   S   SLPGSPL+        +  LR AKSYDTGLN              +  S 
Sbjct: 166 PELFCPSKCTSLPGSPLKMRSPDRLPDRPLRVAKSYDTGLNPNSRAKLKKQKEEEML-SV 224

Query: 231 FKNTQRLSISLFDIDTNENDITNISDQETVISSSSLTMDEPLEIIDDQKNNLKPLRRYNS 290
           FK  QRLSI+  D D +E    + SDQ TVIS+S +    P++   D ++   PLRRYNS
Sbjct: 225 FKENQRLSITFCD-DIDEGS-DSASDQNTVISTSPIPPSHPIQY--DVQSEKPPLRRYNS 280

Query: 291 HESILSTKIRPISISKRFQIGPFRXXXXXXXXXXXXXXXXXXXVKADDFYKPNLSNSTTS 350
           H+S+LSTK++PIS +K      F                    + +    K       +S
Sbjct: 281 HDSVLSTKVQPISSAK---CPTFLTIPTANRPSMKSVTVSSAPIISSTGGK------ASS 331

Query: 351 KDILSMY---------SIKNDVQNSNRGXXXXXXXXXXXXXXXXXXWNIFNFPLIASSEV 401
           KD+LS +           +ND  N+NR                   WN+F        + 
Sbjct: 332 KDLLSSFISNTQDYDKKARNDNGNNNR-------------FSSNLIWNLFK-------QK 371

Query: 402 GSKQENNTTAK----HFGSQRKK-QISSLSYNKANYSTMT---IGPNGSMFCSPTIYEPT 453
             K  N T  +       S+RK+ Q+ + S+    YS+ +   +    S   SPT    T
Sbjct: 372 SQKNRNPTPLRVPQQDVTSERKENQLLTTSHPSGVYSSCSRLLVKNQNSSIISPTRQRIT 431

Query: 454 FSNTVSFQELHDALNTELDL 473
             NT+ + EL +AL+TEL L
Sbjct: 432 NGNTM-YDELQEALDTELVL 450

>Suva_3.151 Chr3 (227186..228451) [1266 bp, 421 aa] {ON} YCL063W
           (REAL)
          Length = 421

 Score =  170 bits (431), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 124/310 (40%), Positives = 171/310 (55%), Gaps = 39/310 (12%)

Query: 1   MPYSNIDDLSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDENDLEKVTDTYNLYMSQL 60
           M    ++D++ERLL RS+EAILQLDLWIQRQQ+ +  + + D + L+K++  YN YMSQL
Sbjct: 1   MATQALEDITERLLTRSEEAILQLDLWIQRQQRSSVCEPS-DRDSLDKLSQQYNQYMSQL 59

Query: 61  NSLYIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLAX 120
           NSLY+RS++VRDKL+ ++  R NT +         N    IEDL+ EFQDIT +LN LA 
Sbjct: 60  NSLYVRSESVRDKLSKEQWRRLNTEE---------NEHKRIEDLVHEFQDITVRLNDLAT 110

Query: 121 XXXXXXX-XXXXXXXXXXIGSFQPKPLKISLKRNK----SLKEQNKKTVTF----DVEEV 171
                             + SFQP+PLKI ++R +    +  +  KK+V F    DVE  
Sbjct: 111 VPNKASNDSPQSQSTRSSLDSFQPRPLKI-IERQRLCVVTPSKPPKKSVVFNPINDVECP 169

Query: 172 TDLNINSVISLPGSPLRNEQSSPPMNHHLRQAKSYDTGLNXXXXXXXXXXXXXXVYDSTF 231
           +  N     SLP SP    +  P   H LR AKS+DTGLN               Y+S F
Sbjct: 170 SKTN-----SLPCSP----KKQPGKAHTLRAAKSHDTGLN-----KSKKPSSTDAYESFF 215

Query: 232 KNTQRLSISLFDIDTNENDITNISDQETVISSSSLTMDEPLEIIDDQKNNLKPLRRYNSH 291
           KN QRLS++ FD    E D  ++   +  I   +++    +++   +    +PLRRYNSH
Sbjct: 216 KNKQRLSLTFFD----EMDDEDLDSDQDTIILPNISTPSHMDMA-TKGAEFEPLRRYNSH 270

Query: 292 ESILSTKIRP 301
           ESILS K  P
Sbjct: 271 ESILSNKPAP 280

>YCL063W Chr3 (17290..18561) [1272 bp, 423 aa] {ON}
           VAC17Phosphoprotein involved in vacuole inheritance;
           degraded in late M phase of the cell cycle; acts as a
           vacuole-specific receptor for myosin Myo2p
          Length = 423

 Score =  169 bits (428), Expect = 7e-47,   Method: Compositional matrix adjust.
 Identities = 164/482 (34%), Positives = 231/482 (47%), Gaps = 72/482 (14%)

Query: 1   MPYSNIDDLSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDENDLEKVTDTYNLYMSQL 60
           M    ++D++ERLL+RSQEAILQLDLWIQRQQ+ +      D+  L+K++  YN YMSQL
Sbjct: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQRSSICQTT-DQESLDKLSQQYNQYMSQL 59

Query: 61  NSLYIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLAX 120
           NSLY+RS++VRDKL+ +++ R  T           N    IEDL+ EFQDIT +LN LA 
Sbjct: 60  NSLYVRSESVRDKLSKEQQRRLIT---------EDNEHQRIEDLVREFQDITLRLNELAT 110

Query: 121 XXXXXXX-XXXXXXXXXXIGSFQPKPLKISLKRNKSL---KEQNKKTVTFDVEEVTDLNI 176
                             +GSFQP+PLKI  ++   +    +  KK+V F+   + +++ 
Sbjct: 111 VPNEAPNDSPQSQSTRSSLGSFQPRPLKIIERQRLCMVTPSKPPKKSVGFN--PINEVDC 168

Query: 177 NSVI-SLPGSPLRNEQSSPPMNHHLRQAKSYDTGLNXXXXXXXXXXXXXXVYDSTFKNTQ 235
            S   SLP SP    +  P  N  LR AKS+DTGLN               Y+S FKN Q
Sbjct: 169 PSKTNSLPCSP----KKQPARNRTLRAAKSHDTGLN-----KSKKPSSSDTYESFFKNRQ 219

Query: 236 RLSISLFDIDTNENDITNISDQETVISSSSLTMDEPLEIIDDQKNNLKPLRRYNSHESIL 295
           RLS++        +D    SDQ+T+I  +  T   P   +  +    +PLRRYNSHESIL
Sbjct: 220 RLSLT---FFDEMDDEDFDSDQDTIILPNIST--PPHVGVTAKGAEFEPLRRYNSHESIL 274

Query: 296 STKIRPISISKRFQIGPFRXXXXXXXXXXXXXXXXXXXVKADDFYKPNLSNSTTSKDILS 355
           S K  P   SK   +G F                      +  F++P  SN T       
Sbjct: 275 SNKPAP---SKSLNLGSF----------------------SASFFRP--SNPTFG----- 302

Query: 356 MYSIKNDVQNSNRGXXXXXXXXXXXXXXXXXXWNIFNFPLIASSEVGSKQENNTTAKH-- 413
             SI N   N +                      + +F  IA S+  + +ENNT  KH  
Sbjct: 303 -TSISNVQVNCHPTVAATMAPSRNGPRISSSKALLSSF--IARSDTHTVKENNTNLKHAS 359

Query: 414 FGSQRKKQISSLSYN-KANYSTMTIGPNGSMFCSPTIYEPTFSN---TVSFQELHDALNT 469
           F  +    +S++S + ++       G N     +  + +   +N   +VS +EL DALNT
Sbjct: 360 FMDKFNSSLSTISESFQSKRGRKNKGMNEERISNHNVAQEQKNNMDISVSIEELQDALNT 419

Query: 470 EL 471
           EL
Sbjct: 420 EL 421

>Skud_3.2 Chr3 (5324..6604) [1281 bp, 426 aa] {ON} YCL063W (REAL)
          Length = 426

 Score =  169 bits (427), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 128/307 (41%), Positives = 171/307 (55%), Gaps = 31/307 (10%)

Query: 1   MPYSNIDDLSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDENDLEKVTDTYNLYMSQL 60
           M    ++D++ERLL+RSQEAILQLDLWIQRQQ+ +    + D+  L+K++  YN YMSQL
Sbjct: 1   MATQALEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTS-DQESLDKLSQQYNQYMSQL 59

Query: 61  NSLYIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLAX 120
           NSLY+RS++VRDKL+ +++ R  T           N    IEDL+ EFQDIT +LN LA 
Sbjct: 60  NSLYVRSESVRDKLSKEQQRRLIT---------EDNEHQRIEDLVHEFQDITSRLNELAT 110

Query: 121 XXXXXXX-XXXXXXXXXXIGSFQPKPLKISLKRNKSL---KEQNKKTVTFDVEEVTDLNI 176
                              GSFQP+PLKI  ++   +    +  KK+V F+   + D++ 
Sbjct: 111 VPHGVSNDSPQSQSTRSSSGSFQPRPLKIIERQRVCMVTPSKPPKKSVGFN--PINDVDC 168

Query: 177 NSVI-SLPGSPLRNEQSSPPMNHHLRQAKSYDTGLNXXXXXXXXXXXXXXVYDSTFKNTQ 235
            S   SLP SP    +  P  N  LR AKS+DTGLN               Y+S FKN Q
Sbjct: 169 PSKTNSLPCSP----KKPPAKNRTLRAAKSHDTGLN-----KSKKMSSTDAYESFFKNKQ 219

Query: 236 RLSISLFDIDTNENDITNISDQETVISSSSLTMDEPLEIIDDQKNNLKPLRRYNSHESIL 295
           RLS++ FD     +D    SDQ+T+I  +  T   P   +  +    +PLRRYNSHESIL
Sbjct: 220 RLSLTFFD---EMDDEDLDSDQDTIILPNIST--PPHMNVTAKGAEFEPLRRYNSHESIL 274

Query: 296 STKIRPI 302
           S K  PI
Sbjct: 275 SNKPAPI 281

>Smik_3.13 Chr3 (18714..19991) [1278 bp, 425 aa] {ON} YCL063W (REAL)
          Length = 425

 Score =  168 bits (425), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 126/302 (41%), Positives = 168/302 (55%), Gaps = 31/302 (10%)

Query: 6   IDDLSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDENDLEKVTDTYNLYMSQLNSLYI 65
           ++D++ERLL+RSQEAILQLDLWIQRQQ+ +      D+  L+KV+  YN YMSQLNSLY+
Sbjct: 6   LEDITERLLIRSQEAILQLDLWIQRQQRSSVCQTT-DQELLDKVSKQYNQYMSQLNSLYV 64

Query: 66  RSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLAXXXXXX 125
           RS++VRDKL+ +++ R  T           N    IEDL+ EFQDIT +LN LA      
Sbjct: 65  RSESVRDKLSKEQQRRLIT---------EDNEHQRIEDLVREFQDITLRLNELATAPNEV 115

Query: 126 XX-XXXXXXXXXXIGSFQPKPLKISLKRNKSL---KEQNKKTVTFDVEEVTDLNINSVI- 180
                        + SFQP+PLKI  ++   +    +  KK+V F+   + D++  S   
Sbjct: 116 ANDSPQSQSTRSSLESFQPRPLKIIERQRLCMVTPSKPPKKSVGFN--PINDVDCPSKTN 173

Query: 181 SLPGSPLRNEQSSPPMNHHLRQAKSYDTGLNXXXXXXXXXXXXXXVYDSTFKNTQRLSIS 240
           SLP SP    +  P  NH LR AKS+DTGLN               Y+S FKN QRLS++
Sbjct: 174 SLPCSP----KKQPAKNHTLRAAKSHDTGLN-----KSKKPSSADAYESFFKNRQRLSLT 224

Query: 241 LFDIDTNENDITNISDQETVISSSSLTMDEPLEIIDDQKNNLKPLRRYNSHESILSTKIR 300
                   +D    SDQ+TVI  +  T   P   +  +    +PLRRYNSHESILS K  
Sbjct: 225 ---FFDEMDDEDFDSDQDTVILPNIST--PPHVNVTAKGAEFEPLRRYNSHESILSNKPA 279

Query: 301 PI 302
           P+
Sbjct: 280 PL 281

>SAKL0C00440g Chr3 (39662..41050) [1389 bp, 462 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 462

 Score =  160 bits (405), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 158/497 (31%), Positives = 226/497 (45%), Gaps = 65/497 (13%)

Query: 5   NIDDLSERLLVRSQEAILQLDLWIQRQQQWAESD--DNHDENDLEKVTDTYNLYMSQLNS 62
            + ++S++LLVRSQEAILQLDL+IQRQQ+  E +  D  D   L K+ + Y   ++QLNS
Sbjct: 3   GLHEISQKLLVRSQEAILQLDLYIQRQQRLYEYETLDQPDNGLLTKLQE-YQTCLAQLNS 61

Query: 63  LYIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLAXXX 122
           L+IRS+++RD++ +               + + +G S I  L+ EFQ IT KLN LA   
Sbjct: 62  LHIRSEHLRDRIASTDH------------RASQDGDS-IGHLVTEFQKITTKLNELA-AT 107

Query: 123 XXXXXXXXXXXXXXXIGSFQPKPLKISLKRNKSLKEQNK-KTVTFDVEEVTDLNINSVI- 180
                          + SF+PKPLKI L+R K     +  K V    +++  L  N    
Sbjct: 108 QDRAYQSPGSQSTKSVSSFEPKPLKI-LERTKLQHPTSPTKRVATPPKKIAPLRKNPPFD 166

Query: 181 ------------SLPGSPLRNEQSSPPMN----HHLRQAKSYDTGLNXXXXXXXXXXXXX 224
                       SLPGSP  +  +S P++       R AKS D GLN             
Sbjct: 167 KKVMFSGHSKSTSLPGSP--SMAASSPVSIQQERFPRHAKSCDAGLNKQQRRRQDSDNRL 224

Query: 225 XVYDSTFKNTQRLSISLFDIDTNENDITNISDQETVISSSSLTMDEPLEIIDDQK-NNLK 283
                 FK  QRLSIS FD     ++I   SD++TVIS S      P E    +     +
Sbjct: 225 NF----FKENQRLSISFFD-----DEIDYSSDEDTVISVS------PPETTSFKGFPKAE 269

Query: 284 PLRRYNSHESILSTK-IRPISISKR---FQIGPFRXXXXXXXXXXXXXXXXXXXVKADDF 339
           PLRRYNSHES+LS K + P ++  R   F +   R                     A   
Sbjct: 270 PLRRYNSHESVLSRKEVLPAALPARAGWFSLWAGRNNKPKPMAESVSINDKPVYSTA-AL 328

Query: 340 YKPNLSNSTTSKDILSMYSIKNDVQNSNRGXXXXXXXXXXXXXXXXXXWNIFNFPLIASS 399
            + +   + TSKD+L+ +      Q   +                   W +FN  ++ +S
Sbjct: 329 LRSHSKTTETSKDLLAQFVSAAPKQ--KKQTTSWFGPAEEPKRSIFSGWKLFNNSVLVTS 386

Query: 400 EVGSKQENN-TTAKHFGSQRKKQISSLSYNKANY--STMTIGPNGSMFCSPTIYEPTFSN 456
           E G +  N+  +AK  G+    +   L   K +   S++ +GPNGS F SP   EP  +N
Sbjct: 387 ETGLQDSNSKPSAKRIGAAAPAKRVPLGRRKTHLPSSSLIMGPNGSRFVSPP-NEPVLNN 445

Query: 457 TVSFQELHDALNTELDL 473
            VS+  LH+AL TE  L
Sbjct: 446 KVSYDALHEALCTEFRL 462

>TPHA0E04020 Chr5 complement(842960..844582) [1623 bp, 540 aa] {ON}
           Anc_1.4 YCL063W
          Length = 540

 Score =  161 bits (408), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 140/360 (38%), Positives = 181/360 (50%), Gaps = 78/360 (21%)

Query: 4   SNIDDLSERLLVRSQEAILQLDLWIQRQQQ------WAESDD----NHDEND-LEKVTDT 52
           SN+++LSE+LL+RSQEAILQLDLWI RQQQ      +  + D      D N+ L  +  T
Sbjct: 6   SNLEELSEKLLIRSQEAILQLDLWILRQQQQHNDHRFGTATDTGNKTKDSNEALNALRST 65

Query: 53  YNLYMSQLNSLYIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDIT 112
           Y+LYMSQLNSLY+RS+ +RDKLN++K          + +K N++ + +IE+L+FEFQ+I 
Sbjct: 66  YDLYMSQLNSLYVRSEFIRDKLNSEKN---------NVNKFNLDHR-NIEELVFEFQNIR 115

Query: 113 RKLNVLAXXXXXXXXX-XXXXXXXXXIGSFQPKPLKISLKRNKSLKEQ-----NKKTVTF 166
            KLN LA                   + S   KPLK+  K  K + ++      +K+VTF
Sbjct: 116 EKLNQLAASSKLDKHSPPKTSTRSSSMESMNLKPLKVVAKHEKRMSKELELKNKEKSVTF 175

Query: 167 DVEEVTDLNINSVISLPGSPLR---NEQSSPPMNHH----LRQAKSYDTGLNXXXXXXXX 219
             E    L  N +    G  L    +  +SP +       LR A SYDTGLN        
Sbjct: 176 GKETRISLTTNGI----GGKLMIKDDSDASPQLIDKKYKVLRNAISYDTGLNSKSKSNKR 231

Query: 220 X-----XXXXXVYDSTFKNTQRLSISLFD--IDTNEND-----------------ITNIS 255
                       YDS FKN QR SISLF+  +DT  N                  I N S
Sbjct: 232 SNREYRKKNDAAYDSLFKNKQRFSISLFEDYVDTTTNTNYNEFNPTVDASINTELIENNS 291

Query: 256 DQETVISSSSLTM--DEPLE-------IIDDQKNN-------LKPLRRYNSHESILSTKI 299
           DQETVISSS L    +EPL+       I  D+ NN          LRR NSHESILSTK+
Sbjct: 292 DQETVISSSHLPCITNEPLDDYILSNSIQLDKNNNSGNNEGKKSHLRRCNSHESILSTKL 351

 Score = 34.7 bits (78), Expect = 0.59,   Method: Compositional matrix adjust.
 Identities = 29/79 (36%), Positives = 34/79 (43%), Gaps = 11/79 (13%)

Query: 396 IASSEVGSKQENNTTAKHFGSQRKKQISSLSYNKAN-YSTMTIGPNGSMFCSPTIYEPTF 454
           I SSEVG K  + +T           I   S N  N Y+   I  N        I  P  
Sbjct: 470 IISSEVGKKLCDRSTG----------IKVTSINTQNAYTFPFIRSNSHDITKQNITNPII 519

Query: 455 SNTVSFQELHDALNTELDL 473
              VS+ ELHDALNTE+ L
Sbjct: 520 KERVSYNELHDALNTEIKL 538

>NDAI0A00130 Chr1 (6694..8130) [1437 bp, 478 aa] {ON} Anc_1.4
           YCL063W
          Length = 478

 Score =  132 bits (333), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 159/514 (30%), Positives = 225/514 (43%), Gaps = 86/514 (16%)

Query: 6   IDDLSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDENDL--EKVTD-TYNLYMSQLNS 62
           + D++ERLL+RSQEAILQLDLWIQR+++  E    ++ N++  + V +  YN+Y++QLNS
Sbjct: 5   LQDITERLLIRSQEAILQLDLWIQREKKQQELSTLNNSNNITYDHVDNQQYNVYLAQLNS 64

Query: 63  LYIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLAXXX 122
           L +R Q +RDK           +  ++      + Q  IE+L++EF+ IT KLN L+   
Sbjct: 65  LIVRVQYIRDKF----------LHNINQLDSTQDEQKYIENLVYEFKQITLKLNDLSKKN 114

Query: 123 XXXXXXXX---XXXXXXXIGSFQPKPLKISLKRNKSLKEQNKKTVTFDVEEVT-DLNINS 178
                             + SF+PKPLKI +KR K+  ++   T+  D + +  D N+  
Sbjct: 115 KTTSSSENSSKTASSKSSMESFEPKPLKI-IKRTKN-DQKVSNTINNDHDLIMQDENLQR 172

Query: 179 VISLPGSPLRNEQSS----PPMNHHLRQAKSYDTGLNXXXXXXXXXXXXXXVYDST---- 230
             SLP SP+  E+SS         +LR  KS D                    + T    
Sbjct: 173 PNSLPSSPI--EKSSYVTISQNEQNLRLMKSQDFSTKKNTSRNTNYNTIRKFENDTINQF 230

Query: 231 FKNTQRLSISLFDID------TNENDITNI---------SDQETVISSSSLTMDEPLEII 275
           FK+ QRLSI +FD D      TN    T I         SDQ TVIS  ++  ++     
Sbjct: 231 FKSQQRLSIGIFDNDDDNIYSTNMGTATRITGEYLTDNNSDQATVISQGTIKRND----- 285

Query: 276 DDQKNNLKPLRRYNSHESILSTKIRPISISKRFQIGPFRXXXXXXXXXXXXXXXXXXXVK 335
           DD      PLRRYNSHESILS KI    +        F                      
Sbjct: 286 DD----FTPLRRYNSHESILSQKISSTPLIDNNNNLTFNSKLPLYSSIRRPSMQSIHVTS 341

Query: 336 ADDFYKPNLSNSTTSKDILSMYSIKNDVQNSNRGXXXXXXXXXXXXXXXX---------- 385
              F +   S   TSKD+LS +   +  +N+NR                           
Sbjct: 342 NPIFARS--SQGKTSKDLLSSFVTSSIPRNNNRNIQTRTKTRTQSRRNNQLRDHTINQTS 399

Query: 386 -----XXWNIFN-FPLIASSEVGSKQENNTTAKHFGSQRKKQISSLSYNKANYSTMTIGP 439
                  WN  N F +I S       E NTT      +R   I  ++ ++A+     I  
Sbjct: 400 TSSFFGNWNFLNRFNMITS-------ETNTTT---NRKRNYNIPLVNQSRAH----NIDV 445

Query: 440 NGSMFCSPTIYEPTFSNTVSFQELHDALNTELDL 473
           N +M  S +I EP + NT+S  +L DALNTEL L
Sbjct: 446 NDTM-DSISIKEPVYDNTISLDDLEDALNTELLL 478

>NCAS0B09120 Chr2 complement(1749531..1750832) [1302 bp, 433 aa]
           {ON} Anc_1.4 YCL063W
          Length = 433

 Score =  128 bits (321), Expect = 8e-32,   Method: Compositional matrix adjust.
 Identities = 161/508 (31%), Positives = 224/508 (44%), Gaps = 118/508 (23%)

Query: 6   IDDLSERLLVRSQEAILQLDLWIQRQQQ-------------WAESDDNHD-ENDLEKVTD 51
           + D+SERLLVRSQEAILQLD+WIQRQ++               +++ N D    L +  +
Sbjct: 4   LQDISERLLVRSQEAILQLDVWIQRQRRLQELMEGEEEQEQGGDTNTNMDIRGTLPQFLE 63

Query: 52  TYNLYMSQLNSLYIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDI 111
            YN YM+QLNSL +R + +RD L  KK +     +  S + V  + Q  I+DL+ EFQDI
Sbjct: 64  QYNTYMAQLNSLQVRVEFIRDTLVNKKNTGIRNQQLESNNSV--DEQKYIQDLVHEFQDI 121

Query: 112 TRKLNVLAXXXXXXXXXXXXXXXXXXIGSFQPKPLKISLKRN--KSLKEQNK--KTVTFD 167
           T+KL+ L+                  I SF+PKPL+I  + N    L +Q    K V+F+
Sbjct: 122 TQKLSELSTVRNPSTASSRSTSTKSSIESFKPKPLRIISRSNTHSHLHQQTSLDKKVSFN 181

Query: 168 VEEVTDLNINSVISLPGSPLRNEQSSPPMNHHLRQAKSYDTGLNXXXXXXXXXXXXXXVY 227
            +E      +S      S   N +S       LR  KS D                  + 
Sbjct: 182 EDESNSSISHSRSM--ESLHENSKS-------LRNTKSMDV-----------------LK 215

Query: 228 DSTFKN----------TQRLSISLFDIDTNENDITNI-------SDQETVISSSS--LTM 268
            STFKN           QRLSI++FD D   N+  N        SDQ TVIS  +     
Sbjct: 216 RSTFKNHSDFSKLLNSRQRLSINIFDDDLIANEDGNEFYNQYSDSDQATVISHGTPIRGA 275

Query: 269 DEPLEIIDDQKNNLKPLRRYNSHESILSTKIRPISISKRFQIGPFRXXXXXXXXXXXXXX 328
           D PL            LRRYNSHESILS + +P    +  QI P+               
Sbjct: 276 DTPL------------LRRYNSHESILSFR-KPTQSRQPNQILPY--------SSVRQPS 314

Query: 329 XXXXXVKADDFY---KPNLSNSTTSKDILSMYSIKNDVQNSNRGXXXXXXXXXXXXXXXX 385
                V ++  +   +PN     TSKD+LS +       N  +                 
Sbjct: 315 MQSVAVNSNPIFSRMRPN----ATSKDLLSSFI------NKPQPNRLHQQKPKPNSNSLF 364

Query: 386 XXWNIFNFPLIASSEVGSKQENNTTAKHFGSQRKKQISSLSYNKANYSTMTIGPNGSMFC 445
             WN FN     +SE+G+     TT + + +      SS+S NK N       PN  +  
Sbjct: 365 GKWNFFNKFNSVTSEIGT-----TTTQLYPTN-----SSMS-NKFN-------PND-IPS 405

Query: 446 SPTIYEPTFSNTVSFQELHDALNTELDL 473
           S +I EP F +++  ++L+DALNTEL L
Sbjct: 406 SASIREPVFDDSLHLEDLNDALNTELLL 433

>KNAG0C00190 Chr3 (28746..30074) [1329 bp, 442 aa] {ON} Anc_1.4
           YCL063W
          Length = 442

 Score =  124 bits (312), Expect = 1e-30,   Method: Compositional matrix adjust.
 Identities = 117/367 (31%), Positives = 175/367 (47%), Gaps = 56/367 (15%)

Query: 6   IDDLSERLLVRSQEAILQLDLWIQRQQQWAESDDNH-DENDLEKVTDTYNLYMSQLNSLY 64
           ++D+++RLL+RSQ+AILQL+LW+Q+Q++   +D    D    E +    NL++SQLNSL 
Sbjct: 4   LEDVTDRLLIRSQDAILQLELWVQQQEKLLLTDHASVDRKKFEAIAQQRNLHLSQLNSLC 63

Query: 65  IRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLAXXXXX 124
           +RS+ +++KL +++          +   +    +S IE+L++EFQDI   LN L+     
Sbjct: 64  LRSRYIKEKLASER----------NICSIRKGRRSYIENLVYEFQDIAMSLNELSETNRK 113

Query: 125 XXXXXXXXXXXXXIGSFQPKPLKISLKRN-----KSLKEQNKKTVTFDVE-EVTDL--NI 176
                          SF+PKPL+I L+R      KS  ++N   +    E E +D   N+
Sbjct: 114 NGSPVSQATTNSS-DSFEPKPLRI-LERQRTCNAKSPTKRNSNHIKIPRETEKSDFTENV 171

Query: 177 NSVI--SLPGSPLRNEQSSPPMNHHLRQAKSYDTGLNXXXXXXXXXXXXXXVYDSTFKNT 234
              +  SLP SPLR    S      +R  KSY   LN                 + F   
Sbjct: 172 ADCLHSSLPSSPLRGSNGS---QQTIRLTKSYHESLNGQKPTSHSPLM------NPFNAK 222

Query: 235 QRLSISLFDIDTNENDITNI----SDQETVISSSSLTMDEPLEIIDDQKNNLKPLRRYNS 290
            RLS+ LFD + +E ++T      SDQETV+ +S +           +    +PLRRYNS
Sbjct: 223 NRLSLYLFD-NIDEKELTPCDDDNSDQETVMYNSPVV---------SKGAAFEPLRRYNS 272

Query: 291 HESILS-TKIRPI-SISKRFQIGPFRXXXXXXXXXXXXXXXXXXXVKADDFYKPNLSNST 348
           HESILS  K  PI S +++ Q  P                     V +   Y   LS  +
Sbjct: 273 HESILSVAKKAPIHSSAQKLQFYP--------SATNGTTSAQSVFVSSKPVYTKPLSVQS 324

Query: 349 TSKDILS 355
            SKD+LS
Sbjct: 325 RSKDLLS 331

>CAGL0B00308g Chr2 (16533..17825) [1293 bp, 430 aa] {ON} similar to
           uniprot|P25591 Saccharomyces cerevisiae YCL063w
          Length = 430

 Score =  120 bits (302), Expect = 3e-29,   Method: Compositional matrix adjust.
 Identities = 109/310 (35%), Positives = 163/310 (52%), Gaps = 40/310 (12%)

Query: 4   SNIDDLSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDEND-LEKVTDTYNLYMSQLNS 62
           +++++++ERLL RS EAI QLD WI  Q +     +N    D +E++ D Y  ++ +LNS
Sbjct: 2   ASLEEITERLLERSNEAIEQLDEWILLQNKNRHISENKSGLDSIERLDDKYTEFLEKLNS 61

Query: 63  LYIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLAXXX 122
           LYIRSQ ++DK+ T+K ++    K    S++N    S I++L+ EF++IT  LN +A   
Sbjct: 62  LYIRSQYIKDKIRTEKNAKATKRK----SELNT---SRIQELMLEFKEITLSLNEIAQQD 114

Query: 123 XXXXXXX---XXXXXXXXIGSFQPKPLKI----SLKRNKSLKEQNKKTVTF-DVEEVTDL 174
                             + SF PKPLKI    S+ R+       K+ ++F  + E  +L
Sbjct: 115 DETNSKQLSPASTSTKSSLESFTPKPLKILNRASMIRSPINSPPKKRNISFCPIHE--NL 172

Query: 175 NINSVISLPGSPLRN----EQSSPPMNHHLRQAKSYDTGLNXXXXXXXXXXXXXXVYDST 230
           ++    SLP SP R+    EQ        L  A+S+ TGL                 D  
Sbjct: 173 SVTEYESLPSSPNRSNLLEEQE-----QVLHPARSFQTGLRTEKARKPDKNQ----LDKY 223

Query: 231 FKNTQRLSISLF---DIDTNEN-DITNISDQETVISSSSLTMDEPLEIIDDQKNNLKPLR 286
           FK+ QRLS++LF   D D  E+ +  + SD+ETVI +SS  + E   I DD    +KP+R
Sbjct: 224 FKDKQRLSLTLFGSADADDGESLNNNDYSDEETVIFTSSSNI-ETDAITDD----MKPIR 278

Query: 287 RYNSHESILS 296
           R NSHES+LS
Sbjct: 279 RCNSHESVLS 288

>KLLA0C00462g Chr3 (33948..35330) [1383 bp, 460 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 460

 Score =  110 bits (274), Expect = 2e-25,   Method: Compositional matrix adjust.
 Identities = 138/497 (27%), Positives = 220/497 (44%), Gaps = 75/497 (15%)

Query: 9   LSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDENDLEKVTDTYNLYMSQLNSLYIRSQ 68
           ++ERL++R  EA++QL+L IQR+    E D N+    ++     Y  ++++L+SL +R++
Sbjct: 7   VAERLVIRCNEAVMQLELSIQRKM--CEFDPNNSHCFIQ--VQEYYSFLARLSSLKLRAE 62

Query: 69  NVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLAXXXXXXXXX 128
           +V++ L  ++K          P+ V +  ++ +E LI+EFQDIT  LN +A         
Sbjct: 63  HVQESLRHQRKD---------PNDVCIEYET-LEKLIYEFQDITMSLNEVARAYQSPTKS 112

Query: 129 XXXXXXXXX------------------IGSFQPKPLKISLKRNKSLKEQN-----KKTVT 165
                                      IG+    P+K SL + K  +E N     K+ V 
Sbjct: 113 ARSGSSKESSVIPLKTLKIIERNRDSLIGT---SPMKKSLSQLKK-EEHNQSLPAKRNVR 168

Query: 166 FDVEEVTDLN----INSVISLPGSPLRNEQSSPPM----NHHLRQAKSYDTGLNXXXXXX 217
           F  +++  L+    +    SLPGSP+ +      M    +  LR AKSYD GLN      
Sbjct: 169 FQEDDLDILHHLHSVKRANSLPGSPMPDTLLESQMFSREHKTLRMAKSYDVGLNGRAKKN 228

Query: 218 XXXXXXXXVYDSTFKNTQRLSISLFDIDTNENDITNISDQETVISSSSLTMDEPLEIIDD 277
                        FKN  RLS+S+FD D N    T+ SD+ETVIS S   +   L   +D
Sbjct: 229 ADWEF--------FKNKNRLSLSVFD-DVN----TDASDEETVISVSPPNISYYLSQNED 275

Query: 278 QKNNLKPLRRYNSHESILSTKIRPISISKRFQIGPFRXXXXXXXXXXXXXXXXXXXVKAD 337
           Q  + K +RR NSHESILS KI   S      + P                       ++
Sbjct: 276 QYPS-KQVRRCNSHESILSRKILSPSTPANLIMRP--TYQSVWQKKAIVTKPTISCSTSN 332

Query: 338 DFYKPNLSNSTTSKDILSMYSIKNDVQNSNRGXXXXXXXXXXXXXXXXXXWNIFNFPLIA 397
               P + +   SKD+LS + +        RG                  W  FN   + 
Sbjct: 333 STASPTIGSPHLSKDMLSQF-VTAPPSKKYRG-WFSSSNSTPFASSIFQKW--FNSDSLV 388

Query: 398 SSEVGSKQENN-TTAKHFGSQRKKQISSLSYNKANYSTMTIGPNGSMFCSPTIYEPTFSN 456
           + E+G+   ++ ++ +     R++  SS     +  +++ IGPNG+ F    + +P  + 
Sbjct: 389 TKEIGNPDNSSPSSGRPIVENRQRHSSS----NSYSTSIVIGPNGAKFIR-GLNDPLVTC 443

Query: 457 TVSFQELHDALNTELDL 473
           TVS+ EL +ALNTE + 
Sbjct: 444 TVSYNELQEALNTEFNF 460

>TBLA0A07580 Chr1 complement(1878594..1880135) [1542 bp, 513 aa]
           {ON} Anc_1.4 YCL063W
          Length = 513

 Score = 95.1 bits (235), Expect = 3e-20,   Method: Compositional matrix adjust.
 Identities = 97/319 (30%), Positives = 144/319 (45%), Gaps = 40/319 (12%)

Query: 7   DDLSERLLVRSQEAILQLDLWIQRQQQWAESDD--NHDENDLEKVTDTYNLYMSQLNSLY 64
           +++S RLL ++QEA+LQLDLWI+ QQ +   D         LE+    YN YM QLNSLY
Sbjct: 5   EEVSIRLLTKAQEAVLQLDLWIKDQQGFQNRDGLRASTSESLEQAERDYNRYMFQLNSLY 64

Query: 65  IRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLAXXXX- 123
           +R+Q +RDK+   +K     +     +  + N  + ++ L+ EF  ++ K+N L+     
Sbjct: 65  LRAQYIRDKI---EKQNAYNLADSDVAGNDTNSHAYVQQLVTEFYSLSIKMNELSAIQEN 121

Query: 124 --------XXXXXXXXXXXXXXIGSFQPKPLKISLKRNKSLKEQNKKTVTFDVEEVTDL- 174
                                    FQP+PLKI L+R K    QN      D+E    L 
Sbjct: 122 VTNGSSPLSNKSSHSNDSLSKITDGFQPRPLKI-LQRQKHNNNQNTHPQP-DLESPLKLK 179

Query: 175 ---NINSVIS---LPGSPLRNEQSSPPMNHHLR------QAKSYDTGLNXXXXXXXXXXX 222
              + N ++S       P +N  S    N+ L       + +S++               
Sbjct: 180 HRSSYNKLLSSNKKESKPYKNFNSKKSKNNELLSDISPVKIQSFEEPTFSVANTRNKNSM 239

Query: 223 XXXVYDSTFKNTQRLSISL---FDIDTNENDITNISDQETVISSSSLTMDEPLEIIDDQK 279
               Y S FK   RLSI     +D D   +D T ISDQ+T+  S+        +I    K
Sbjct: 240 DPLHY-SLFKTNNRLSIQFPDGYDNDDEYDDPTCISDQDTIFVSTP-------KIASSIK 291

Query: 280 NNLKPLRRYNSHESILSTK 298
           N  +PLR++NSHESILS +
Sbjct: 292 NTSEPLRKFNSHESILSVE 310

>Kwal_33.13003 s33 (35425..36774) [1350 bp, 449 aa] {ON} YCL063W -
           Hypothetical ORF [contig 123] FULL
          Length = 449

 Score = 77.8 bits (190), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 117/491 (23%), Positives = 196/491 (39%), Gaps = 70/491 (14%)

Query: 6   IDDLSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDENDLEKVTDT---YNLYMSQLNS 62
           +  +++  L RS+EA+++L+  + +Q++  ES+ + D+   E+ + T   Y  Y+ QLN 
Sbjct: 4   LAKIAQCALERSEEALVRLEKCVGKQRRLYESERS-DQCLSEESSSTIVQYYSYLGQLNC 62

Query: 63  LYIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRKLNVLAXXX 122
           LYI++Q+++D +  +     N+             Q  IE L  +++ +    N L    
Sbjct: 63  LYIKAQSLKDMMGNRCGHLPNST------------QEAIERLEHDYKALCNHANELG-IR 109

Query: 123 XXXXXXXXXXXXXXXIGSFQPKPLKISLKRNKSLKEQNKKTVTFDV------EEVTDLNI 176
                          + SFQPKPLKI  +R         K  T  V         TD N 
Sbjct: 110 EKNLEDSPSCLSPASVSSFQPKPLKIIERRLAQTNTSPTKVCTATVMAKSFCRSGTDKNS 169

Query: 177 NSVISLPG--------SPLRNEQSSPPMNHHLRQAKSYDTGLNXXXXXXXXXXXXXXVYD 228
           + +    G        SP  NE    P    +R  KS  TGLN                 
Sbjct: 170 DYIPDEIGKTNSCNTNSPCTNEAKKEP--KFIRVVKSCGTGLNKHSNPHENRL------- 220

Query: 229 STFKNTQRLSISLFDIDTNENDITNISDQETVISSSSLTMDEPLEIIDDQKNNLKPLRRY 288
           S F++ QRLSIS  +      D   +SD+ET+ S S L     L       N+   + + 
Sbjct: 221 SFFRDRQRLSISFIE------DDEYLSDEETITSGSPLNASFLL-------NDFAKVAKG 267

Query: 289 NSHESILSTKIRPISISKR----FQIGPFRXXXXXXXXXXXXXXXXXXXVKAD--DFYKP 342
             ++++ S+  R +  ++R      + PF                    ++ D    + P
Sbjct: 268 RPNQTLASS--RHVENNERGAQTAAVSPF-VSLVPKKTCTAQIGLTSIDIRPDFGPCFSP 324

Query: 343 NLSNSTTSKDILSMYSIKNDVQNSNRGXXXXXXXXXXXXXXXXXXWNIFNFPLIASSEVG 402
               +T SK+ILS + IK       R                   + IFN  ++ +SE G
Sbjct: 325 KKFETTESKEILSHFVIKEP-----RTKSHSWLKGCDKSVPFLQTFKIFNNQVLVTSETG 379

Query: 403 SKQENNTTAKHFGSQRKKQISSLSYNKANYSTMTIGPNGSMFC-SPTIYEPTFSNTVSFQ 461
            +  + TT+    +  +K  +    +    S +  G +GS F  +P   E  F   VS++
Sbjct: 380 CRNVDRTTSTKLITPSRKHFAQRELSDRTCSILVHGSSGSRFVNAPQQQELHFK--VSYE 437

Query: 462 ELHDALNTELD 472
            L +ALNT+L+
Sbjct: 438 ALREALNTDLN 448

>KAFR0D00120 Chr4 (9052..10251) [1200 bp, 399 aa] {ON} Anc_1.4
           YCL063W
          Length = 399

 Score = 62.8 bits (151), Expect = 6e-10,   Method: Compositional matrix adjust.
 Identities = 126/490 (25%), Positives = 200/490 (40%), Gaps = 124/490 (25%)

Query: 9   LSERLLVRSQEAILQLDLWIQRQQQWAESDDNHDENDLEKVTDTYNLYMSQLNSLYIRSQ 68
           +S+ LL RS+EA+ QL+ W+++Q+Q            L + T  Y     QLNSL  +S+
Sbjct: 5   VSDTLLQRSEEAVSQLESWLKQQEQ------------LHQTTAEY----KQLNSLCAKSK 48

Query: 69  NVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSD----IEDLIFEFQDITRKLNVLAXXXXX 124
            + + L    K  +++I +      ++  Q +    +E LI EF +I+ KLN +      
Sbjct: 49  YISNLL----KDDSSSIPH------DLMEQKERSFIVESLIHEFNEISTKLNEIV----- 93

Query: 125 XXXXXXXXXXXXXIGSFQPKPLKISLKRNKSLKEQNKKT-VT------------FDVEEV 171
                        I SF+PKPL + L++NK L+   + + VT            F +   
Sbjct: 94  -----THTSPQSTIDSFEPKPLNL-LRKNKILESPTRSSPVTRGRLERKISINLFPMHTT 147

Query: 172 TDLNINSVISLPGSPLRNEQSSPPMNHHLRQAKSYDTGLNXXXXXXXXXXXXXXVYDSTF 231
           T  N     S+P SP + + +S      LR  KSY  GLN               Y + F
Sbjct: 148 TKCN-----SVPTSP-KCKSTSTLNQRTLRNIKSYHYGLNGD-------------YINPF 188

Query: 232 KNTQRLSISLFDIDTNENDITNISDQETVISSSSLTMDEPLEIIDDQKNNLKPLRRYNSH 291
           K   RLSIS F+ D   ND  N   +  +    ++ +  P      QK     L+R NS 
Sbjct: 189 KENNRLSISFFNGDNTFND-NNSDSESDIDDDDTVLVTSPFLTNPKQK-----LKRSNSQ 242

Query: 292 ESILSTK--IRPISISKRFQIGPFRXXXXXXXXXXXXXXXXXXXVKADDFYKPNLSNSTT 349
           +S+   +  +R  S  K+  + P                          F K      ++
Sbjct: 243 DSVFWNENYLRKPSFQKQLNLFP-----------STLTKPTAELSSTQVFLKNTGRLGSS 291

Query: 350 SKDILSMYSIKNDVQNSNRGXXXXXXXXXXXXXXXXXXWNIFNFPLIASSEVGSKQENNT 409
           SK +L+ + +K+++Q   R                    NIFN     +SE+G  + + +
Sbjct: 292 SKALLTSF-VKDNLQQQQRTHNASSFN------------NIFN---SVTSEIGKSKLDKS 335

Query: 410 TAKHFGSQRKKQISSLSYNKANYSTMTIGPNGSMF--------CSPTIYEPTFSNTVSFQ 461
              H  ++R+     LS N    ST+ I    S F         SPT  +P  +N V + 
Sbjct: 336 QIIH--TERR----VLSDNSIVISTL-ITSKKSRFNRFSSVDNISPT-KKPIINNDVQYS 387

Query: 462 ELHDALNTEL 471
           +L+DALNTE 
Sbjct: 388 DLNDALNTEF 397

>KLTH0F00462g Chr6 (35640..36995) [1356 bp, 451 aa] {ON} weakly
           similar to uniprot|P25591 Saccharomyces cerevisiae
           YCL063W VAC17 vacuole inheritance
          Length = 451

 Score = 61.6 bits (148), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 75/278 (26%), Positives = 117/278 (42%), Gaps = 45/278 (16%)

Query: 6   IDDLSERLLVRSQEAILQLDLWIQRQQQWAESD--DNHDENDLEKVTDTYNLYMSQLNSL 63
           + ++++  L  SQ A+ +LD  ++RQ++  ES   D    +        Y  Y+ QL SL
Sbjct: 4   LQEIAQESLALSQSALARLDSCLERQRRLYESGFPDQCLSDKSSTNMAQYYEYIGQLYSL 63

Query: 64  YIRSQNVRDKLNTKKKSRTNTIKYVSPSKVNMNGQSDIEDLIFEFQDITRK-LNVLAXXX 122
           Y ++Q + D +        ++++           Q  IE+LI EFQ+I +   N ++   
Sbjct: 64  YTKAQKLSDTVILSDSKSLSSVQ-----------QRAIENLIQEFQEIAKNDENFISYSM 112

Query: 123 XXXXXXXXXXXXXXXIGSFQPKPLKISLKRNKSLKEQNKKTVTFDVEEVTDLN--INSVI 180
                          I SFQPKPLKI  +R   L+   K++    +  + +     N   
Sbjct: 113 RESPNSMSVQS----ICSFQPKPLKILQRRQAQLESPTKRSFRPSMSLLDNRGDETNLAT 168

Query: 181 SLPGSPLRNEQSSPPMNH------------HLRQAKSYDTGLNXXXXXXXXXXXXXXVYD 228
           +   S  R   SSP   H             +R AKS D GLN                 
Sbjct: 169 ASDRSQERLLGSSPSSIHFFRPSHTNADTLFIRSAKSCDAGLNRRSNPHENRL------- 221

Query: 229 STFKNTQRLSISLFDIDTNENDITNISDQETVISSSSL 266
           + FK+ QRLSIS  +      D  ++SD+ TVIS+ SL
Sbjct: 222 NFFKDRQRLSISFIE------DEEDVSDEATVISAGSL 253

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.128    0.352 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,917,605
Number of extensions: 1940012
Number of successful extensions: 8339
Number of sequences better than 10.0: 64
Number of HSP's gapped: 8595
Number of HSP's successfully gapped: 73
Length of query: 474
Length of database: 53,481,399
Length adjustment: 113
Effective length of query: 361
Effective length of database: 40,524,141
Effective search space: 14629214901
Effective search space used: 14629214901
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 68 (30.8 bits)