Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_2002.61.3ON35035016080.0
Suva_3.1501.3ON36134811431e-156
NCAS0B091301.3ON36735511331e-155
Skud_3.11.3ON36034811291e-154
TPHA0E040401.3ON35733911261e-154
NDAI0A001201.3ON37736411271e-154
Smik_3.121.3ON36034811231e-153
KNAG0C001801.3ON35934811201e-153
YCL064C (CHA1)1.3ON36034811191e-153
KAFR0D001101.3ON36535210931e-149
TBLA0A049201.3ON36034910471e-142
CAGL0B00286g1.3ON36033410101e-136
KAFR0I00130singletonON3443449881e-133
KAFR0F04430singletonON3433429251e-123
NCAS0A15330singletonON3473419221e-123
ZYRO0F15774gsingletonON4103338951e-118
SAKL0C00418g1.3ON3643508601e-113
NDAI0K02950singletonON3343298511e-112
KLLA0C00440g1.3ON3773258001e-104
KLTH0F00440g1.3ON3413337951e-104
ZYRO0F18524g1.3ON3353347771e-101
KNAG0D05380singletonON3343347681e-100
AFR747W1.3ON4263417771e-100
Ecym_10061.3ON3643587499e-97
SAKL0C13904gsingletonON3393317424e-96
Smik_9.2na 1ON3383267201e-92
Scer_YGOB_SDL1 (SDL1)na 1ON3373326956e-89
Skud_9.2na 1ON3393236887e-88
TDEL0D06540singletonON3373246755e-86
KLLA0E01805gsingletonON3223226293e-79
KNAG0A01150singletonON2312215162e-63
YIL167W (SDL1)singletonOFF2101984375e-52
YIL168WsingletonOFF1271212642e-27
SAKL0F11858g7.367ON5622271729e-13
KAFR0K017007.367ON5792281641e-11
KLLA0E19779g7.367ON5672271514e-10
CAGL0I05126g7.367ON5712641434e-09
NCAS0A142307.367ON5692641434e-09
Ecym_47087.367ON5702881401e-08
TDEL0C018007.367ON5692271354e-08
TBLA0C050707.367ON5752551337e-08
Suva_5.1997.367ON5762281311e-07
ACR232C7.367ON5602271311e-07
ZYRO0B02772g7.367ON5692281292e-07
Kpol_530.167.367ON5662231274e-07
Smik_5.2257.367ON5762281264e-07
YER086W (ILV1)7.367ON5762281257e-07
NDAI0A018107.367ON5702281202e-06
Skud_5.2057.367ON5762281203e-06
TPHA0F031307.367ON5682281168e-06
KNAG0C036907.367ON5772641151e-05
Kwal_33.148227.367ON5622641105e-05
KLTH0B04884g7.367ON5732231097e-05
SAKL0A10626gsingletonON3201611033e-04
YKL218C (SRY1)na 2ON3263201024e-04
Skud_11.2na 2ON3262961006e-04
Suva_10.5144.259ON780143722.2
Smik_17.27singletonON68820695.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_2002.6
         (350 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON} ...   624   0.0  
Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON...   444   e-156
NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3    441   e-155
Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL0...   439   e-154
TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3...   438   e-154
NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON} A...   438   e-154
Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON} Y...   437   e-153
KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}...   436   e-153
YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}  CH...   435   e-153
KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON} A...   425   e-149
TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa] ...   407   e-142
CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON...   393   e-136
KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}...   385   e-133
KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON}              360   e-123
NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON}            359   e-123
ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} simi...   349   e-118
SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON...   335   e-113
NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON}             332   e-112
KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON...   312   e-104
KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON...   310   e-104
ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} simi...   303   e-101
KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {O...   300   e-100
AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic ...   303   e-100
Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON} si...   293   9e-97
SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} simi...   290   4e-96
Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)      281   1e-92
Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa...   272   6e-89
Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)      269   7e-88
TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON}            264   5e-86
KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {O...   246   3e-79
KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}                   203   2e-63
YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open rea...   172   5e-52
YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading ...   106   2e-27
SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly...    71   9e-13
KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7....    68   1e-11
KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]...    63   4e-10
CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {...    60   4e-09
NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON} Anc_7...    60   4e-09
Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar...    59   1e-08
TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {O...    57   4e-08
TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON} Anc_7...    56   7e-08
Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W ...    55   1e-07
ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON} S...    55   1e-07
ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly...    54   2e-07
Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}...    54   4e-07
Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W ...    53   4e-07
YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threon...    53   7e-07
NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {O...    51   2e-06
Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W ...    51   3e-06
TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {O...    49   8e-06
KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {O...    49   1e-05
Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {...    47   5e-05
KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly...    47   7e-05
SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {O...    44   3e-04
YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}  SR...    44   4e-04
Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON} YKL...    43   6e-04
Suva_10.514 Chr10 complement(878137..880479) [2343 bp, 780 aa] {...    32   2.2  
Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}...    31   5.3  

>Kpol_2002.6 s2002 complement(7840..8892) [1053 bp, 350 aa] {ON}
           complement(7840..8892) [1053 nt, 351 aa]
          Length = 350

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/350 (88%), Positives = 308/350 (88%)

Query: 1   MSLVYNKTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKP 60
           MSLVYNKTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKP
Sbjct: 1   MSLVYNKTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKP 60

Query: 61  YVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADN 120
           YVF               QRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADN
Sbjct: 61  YVFSSSGGNAGLAAATASQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADN 120

Query: 121 FLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSV 180
           FLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSV
Sbjct: 121 FLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSV 180

Query: 181 XXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTA 240
                        EKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTA 240

Query: 241 NISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTDLLETA 300
           NISNQMFDYAKKYN              CLKFTHDHNMVIEPACGAAIHLGYHTDLLETA
Sbjct: 241 NISNQMFDYAKKYNTKSVVVEDKDVVETCLKFTHDHNMVIEPACGAAIHLGYHTDLLETA 300

Query: 301 LGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQKASPTIPSFIDI 350
           LGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQKASPTIPSFIDI
Sbjct: 301 LGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQKASPTIPSFIDI 350

>Suva_3.150 Chr3 complement(225656..226741) [1086 bp, 361 aa] {ON}
           YCL064C (REAL)
          Length = 361

 Score =  444 bits (1143), Expect = e-156,   Method: Compositional matrix adjust.
 Identities = 213/348 (61%), Positives = 253/348 (72%)

Query: 1   MSLVYNKTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKP 60
           MS+VYNKTPLL+ FFPGK+L QFYLKYE LQPSGSFKSRGIGNLILKNAIRI+K   + P
Sbjct: 1   MSIVYNKTPLLRQFFPGKSLAQFYLKYECLQPSGSFKSRGIGNLILKNAIRIQKNGKRSP 60

Query: 61  YVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADN 120
            VF               QRLSLPCTVVVPTATKERMV+KIR TGA VI+ G  WKEAD 
Sbjct: 61  QVFASSGGNAGFAAATACQRLSLPCTVVVPTATKERMVEKIRNTGAQVIVNGAFWKEADT 120

Query: 121 FLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSV 180
           +LK N+MN I+   +EPIYVHPFDNP IWEGHS+MVDEI++    Q+  ++ +K IVCSV
Sbjct: 121 YLKTNVMNLIDHQAVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRVPMEKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTA 240
                        E++ LADKIP+VGVET+GCHVFNTSL++ +PV+F KI++IATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERHGLADKIPIVGVETKGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 NISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTDLLETA 300
           NISNQ F+YA+KYN              CLK++H  NMV EPACGAA+HLGYHTD+LETA
Sbjct: 241 NISNQTFEYARKYNTKSVVVEDKDVIETCLKYSHQFNMVTEPACGAALHLGYHTDILETA 300

Query: 301 LGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQKASPTIPSFI 348
           L TKL  DD VLI+ACGGSSNTV++LE  L  +  +   A     +FI
Sbjct: 301 LDTKLAADDIVLIIACGGSSNTVQDLEETLASMKKEGVPAIELADNFI 348

>NCAS0B09130 Chr2 (1751219..1752322) [1104 bp, 367 aa] {ON} Anc_1.3
          Length = 367

 Score =  441 bits (1133), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 213/355 (60%), Positives = 260/355 (73%), Gaps = 6/355 (1%)

Query: 1   MSLVYNKTPLLKHFFPG------KNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKK 54
           MS+VYNKTPLL+ FFP        ++PQF+LKYE LQPSGSFKSRGIGNLI+KNAIRIKK
Sbjct: 1   MSIVYNKTPLLRQFFPAVSTKPSTSIPQFFLKYECLQPSGSFKSRGIGNLIMKNAIRIKK 60

Query: 55  INVKKPYVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNH 114
              K P VF               QRLSLPCTVVVPTATK+RMV+KIRATGANVII G H
Sbjct: 61  SGNKSPQVFSSSGGNAGFAAATASQRLSLPCTVVVPTATKQRMVEKIRATGANVIINGAH 120

Query: 115 WKEADNFLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLK 174
           WKEAD +LK ++MN I+ +  EPIYVHPFDNP IWEGHSTMVDEI++T ++Q   +  +K
Sbjct: 121 WKEADTYLKSSVMNSIDLNTTEPIYVHPFDNPDIWEGHSTMVDEIVDTLNEQNIALNKIK 180

Query: 175 AIVCSVXXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIA 234
            IVCSV             EK+ LADKIP+VGVET+GCHVFNTSLKL K +EF+KI++IA
Sbjct: 181 GIVCSVGGGGLYNGIIQGLEKHKLADKIPIVGVETKGCHVFNTSLKLGKQIEFSKITSIA 240

Query: 235 TSLGTANISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHT 294
           TSLGTA+IS+Q F+YAKKY+              CLK+T D NMV EPACGA++HL Y+T
Sbjct: 241 TSLGTASISSQTFEYAKKYHTRSVVVEDTDVIETCLKYTQDFNMVAEPACGASLHLAYNT 300

Query: 295 DLLETALGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQKASPTIPSFID 349
           ++LE ALG KL+ DD +L++ACGGSSNTV++LE  L+ L  K++    T P+FI+
Sbjct: 301 NILENALGHKLSSDDIILVIACGGSSNTVQDLEETLVRLREKAKHERITPPTFIN 355

>Skud_3.1 Chr3 complement(3828..4910) [1083 bp, 360 aa] {ON} YCL064C
           (REAL)
          Length = 360

 Score =  439 bits (1129), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 211/348 (60%), Positives = 253/348 (72%)

Query: 1   MSLVYNKTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKP 60
           MS+VYNKTPLL+ FFP K+  QF+LKYE LQPSGSFKSRGIGNLILKNAIRI+K   + P
Sbjct: 1   MSIVYNKTPLLRQFFPSKSPAQFFLKYECLQPSGSFKSRGIGNLILKNAIRIQKDGRRSP 60

Query: 61  YVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADN 120
            VF               QRLSLPCTVVVPTATK+RMV+KIR TGA VI+ G +WKEAD 
Sbjct: 61  QVFASSGGNAGLAAATTCQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVNGAYWKEADT 120

Query: 121 FLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSV 180
           FLK NIMN+I+   +EPIYVHPFDNP IWEGHS+MVDEI++    Q+ ++  +K IVCSV
Sbjct: 121 FLKANIMNQIDSQVVEPIYVHPFDNPDIWEGHSSMVDEIVQDLKSQRISMNKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTA 240
                        E+Y+LADKIP+VGVET GCHVFNTSL++ +PV+F KI++IATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERYHLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 NISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTDLLETA 300
            ISNQ F+YA KYN              CLK+TH  NMV EPACGAA+HLGYHT++LE A
Sbjct: 241 VISNQTFEYAHKYNTKSVVIEDKDVIETCLKYTHQCNMVAEPACGAALHLGYHTEILEKA 300

Query: 301 LGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQKASPTIPSFI 348
           LG+KL  DD V+I+ACGGSSNTV++LE  L +L  +   A  T  +FI
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTVQDLEETLEDLKKQGLPAIETADNFI 348

>TPHA0E04040 Chr5 (846219..847292) [1074 bp, 357 aa] {ON} Anc_1.3
           YCL064C
          Length = 357

 Score =  438 bits (1126), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 214/339 (63%), Positives = 250/339 (73%)

Query: 1   MSLVYNKTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKP 60
           MS VYNKTPLL+H FPGKNLPQ +LKYE  QPSGSFKSRGIGNLI   ++ I+K + K P
Sbjct: 1   MSQVYNKTPLLRHLFPGKNLPQVFLKYECFQPSGSFKSRGIGNLIQSTSLEIQKNSKKSP 60

Query: 61  YVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADN 120
            VF               + LSLPCTVVVPTATK RMV+KI+ATGANVI+KGNHWKEAD 
Sbjct: 61  EVFSSSGGNAGLAAATASKMLSLPCTVVVPTATKLRMVEKIKATGANVIVKGNHWKEADT 120

Query: 121 FLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSV 180
           +LK N+++ I+K  IEPIYVHPFDN  IWEGH+TM+DEI+ETF QQ   I+ +KAIVCSV
Sbjct: 121 YLKTNVLSNIDKKLIEPIYVHPFDNKKIWEGHATMIDEIVETFGQQHIPIEKVKAIVCSV 180

Query: 181 XXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTA 240
                        EK++LA KIPVVGVET GCHVFNTSLK+ K ++F KI+TIATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKHDLATKIPVVGVETLGCHVFNTSLKMGKVIQFEKINTIATSLGTA 240

Query: 241 NISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTDLLETA 300
           NISNQ F+YAKKYN              CLKFT D NMV EPACGAA+H+GY+ D+LE +
Sbjct: 241 NISNQTFEYAKKYNTKSIVVDDLKVVETCLKFTRDSNMVAEPACGAALHMGYNMDILEKS 300

Query: 301 LGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQK 339
           LG KL  DD VLI+ACGGSSNTV+ELE +L EL  KS +
Sbjct: 301 LGKKLATDDIVLIIACGGSSNTVQELEASLTELKNKSNE 339

>NDAI0A00120 Chr1 complement(4652..5785) [1134 bp, 377 aa] {ON}
           Anc_1.3
          Length = 377

 Score =  438 bits (1127), Expect = e-154,   Method: Compositional matrix adjust.
 Identities = 215/364 (59%), Positives = 260/364 (71%), Gaps = 15/364 (4%)

Query: 1   MSLVYNKTPLLKHFFPGK-----------NLPQFYLKYESLQPSGSFKSRGIGNLILKNA 49
           MS+VYNKTPLL+ FF                PQF++KYE LQPSGSFKSRGIGNLILK+A
Sbjct: 1   MSVVYNKTPLLRQFFQNSVAKSSATASVTATPQFFVKYECLQPSGSFKSRGIGNLILKSA 60

Query: 50  IRIKKINVKKPYVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVI 109
           + I KI  K P VF               QRLSLPCTVVVPTATK+RMV+KI++TGANVI
Sbjct: 61  MNINKIGQKTPQVFASSGGNAGFAAATACQRLSLPCTVVVPTATKQRMVEKIKSTGANVI 120

Query: 110 IKGNHWKEADNFLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFN 169
           I G HWKEAD FLK +IMN+I+ + IEPIYVHPFDNPLIWEGH+TMVDEIM++ + Q   
Sbjct: 121 INGAHWKEADMFLKNSIMNKIDTNHIEPIYVHPFDNPLIWEGHATMVDEIMDSLNDQNIP 180

Query: 170 IKNLKAIVCSVXXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTK 229
           I  +K IVCSV             +KYNLADKIP+VGVET+GCHVFNTSLKLNK +EF+K
Sbjct: 181 INKVKGIVCSVGGGGLYNGIIQGLQKYNLADKIPIVGVETKGCHVFNTSLKLNKQIEFSK 240

Query: 230 ISTIATSLGTANISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIH 289
           I++IATSLGTANIS + F+YA+KY               CLK+T D+NMV+EPACGA+IH
Sbjct: 241 ITSIATSLGTANISKKTFEYAQKYKTRSVVIEDKNVIETCLKYTQDYNMVVEPACGASIH 300

Query: 290 LGYHTDLLETALGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQK----ASPTIP 345
           L YHTD+LE +LG KL  DD +L++ACGGSSNT  +LE+ LL +    ++    +S TIP
Sbjct: 301 LAYHTDILEKSLGHKLNSDDIILVIACGGSSNTTHDLESLLLNMKADEKQNLDSSSSTIP 360

Query: 346 SFID 349
           +FID
Sbjct: 361 NFID 364

>Smik_3.12 Chr3 complement(17223..18305) [1083 bp, 360 aa] {ON}
           YCL064C (REAL)
          Length = 360

 Score =  437 bits (1123), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 206/348 (59%), Positives = 254/348 (72%)

Query: 1   MSLVYNKTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKP 60
           MS+VYNKTPLL+ FFPGK+  QF+LKYE LQPSGSFKSRGIGNLI+K+AIRI+K   K P
Sbjct: 1   MSIVYNKTPLLRQFFPGKSPAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKKSP 60

Query: 61  YVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADN 120
            +F               QRLSLPCTVVVPTATK+RMV+KIR TGA VI+ G +WKEAD 
Sbjct: 61  QIFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVEKIRNTGAQVIVSGAYWKEADT 120

Query: 121 FLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSV 180
           FLK ++M +I+   +EPIYVHPFDNP IWEGHS+MVDE+++    Q+ ++  +K IVCSV
Sbjct: 121 FLKADVMQKIDTQVVEPIYVHPFDNPDIWEGHSSMVDEMVQDLEFQRISMNKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTA 240
                        E+Y LADKIP+VGVET GCHVFNTSL++ +PV+F KI++IATSLGTA
Sbjct: 181 GGGGLYNGIVQGLERYGLADKIPIVGVETNGCHVFNTSLRIGQPVQFKKITSIATSLGTA 240

Query: 241 NISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTDLLETA 300
            ISNQ FDYA+KYN              CLK+TH  NMV+EPACGAA+HLGY+T++LE A
Sbjct: 241 VISNQTFDYARKYNTRSVVIEDKDVIDTCLKYTHQFNMVVEPACGAALHLGYNTEILERA 300

Query: 301 LGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQKASPTIPSFI 348
           LG+KL  DD V+I+ACGGSSNT+++LE AL   N +S  A     +FI
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTIQDLEEALDHFNKRSAPAIEVTDNFI 348

>KNAG0C00180 Chr3 complement(27151..28230) [1080 bp, 359 aa] {ON}
           Anc_1.3 YCL064C
          Length = 359

 Score =  436 bits (1120), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 213/348 (61%), Positives = 253/348 (72%), Gaps = 2/348 (0%)

Query: 1   MSLVYNKTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKP 60
           MSLVYNKTPLL+ FFPGKNLPQ +LKYE LQPSGSFKSRGIGNLILKNA+RI+KI  ++ 
Sbjct: 1   MSLVYNKTPLLRQFFPGKNLPQLFLKYECLQPSGSFKSRGIGNLILKNAMRIQKIGERRA 60

Query: 61  YVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADN 120
           +VF               QRLSLPCTVVVPTATK RMV+KIR TGA VI+ G HWKEAD 
Sbjct: 61  HVFASSGGNAGFAAATACQRLSLPCTVVVPTATKTRMVEKIRNTGAKVIVNGAHWKEADQ 120

Query: 121 FLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSV 180
            LK+ +M++I+    EPIYVHPFDNP IWEGH+T+VDEIMET + QK   +N+K IVCSV
Sbjct: 121 HLKKTVMSQIDLKTTEPIYVHPFDNPDIWEGHATLVDEIMETLNSQKIQTENVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTA 240
                        EK+ LA+KIP+VGVET+GCHV NTSL LNK +EF KI++IATSLGTA
Sbjct: 181 GGGGLYNGIMQGLEKHGLAEKIPIVGVETRGCHVLNTSLNLNKQIEFEKITSIATSLGTA 240

Query: 241 NISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTDLLETA 300
           +IS Q F+ AKKYN              CLK+T D NMV EPACGAA+HL Y+ D+LE A
Sbjct: 241 SISKQTFELAKKYNTRSVVVDDSKVIETCLKYTRDFNMVAEPACGAALHLAYNVDILEKA 300

Query: 301 LGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQKASPT--IPS 346
           LG  LT +D +L++ACGGSSNT+K+LE  L+ LN KS  + P   IPS
Sbjct: 301 LGHSLTPNDVILVIACGGSSNTLKDLEDTLVTLNSKSIPSPPEYWIPS 348

>YCL064C Chr3 complement(15798..16880) [1083 bp, 360 aa] {ON}
           CHA1Catabolic L-serine (L-threonine) deaminase,
           catalyzes the degradation of both L-serine and
           L-threonine; required to use serine or threonine as the
           sole nitrogen source, transcriptionally induced by
           serine and threonine
          Length = 360

 Score =  435 bits (1119), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 208/348 (59%), Positives = 249/348 (71%)

Query: 1   MSLVYNKTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKP 60
           MS+VYNKTPLL+ FFPGK   QF+LKYE LQPSGSFKSRGIGNLI+K+AIRI+K   + P
Sbjct: 1   MSIVYNKTPLLRQFFPGKASAQFFLKYECLQPSGSFKSRGIGNLIMKSAIRIQKDGKRSP 60

Query: 61  YVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADN 120
            VF               QRLSLPCTVVVPTATK+RMV KIR TGA VI+ G +WKEAD 
Sbjct: 61  QVFASSGGNAGFAAATACQRLSLPCTVVVPTATKKRMVDKIRNTGAQVIVSGAYWKEADT 120

Query: 121 FLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSV 180
           FLK N+MN+I+   IEPIYVHPFDNP IWEGHS+M+DEI++    Q  ++  +K IVCSV
Sbjct: 121 FLKTNVMNKIDSQVIEPIYVHPFDNPDIWEGHSSMIDEIVQDLKSQHISVNKVKGIVCSV 180

Query: 181 XXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTA 240
                        E+Y LAD+IP+VGVET GCHVFNTSLK+ +PV+F KI++IATSLGTA
Sbjct: 181 GGGGLYNGIIQGLERYGLADRIPIVGVETNGCHVFNTSLKIGQPVQFKKITSIATSLGTA 240

Query: 241 NISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTDLLETA 300
            ISNQ F+YA+KYN              CLK+TH  NMVIEPACGAA+HLGY+T +LE A
Sbjct: 241 VISNQTFEYARKYNTRSVVIEDKDVIETCLKYTHQFNMVIEPACGAALHLGYNTKILENA 300

Query: 301 LGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQKASPTIPSFI 348
           LG+KL  DD V+I+ACGGSSNT+K+LE AL  +  K         +FI
Sbjct: 301 LGSKLAADDIVIIIACGGSSNTIKDLEEALDSMRKKDTPVIEVADNFI 348

>KAFR0D00110 Chr4 complement(7211..8308) [1098 bp, 365 aa] {ON}
           Anc_1.3 YCL064C
          Length = 365

 Score =  425 bits (1093), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 208/352 (59%), Positives = 256/352 (72%), Gaps = 7/352 (1%)

Query: 1   MSLVYNKTPLLKHFFPG------KNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKK 54
           MS+VYNKTPLL+ FFPG       +LPQF+LKYE LQPSGSFKSRGIGNLILK A++I K
Sbjct: 1   MSVVYNKTPLLRQFFPGTKSRKSNSLPQFFLKYECLQPSGSFKSRGIGNLILKQAMQIHK 60

Query: 55  INVKKPYVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNH 114
              K+P VF               QRLSLPCTVVVPTATK+RM++KI+ TGANVII G  
Sbjct: 61  KGTKRPEVFASSGGNAGYAAAVACQRLSLPCTVVVPTATKQRMIEKIKDTGANVIIDGAF 120

Query: 115 WKEADNFLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLK 174
           WKEAD +LK+++MN+INK++I+PIYVHPFDNPLIWEGHS++VDEIM+T  +QK    N+K
Sbjct: 121 WKEADQYLKKSVMNKINKNEIDPIYVHPFDNPLIWEGHSSIVDEIMDTLREQKVQPSNIK 180

Query: 175 AIVCSVXXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIA 234
            IVCSV             E++ L DKIPVVGVET+GCHVFNTSLKL K VEF KI++IA
Sbjct: 181 GIVCSVGGGGLYNGIIQGLERHKLVDKIPVVGVETEGCHVFNTSLKLGKQVEFEKITSIA 240

Query: 235 TSLGTANISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHT 294
           TSL TA+IS + F+ A KY               CLK+T D+NMV EPACGA+IHL Y+ 
Sbjct: 241 TSLATASISAKTFENALKYGTRSVIVKDADVIETCLKYTKDYNMVTEPACGASIHLAYNI 300

Query: 295 DLLETALGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQKASPTIPS 346
           D+LE ALGTKLT DD V+++ACGGSSNT++++E  LL L    + A+ T+P+
Sbjct: 301 DILENALGTKLTKDDTVVVIACGGSSNTLQDMEETLLRLR-SEENAAMTLPN 351

>TBLA0A04920 Chr1 complement(1214344..1215426) [1083 bp, 360 aa]
           {ON} Anc_1.3 YCL064C
          Length = 360

 Score =  407 bits (1047), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 198/349 (56%), Positives = 251/349 (71%), Gaps = 3/349 (0%)

Query: 1   MSLVYNKTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINV-KK 59
           MS+VYNKTPLL+ FF G  +PQF+LKYE +QPSGSFKSRGIGNLILK+  +I   N+ K+
Sbjct: 1   MSIVYNKTPLLRQFFRGSPIPQFFLKYECMQPSGSFKSRGIGNLILKSIDKINSSNLNKR 60

Query: 60  PYVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEAD 119
           P VF               +RLS+PCTVVVPTATKERMV KI+ TGA VI+ G HW EAD
Sbjct: 61  PQVFSSSGGNAGLAAATASRRLSIPCTVVVPTATKERMVNKIKDTGAKVIVNGGHWSEAD 120

Query: 120 NFLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCS 179
           ++L+ +++N+I+ ++IEPIYVHPFDNPLIWEGHSTM+DEI+E+ ++Q  +I+N+KAI CS
Sbjct: 121 DYLQNHVINKIDLNEIEPIYVHPFDNPLIWEGHSTMIDEIIESLNEQNIDIRNVKAITCS 180

Query: 180 VXXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGT 239
           +             EKYNLA KIP++GVET GC VFNTSLKL K V+F KI+TIATSLGT
Sbjct: 181 IGGGGLYNGLIRGLEKYNLASKIPIIGVETNGCQVFNTSLKLKKLVKFPKINTIATSLGT 240

Query: 240 ANISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTDLLET 299
           + IS + F+ A KYN              CL++T+D N V EPACGAA+HL Y+T L+E 
Sbjct: 241 STISAKTFENALKYNTKSVVVDNIDVIKTCLRYTYDFNQVAEPACGAALHLAYNTGLIEN 300

Query: 300 ALGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQKASPTIPSFI 348
           AL T LT DD ++++ACGGSSNTV+ELE ALL+  L    + P  P +I
Sbjct: 301 ALDTTLTKDDIIIVIACGGSSNTVQELEEALLKYKL--DYSLPQTPEYI 347

>CAGL0B00286g Chr2 complement(12803..13885) [1083 bp, 360 aa] {ON}
           highly similar to uniprot|P25379 Saccharomyces
           cerevisiae YCL064c CHA1 L-serine/L-threonine deaminase
          Length = 360

 Score =  393 bits (1010), Expect = e-136,   Method: Compositional matrix adjust.
 Identities = 193/334 (57%), Positives = 239/334 (71%), Gaps = 5/334 (1%)

Query: 4   VYNKTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINV-KKPYV 62
           VYNKTPL++  FP  ++PQ YLK+E  QPSGSFKSRGIG+LI K + RI    + KKP V
Sbjct: 3   VYNKTPLIRQIFP--SIPQMYLKHECFQPSGSFKSRGIGHLISKQSQRILGNGLGKKPMV 60

Query: 63  FXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFL 122
           F               + L+LPCTVV+PTATK+RM  KIRATGANVI+ GN WKEADN+L
Sbjct: 61  FASSGGNAGLAAATAAKFLNLPCTVVIPTATKQRMADKIRATGANVIVSGNFWKEADNYL 120

Query: 123 KQNIMNEINK--DKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSV 180
           K NI++++ +    +EPIYVHPFDNP IWEGH++MVDEI+E F  +   +  +KAIVCSV
Sbjct: 121 KDNILSKLEELHKNVEPIYVHPFDNPDIWEGHASMVDEIVEDFKNKMIPLNKIKAIVCSV 180

Query: 181 XXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTA 240
                        EKYNLADKIP+VGVET+GCHVFNTSL++NK V F KI++IATSLGTA
Sbjct: 181 GGGGLYNGIIQGLEKYNLADKIPIVGVETKGCHVFNTSLRMNKVVSFKKITSIATSLGTA 240

Query: 241 NISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTDLLETA 300
           +IS + F YAK+Y               CL++THD NMVIEPACGAA+HL YHT++LE  
Sbjct: 241 DISTEAFKYAKRYGTKSVVLSDQDVVKTCLRYTHDFNMVIEPACGAAVHLAYHTEILEKE 300

Query: 301 LGTKLTCDDAVLIVACGGSSNTVKELETALLELN 334
           LGTKL  DD VL+VACGGSSNTV+++E+ L  L+
Sbjct: 301 LGTKLNADDIVLVVACGGSSNTVEDMESILQRLS 334

>KAFR0I00130 Chr9 complement(26703..27737) [1035 bp, 344 aa] {ON}
           Anc_1.3 YCL064C
          Length = 344

 Score =  385 bits (988), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 183/344 (53%), Positives = 237/344 (68%), Gaps = 6/344 (1%)

Query: 1   MSLVYNKTPLLKHFFPG------KNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKK 54
           M +VYNKTPL+   FPG       +LPQ  +KYE LQPSGSFKSRGIGNL+ + A++I+K
Sbjct: 1   MPIVYNKTPLVPQSFPGTEIRSSDSLPQVLIKYEYLQPSGSFKSRGIGNLVYQKALQIQK 60

Query: 55  INVKKPYVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNH 114
            + K P VF               Q+LSLPCTVVVP ATK+RM++KIR+TGA V I G  
Sbjct: 61  NSTKNPEVFSSSGGNAGYAAAVVAQKLSLPCTVVVPAATKQRMIEKIRSTGAKVTIHGTF 120

Query: 115 WKEADNFLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLK 174
           WK AD ++K +++NEIN +K+EPIYVHP D+PLIWEG+S +VDE+ME+  +QK +   +K
Sbjct: 121 WKGADKYMKNSVLNEINTEKVEPIYVHPSDDPLIWEGNSMIVDELMESLQEQKIDPSKVK 180

Query: 175 AIVCSVXXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIA 234
           AIVCSV             E+Y LADKIP+VGVET G HVFNT LK  K +EF KIST+A
Sbjct: 181 AIVCSVGGGGLYNGLMQGLERYKLADKIPIVGVETDGSHVFNTCLKSGKHIEFEKISTVA 240

Query: 235 TSLGTANISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHT 294
           TSLG+A+I+ + F+YA KY               CL++T D+NM+ EPACGAAIHL YH 
Sbjct: 241 TSLGSASITKKTFEYAMKYRPRGVIVKDIEVLETCLRYTQDYNMITEPACGAAIHLAYHV 300

Query: 295 DLLETALGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQ 338
           D+LE AL T+L  DD V+I+ACGGSSN++ ++E  L ++  +SQ
Sbjct: 301 DILEKALDTRLDGDDVVIIIACGGSSNSLHDMEETLKKMKSESQ 344

>KAFR0F04430 Chr6 (868691..869722) [1032 bp, 343 aa] {ON} 
          Length = 343

 Score =  360 bits (925), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 167/342 (48%), Positives = 236/342 (69%), Gaps = 6/342 (1%)

Query: 1   MSLVYNKTPLLKHFFPGKNL------PQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKK 54
           M  VYNKTPLL+ +F   N       PQ + KYES QP  SFKSRGIGNLILKNA ++++
Sbjct: 1   MPTVYNKTPLLRPYFLEANRGTSDSSPQVFFKYESFQPGCSFKSRGIGNLILKNAKKVEE 60

Query: 55  INVKKPYVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNH 114
             +K   VF               + LS+PCTVVVP++TK RMV+KIR+TGA VI+ GN 
Sbjct: 61  EGIKTLEVFSSSGGNAGYAAAVACRELSIPCTVVVPSSTKVRMVEKIRSTGAQVIVSGNF 120

Query: 115 WKEADNFLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLK 174
           WKEAD +L+ +++N+++  K+EP+YVHPFD+PLIWEGHST++DEI+E+ + +  +   +K
Sbjct: 121 WKEADEYLRNSVINKVDSSKVEPLYVHPFDDPLIWEGHSTIIDEIVESLNDENVHTSKVK 180

Query: 175 AIVCSVXXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIA 234
            +VCS+             E++ LADKIPV+ VET+GCHVFNT L+L K VEF KIS+IA
Sbjct: 181 GVVCSIGGGGLYNGIIEGLERHALADKIPVIAVETEGCHVFNTCLELGKHVEFEKISSIA 240

Query: 235 TSLGTANISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHT 294
           TSLG+ +IS + F+YA+KY+              CL+++ D NM+IEPAC A++HL Y+ 
Sbjct: 241 TSLGSPSISTKTFEYAQKYHSKGVVLQDIDVLETCLRYSEDSNMIIEPACAASVHLAYNV 300

Query: 295 DLLETALGTKLTCDDAVLIVACGGSSNTVKELETALLELNLK 336
           D+LE AL  KL+ DD ++I+ACGGS+ T+++++ +L +L +K
Sbjct: 301 DILEEALNKKLSKDDVIIIIACGGSATTLQDIKDSLAKLKIK 342

>NCAS0A15330 Chr1 (3015596..3016639) [1044 bp, 347 aa] {ON} 
          Length = 347

 Score =  359 bits (922), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 169/341 (49%), Positives = 234/341 (68%), Gaps = 5/341 (1%)

Query: 1   MSLVYNKTPLLKHFFPGK----NLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKIN 56
           MSLVYNKTPLL+  FP      + PQ Y+KYESLQPSGSFKSRGIG+LI+KNA+R++++ 
Sbjct: 1   MSLVYNKTPLLRRVFPTGLKVPSAPQLYVKYESLQPSGSFKSRGIGHLIMKNALRVQQLG 60

Query: 57  VKKPYVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWK 116
            K  +VF               Q L LPCTVVVPT+TK RMV+KIR  G  VI+KG+HWK
Sbjct: 61  GKSLHVFSSSGGNAGLAAATASQSLKLPCTVVVPTSTKSRMVEKIRNVGTEVIVKGSHWK 120

Query: 117 EADNFLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAI 176
           EAD+FLK +++  +++ + EPIYVHPFD+P +WEGHSTMVDEI++TF  Q  ++  +KAI
Sbjct: 121 EADSFLKNSVIPSVDRIE-EPIYVHPFDHPDVWEGHSTMVDEIVDTFRSQNVSLNKVKAI 179

Query: 177 VCSVXXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATS 236
           VCSV             EKY+LADKIPV+ +ET GC+ FN  LK  K VE  KI+++ATS
Sbjct: 180 VCSVGGGGLYNGIIHGLEKYHLADKIPVIAMETDGCNSFNACLKAKKQVELPKITSVATS 239

Query: 237 LGTANISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTDL 296
           LG   ++ + F+  ++Y               CLK+ +D N++ EPACGA++H+ Y+T L
Sbjct: 240 LGATGVATKAFENGQRYQSPSVVLQDIDVVNTCLKYANDFNIITEPACGASLHMAYNTKL 299

Query: 297 LETALGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKS 337
           +E ALG KL  DD ++I+ACGGS+NT+++L+ +  +L+ ++
Sbjct: 300 IEKALGKKLDSDDIIVIIACGGSANTMEDLQNSYKQLSAEA 340

>ZYRO0F15774g Chr6 (1300486..1301718) [1233 bp, 410 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 410

 Score =  349 bits (895), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 165/333 (49%), Positives = 221/333 (66%)

Query: 1   MSLVYNKTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKP 60
           M  +YNKTPLLK  F      Q ++KYE LQPSGSFKSRGIG+LI K A  I+    K P
Sbjct: 47  MPSIYNKTPLLKQIFNHATSAQVFVKYECLQPSGSFKSRGIGHLISKRAKDIQGDGRKSP 106

Query: 61  YVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADN 120
           +VF               Q+L+LPCTVV+PT TK+RM  KIR  GANV+++G+HWKEAD+
Sbjct: 107 HVFSSSGGNAGYAAAVAAQKLNLPCTVVIPTTTKQRMADKIRGCGANVVVQGSHWKEADS 166

Query: 121 FLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSV 180
            LK  + N++N   +EPIYVHPFDNP IWEGH+++VDEI+ +   +   +  +K IVCSV
Sbjct: 167 HLKNILQNQVNMAILEPIYVHPFDNPTIWEGHASIVDEIISSLKNENTALNRVKGIVCSV 226

Query: 181 XXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTA 240
                        EKYNLA+KIP++ VET+GCHV NTSL++ + VEF K++++ATSL T+
Sbjct: 227 GGGGLYNGIIQGLEKYNLANKIPLLAVETKGCHVLNTSLQVGQCVEFNKMNSVATSLCTS 286

Query: 241 NISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTDLLETA 300
            IS++  DY +KY               CLK+  + NM+ EPACGA++HLGYH  L+E A
Sbjct: 287 QISSRTLDYVQKYGSKSIVLEDKEVLQTCLKYAENFNMITEPACGASLHLGYHPQLIERA 346

Query: 301 LGTKLTCDDAVLIVACGGSSNTVKELETALLEL 333
           LG  L  DD ++++ACGGSSNT+ +LE +L +L
Sbjct: 347 LGKNLDKDDVIIVIACGGSSNTILDLEESLAKL 379

>SAKL0C00418g Chr3 complement(37529..38623) [1095 bp, 364 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 364

 Score =  335 bits (860), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 165/350 (47%), Positives = 217/350 (62%), Gaps = 9/350 (2%)

Query: 1   MSLVYNKTPLLKHFFPGKNL---PQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINV 57
           M+  Y+KTPLL+  FP   L   PQF +KYE  QPSGSFKSRGIG+LI ++A RI+    
Sbjct: 1   MTSFYSKTPLLRRIFPSSVLSATPQFLVKYEVFQPSGSFKSRGIGHLITQSAARIESEGN 60

Query: 58  KKPYVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKE 117
           K  +VF               +  SLPCTVVVPT T  RMV KIR TGA+VI+ GNHW +
Sbjct: 61  KTAHVFASSGGNAGLAAATACRAFSLPCTVVVPTTTNLRMVAKIRQTGADVIVHGNHWGD 120

Query: 118 ADNFLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIV 177
           AD +L +++M  I+  K EP+Y HPFDNP+IWEGHST+VDEI+E+  +Q+     +K IV
Sbjct: 121 ADQYLHRSVMPCIDTTKFEPVYAHPFDNPVIWEGHSTIVDEIVESLERQRIPASQVKGIV 180

Query: 178 CSVXXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSL 237
           CS+             EK++LA  IP++GVET+GC VF+ SLK  KP+ F KI+++ATSL
Sbjct: 181 CSIGGGGLYNGIIEGLEKHDLATTIPIIGVETKGCEVFHQSLKAGKPLVFDKITSVATSL 240

Query: 238 GTANISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTDLL 297
           GTA I  +  + A KYN              CL F  D N+V EPACGA++H GY+  LL
Sbjct: 241 GTATICKKTLENALKYNTKSVVLSDADVVRTCLDFADDTNIVPEPACGASLHFGYNPHLL 300

Query: 298 ETALGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQKASPTIPSF 347
           E  LG  L  +D ++++ACGGSS TV++L+   + L        P  PSF
Sbjct: 301 EDTLGGSLGPEDIIIVIACGGSSTTVQDLQQMQVRL------GRPLTPSF 344

>NDAI0K02950 Chr11 (671102..672106) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  332 bits (851), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 160/329 (48%), Positives = 223/329 (67%), Gaps = 2/329 (0%)

Query: 1   MSLVYNKTPLLKHFFPGKNL-PQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKK 59
           MS +YNKTPLL+  F    + P+ +LKYE+LQPSGSFKSRGIG LIL++  ++K+   K 
Sbjct: 1   MSFIYNKTPLLRQTFDSAKIGPRIFLKYENLQPSGSFKSRGIGCLILQHINKLKQDGNKT 60

Query: 60  PYVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEAD 119
            +VF               + L +PCTVVVP +TKERMV KIR TGA+V+IKG+HWKEAD
Sbjct: 61  AHVFSSSGGNAGLAAATASRSLQVPCTVVVPKSTKERMVNKIRKTGASVLIKGDHWKEAD 120

Query: 120 NFLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCS 179
           +FL+++ M E++  + +PIYVHPFD+P+IWEGHST++DEI++T   +K +I+ +K I+CS
Sbjct: 121 DFLRKS-MKEMDNTQEQPIYVHPFDDPVIWEGHSTIIDEIVQTLQTEKISIEKVKGIICS 179

Query: 180 VXXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGT 239
           V             E++NLA  IPV+ VET+GC V N SLK   PV+  KI+++ATSLG+
Sbjct: 180 VGGGGLFNGIIKGLERHNLAQSIPVIAVETKGCDVLNKSLKNGTPVQLPKITSVATSLGS 239

Query: 240 ANISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTDLLET 299
             IS+  F+ A KYN              CLK+  D +M +EPACGA++HL Y+  ++E+
Sbjct: 240 TYISSTAFENAMKYNSRSITLNDKDVLETCLKYNDDFSMTLEPACGASVHLAYNPGIVES 299

Query: 300 ALGTKLTCDDAVLIVACGGSSNTVKELET 328
           ALGT L+  D V++V CGGSS T+ +LE+
Sbjct: 300 ALGTALSNHDIVIVVLCGGSSCTLHDLES 328

>KLLA0C00440g Chr3 complement(32008..33141) [1134 bp, 377 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 377

 Score =  312 bits (800), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 152/325 (46%), Positives = 209/325 (64%), Gaps = 1/325 (0%)

Query: 4   VYNKTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKK-PYV 62
           +++KTPLLKH F     PQ  LKYE LQPSGSFKSRGIG+LI      IKK + +K  +V
Sbjct: 24  LFSKTPLLKHQFKRSKGPQVLLKYEFLQPSGSFKSRGIGHLISTKVEEIKKSSPEKIGHV 83

Query: 63  FXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFL 122
           F                 L++PCTVVV  AT+ R+++KIR+ GA+V++ GNHWKEAD+F+
Sbjct: 84  FASSGGNAGLAAAVASLELNVPCTVVVSNATRPRIIEKIRSYGADVVVHGNHWKEADSFM 143

Query: 123 KQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXX 182
           K+++M +++  K EPIY HPFDNPLIWEGHS MVDEIM+  +  K  I  +K IVCS   
Sbjct: 144 KEHLMKKLDSFKYEPIYSHPFDNPLIWEGHSFMVDEIMDVLASSKIPITKIKGIVCSFGG 203

Query: 183 XXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANI 242
                      ++YNLADKIP+V VET+G  V + SL++  PVEF KIS+ ATSLGTA I
Sbjct: 204 GGLYNGLILGLQRYNLADKIPIVCVETKGTDVLSASLRVGAPVEFEKISSCATSLGTATI 263

Query: 243 SNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTDLLETALG 302
           S   +   K++               CL+F++D N+V EP CGA ++ GY+ D L+  LG
Sbjct: 264 STTAYQNVKRHGSKSAVISDTEVISTCLQFSNDTNIVAEPGCGATLYFGYNIDKLQNILG 323

Query: 303 TKLTCDDAVLIVACGGSSNTVKELE 327
           + +  DD V+++ CGGSS ++++L+
Sbjct: 324 SDIKDDDYVILIGCGGSSTSLEDLK 348

>KLTH0F00440g Chr6 complement(34215..35240) [1026 bp, 341 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 341

 Score =  310 bits (795), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 151/333 (45%), Positives = 211/333 (63%), Gaps = 5/333 (1%)

Query: 1   MSLVYNKTPLLKHFFPGK-----NLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKI 55
           M   + KTPLL H+F        N PQF LK E LQPSGSFKSRGIG +I K AI+I+  
Sbjct: 1   MKSAFVKTPLLAHYFAASSNRLPNQPQFMLKCEFLQPSGSFKSRGIGYMITKQAIKIRSE 60

Query: 56  NVKKPYVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHW 115
             K P+VF               + LS+PC+VVVP +T  RMVQKI   GA V + G +W
Sbjct: 61  GNKLPHVFASSGGNAGLAAATTSRALSIPCSVVVPESTSNRMVQKIWNLGAEVHVYGRNW 120

Query: 116 KEADNFLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKA 175
           KEAD FLK++I++  N  + + IY HPFD+PLIWEGHS++VDEI+++  +QK ++KN+KA
Sbjct: 121 KEADKFLKESIISGHNPSRTQVIYAHPFDHPLIWEGHSSIVDEIIDSLKEQKIDLKNIKA 180

Query: 176 IVCSVXXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIAT 235
           IVCSV              ++ L  KIP++GVE++GC VFN+SLKL K  EF  I++IAT
Sbjct: 181 IVCSVGGGGLYNGIIEGLSRHKLVHKIPIIGVESKGCEVFNSSLKLGKLTEFEDITSIAT 240

Query: 236 SLGTANISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTD 295
           S+GT +IS +  + A +Y+              CL+F  + N++ EPACGAA+HLGY+ D
Sbjct: 241 SIGTNSISKKTLENALRYHTKSVVLTDQEIISTCLRFADETNIIPEPACGAALHLGYYPD 300

Query: 296 LLETALGTKLTCDDAVLIVACGGSSNTVKELET 328
           +L  AL +  T +D ++++ CGGS+ +  +L +
Sbjct: 301 ILYQALNSDFTPEDVIIMIGCGGSATSYNDLAS 333

>ZYRO0F18524g Chr6 (1528741..1529748) [1008 bp, 335 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 335

 Score =  303 bits (777), Expect = e-101,   Method: Compositional matrix adjust.
 Identities = 152/334 (45%), Positives = 209/334 (62%), Gaps = 11/334 (3%)

Query: 1   MSLVYNKTPLLKHFFPGKN---LPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKIN- 56
           M+  Y KTPLL+     K    LPQ ++KYE+LQP GSFKSRGIGNLI      +K  N 
Sbjct: 1   MNNWYYKTPLLRQILNWKTTTELPQIFIKYENLQPGGSFKSRGIGNLI-----SLKSENG 55

Query: 57  VKKPYVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWK 116
           + K +V                +++ LPCTVVVPT+TK+RMVQKI+ +GA VII+G+HWK
Sbjct: 56  LVKSHVLSSSGGNAGLAAAIASKQMELPCTVVVPTSTKQRMVQKIKNSGAEVIIRGSHWK 115

Query: 117 EADNFLKQNIMNEINKDKI-EPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKA 175
           EADN+L+QN +     D   +P+YVHPFD+P +WEGHSTMV EI++   +Q  +++N++ 
Sbjct: 116 EADNYLQQNYIQSFRNDGTSKPLYVHPFDDPKVWEGHSTMVHEIIDNLREQNISVENVRG 175

Query: 176 IVCSVXXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIAT 235
           IVCSV             E + LADKIPV+ VET GC+V N SL   +PV   KI+++AT
Sbjct: 176 IVCSVGGGGLFNGIIKGLEDHGLADKIPVIAVETYGCNVLNASLNAGRPVMLDKITSLAT 235

Query: 236 SLGTANISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTD 295
           SLG+  I   +F+ A +Y               CL++  D   ++EPACGA++H+GYH +
Sbjct: 236 SLGSTYIPQGVFENAVRYGAKSLVLEDKDVIETCLRYVSDFGQIVEPACGASLHIGYHPE 295

Query: 296 LLETALGTKLTCDDAVLIVACGGSSNTVKELETA 329
           LLE  LG   + DD ++I+ACGGS+ T K+L  A
Sbjct: 296 LLENFLG-GFSKDDIIVIIACGGSTTTFKDLTIA 328

>KNAG0D05380 Chr4 complement(986308..987312) [1005 bp, 334 aa] {ON} 
          Length = 334

 Score =  300 bits (768), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 151/334 (45%), Positives = 200/334 (59%), Gaps = 2/334 (0%)

Query: 1   MSLVYNKTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKP 60
           M  +YNKTPLL     G + P F  KYE++QP GSFK RG+ +LI K   +IK    K P
Sbjct: 1   MPALYNKTPLLPKNLSGGDGPTFLFKYENMQPGGSFKIRGVSHLIEKRVEQIKSEGKKPP 60

Query: 61  YVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADN 120
           +VF                 LS+PCTVVVPT TK RMV+KIR   A VI+KG++WKEAD+
Sbjct: 61  HVFSSSGGNAGLAAATACHILSIPCTVVVPTLTKPRMVEKIRKANAEVIVKGSNWKEADD 120

Query: 121 FLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSV 180
           +L+  ++   N   ++PIYV+PFD+PL+WEGHSTM+DEI+   +Q+   +  +K IVCSV
Sbjct: 121 YLRGTVIASNNA--VQPIYVNPFDDPLLWEGHSTMIDEILNALNQENIKLDAVKGIVCSV 178

Query: 181 XXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTA 240
                        E + LA  IPVV VET+GC V   SL   KPV   KI +IATSLG++
Sbjct: 179 GGGGLFNGIVHGLENHQLACTIPVVAVETKGCDVLGLSLAAEKPVRLNKIDSIATSLGSS 238

Query: 241 NISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTDLLETA 300
            +S Q FD A K+               C ++  D N ++EPACGA IH  YH  +LE A
Sbjct: 239 YVSCQAFDNAVKFKSRSVVLHDSDVLNTCYRYLDDFNAIVEPACGATIHTAYHYKILEKA 298

Query: 301 LGTKLTCDDAVLIVACGGSSNTVKELETALLELN 334
           LG KLT  D ++I+ CGGS  T+++LE A  +L+
Sbjct: 299 LGQKLTPSDIIIIIVCGGSCVTIQDLENAKRKLD 332

>AFR747W Chr6 (1808016..1809296) [1281 bp, 426 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YCL064C (CHA1)
          Length = 426

 Score =  303 bits (777), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 152/341 (44%), Positives = 211/341 (61%), Gaps = 7/341 (2%)

Query: 1   MSLVYNKTPLLKHFFPGKNL-----PQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKI 55
           M+  Y KTPL++H F  +N+     P+  LKYE  QPSGSFKSRGIGNLI K   +I++ 
Sbjct: 69  MASFYCKTPLMRHVFARQNVRYTANPEIMLKYEFFQPSGSFKSRGIGNLIWKEMQKIRQN 128

Query: 56  NVKKPYVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHW 115
           +  +P+VF               ++L LPCTVVVP  T+ RMV++IR+TGA+VI  G+  
Sbjct: 129 SSLQPHVFASSGGNAGLAAATASRQLGLPCTVVVPETTRRRMVERIRSTGADVISMGSVL 188

Query: 116 KEADNFLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKA 175
           KE+D++L+  +M  +N +K+ PIY HPFDNPLIWEGH+TMVDE++E    Q   ++++K 
Sbjct: 189 KESDDYLRSELMGNVNLEKVAPIYAHPFDNPLIWEGHATMVDEVVEALHLQGVQLESVKG 248

Query: 176 IVCSVXXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIAT 235
           IVCSV             EK+ LAD IPVV VET+GC V + SL L + V     S +AT
Sbjct: 249 IVCSVGGGGLYNGIVYGLEKHGLADSIPVVAVETEGCEVLHRSLLLGRNVSMNPKS-VAT 307

Query: 236 SLGTANISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTD 295
           SL T+ +++    YA+KY               CL F  + N+V EPACGAA+HLGYH +
Sbjct: 308 SLCTSFVTDLTLSYAQKYRTKSVVLDQLAVVQTCLNFAEESNIVTEPACGAALHLGYHPE 367

Query: 296 LLETALGTKLTCDDAVLIVACGGSSNTVKELETALLELNLK 336
           +LE  LG  LT  D V+++ACGGS+  + +L+ +  +L  K
Sbjct: 368 ILERELG-PLTPQDVVIVIACGGSTMNLADLKESEDQLQPK 407

>Ecym_1006 Chr1 complement(9635..10729) [1095 bp, 364 aa] {ON}
           similar to Ashbya gossypii AFR747W
          Length = 364

 Score =  293 bits (749), Expect = 9e-97,   Method: Compositional matrix adjust.
 Identities = 152/358 (42%), Positives = 214/358 (59%), Gaps = 11/358 (3%)

Query: 1   MSLVYNKTPLLKHFFPGKNL-----PQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKI 55
           MS +Y KTPLL+  F   N+     PQF +KYE  QPSGSFKSRGIGNLI      I++ 
Sbjct: 1   MSSLYVKTPLLRRAFGKPNIQISKVPQFLVKYEFFQPSGSFKSRGIGNLIYNKVSEIRRD 60

Query: 56  NVKKPYVFXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHW 115
             K+P+VF               QR+ +PCTVVVPT+T++R+++KI ATGA +I +G+++
Sbjct: 61  PAKQPHVFSSSGGNAGLAAATASQRMGIPCTVVVPTSTRQRIIEKIMATGATIICRGDYF 120

Query: 116 KEADNFLK---QNIMNEINKDKIE-PIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIK 171
            EAD++LK   Q   N+  +DK   PIYVHPF++PLIW GHS +V+EI+E+   +     
Sbjct: 121 AEADSYLKDLMQEAANKNTRDKKNVPIYVHPFNHPLIWHGHSYIVEEILESLRNENIPYS 180

Query: 172 NLKAIVCSVXXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKIS 231
            +K IVCSV             E+++LA+ IP++GVET+GC V + SL   K + F K  
Sbjct: 181 RVKGIVCSVGGGGLYNGIIEGLERHSLANTIPIIGVETEGCEVLHKSLIAGKLITFKKAL 240

Query: 232 TIATSLGTANISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLG 291
           ++ATSL    I+ +   YA+KY               CL+FT + N+V EPACGA +HLG
Sbjct: 241 SVATSLSVPTITKETLRYAQKYKTKSLVLGEGEVLDTCLRFTDESNIVTEPACGATLHLG 300

Query: 292 YHTDLLETALGTKLTCDDAVLIVACGGSSNTVKELETALLELNLKSQKASPT-IPSFI 348
           YH  +L   LG  L+ +D V+++ACGGS+ T+ +L    L+ N  +   SP  IP  I
Sbjct: 301 YHPAILHKELG-PLSSEDIVILIACGGSATTLADLRELKLKYNPVTLDDSPVEIPGLI 357

>SAKL0C13904g Chr3 (1223973..1224992) [1020 bp, 339 aa] {ON} similar
           to uniprot|P25379 Saccharomyces cerevisiae YCL064C CHA1
           catabolism of hydroxy amino acids catabolic serine
           (threonine) dehydratase
          Length = 339

 Score =  290 bits (742), Expect = 4e-96,   Method: Compositional matrix adjust.
 Identities = 141/331 (42%), Positives = 199/331 (60%), Gaps = 1/331 (0%)

Query: 5   YNKTPLLKHFFPGKN-LPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVF 63
           YNKTPLL       +  P+F+LKYE LQP GSFKSRGIG L+ K+  + ++   K   VF
Sbjct: 8   YNKTPLLPRVLTTTDGAPRFFLKYEFLQPGGSFKSRGIGYLVKKSYEKARRDGGKSLAVF 67

Query: 64  XXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLK 123
                          Q  S+ CTVVVP  TK RMV+KIR TGA V++ G HW  AD +L+
Sbjct: 68  SSSGGNAGLAAAIAAQTFSINCTVVVPRTTKSRMVEKIRKTGAEVLVYGKHWGMADEYLR 127

Query: 124 QNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXX 183
           + +M E++  K+ P+YVHPFDNP+IW+GHST+VDE++    ++  +I  +KAIVCSV   
Sbjct: 128 EVVMKEVDVSKVVPLYVHPFDNPIIWQGHSTIVDEVVAQLKEENVSIDKVKAIVCSVGGG 187

Query: 184 XXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANIS 243
                     E + LAD+IP++ +ET+GC V N SL    PV    ++++A+SL +  IS
Sbjct: 188 GLYNGIVKGLETHQLADRIPILAIETKGCDVLNKSLNSGNPVVLESLTSVASSLASPYIS 247

Query: 244 NQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTDLLETALGT 303
            + F+ A+KY               CL F  D  +V+EPACGA+++  YH +LL   +G 
Sbjct: 248 EKAFENARKYESKSILLKDSQVIETCLNFADDAGIVVEPACGASLYSCYHPELLPLYIGK 307

Query: 304 KLTCDDAVLIVACGGSSNTVKELETALLELN 334
           +LT DD ++++ACGGS+ T K+LE    EL 
Sbjct: 308 ELTEDDVIVVIACGGSAVTYKDLEYMKKELG 338

>Smik_9.2 Chr9 (6779..7795) [1017 bp, 338 aa] {ON} YCL064C (REAL)
          Length = 338

 Score =  281 bits (720), Expect = 1e-92,   Method: Compositional matrix adjust.
 Identities = 141/326 (43%), Positives = 194/326 (59%), Gaps = 1/326 (0%)

Query: 5   YNKTPLLKHFFP-GKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVF 63
           Y KTPL++  F  GK  P FY+K++ LQP GSFKSRGIG+LI K           K  VF
Sbjct: 6   YEKTPLIRQVFDNGKTNPLFYIKHDMLQPGGSFKSRGIGHLIRKKNKEALAEGSGKLVVF 65

Query: 64  XXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLK 123
                          + ++L CTVVVP  TK RMV+KI++ GA VII G+HW EAD +LK
Sbjct: 66  SSSGGNAGLAAATSCRLMALNCTVVVPKTTKSRMVKKIQSAGAKVIIHGDHWGEADEYLK 125

Query: 124 QNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXX 183
           Q +M +  +   + +YVHPFD+ +IWEGHST+VDEI++   ++  +   +K +VCSV   
Sbjct: 126 QEVMAQEGQHGSKTLYVHPFDDEIIWEGHSTIVDEILQQLQEKDISPLQVKGLVCSVGGG 185

Query: 184 XXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANIS 243
                     E+  LA KIP+V VET GC V N SLK   PV   +++++ATSLG+  I+
Sbjct: 186 GLFSGIIKGLERNRLAGKIPIVAVETAGCDVLNKSLKNGSPVALERLTSVATSLGSPYIA 245

Query: 244 NQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTDLLETALGT 303
              F+    Y               CL++  D+N ++EPACGA++HL YH ++LE ALG 
Sbjct: 246 PFAFESFITYGCKSVVLSDQDVLDTCLRYADDYNFIVEPACGASLHLCYHPEILEKALGQ 305

Query: 304 KLTCDDAVLIVACGGSSNTVKELETA 329
           KL+ DD V+I+ACGGS  T ++L  A
Sbjct: 306 KLSEDDVVIIIACGGSCMTYEDLVKA 331

>Scer_YGOB_SDL1 Chr9 (29032..29411,29415..30048) [1014 bp, 337 aa]
           {ON} ANNOTATED BY YGOB - Skipping over stop codon in
           S288c
          Length = 337

 Score =  272 bits (695), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 141/332 (42%), Positives = 195/332 (58%), Gaps = 2/332 (0%)

Query: 5   YNKTPLLKHFFP-GKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVF 63
           Y KTPL++ F   GK    FY+K+E LQP GSFKSRGIG+LI K+          K  VF
Sbjct: 6   YEKTPLIRQFLNNGKTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGKLAVF 65

Query: 64  XXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLK 123
                          + ++L C+VVVP  TK RMV+KI++ GA VII G+HW EAD +L+
Sbjct: 66  SSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEADEYLR 125

Query: 124 QNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXX 183
             +  E ++   + +YVHPFDN  IWEGHST+VDEI+E   +   ++  +KA+VCSV   
Sbjct: 126 HEMAQE-SQHGSKTLYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGG 184

Query: 184 XXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANIS 243
                     ++  LA+KIPVV VET GC V N SLK   PV   K++++ATSL +  I+
Sbjct: 185 GLFSGIIKGLDRNQLAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIA 244

Query: 244 NQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTDLLETALGT 303
           +  F+   KY               CL++  D+N ++EPACGA++HL YH ++LE  L  
Sbjct: 245 SFAFESFNKYGCKSVVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQ 304

Query: 304 KLTCDDAVLIVACGGSSNTVKELETALLELNL 335
           K+  DD V+I+ACGGS  T ++L  A   LN+
Sbjct: 305 KIYEDDIVIIIACGGSCMTYEDLVKASSTLNV 336

>Skud_9.2 Chr9 (5919..6938) [1020 bp, 339 aa] {ON} YCL064C (REAL)
          Length = 339

 Score =  269 bits (688), Expect = 7e-88,   Method: Compositional matrix adjust.
 Identities = 134/323 (41%), Positives = 191/323 (59%), Gaps = 1/323 (0%)

Query: 5   YNKTPLLKHFFP-GKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVF 63
           Y +TPL+   F  G+  P+ Y+K+E LQP GSFKSRGIG+LI ++          K  VF
Sbjct: 6   YERTPLIHQVFNNGQTGPRLYVKHEMLQPGGSFKSRGIGHLINRSNEEALADGSGKLAVF 65

Query: 64  XXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLK 123
                            ++L CTVVVP  TK RM++KI+  GA VII G+HW EAD +L+
Sbjct: 66  SSSGGNAGLAAATACSSMALDCTVVVPKTTKSRMIKKIQNAGAKVIIHGSHWGEADEYLR 125

Query: 124 QNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXX 183
           Q +M + ++   + +YVHPFD+  IWEGHST+VDE+++   ++  ++  +KA+VCSV   
Sbjct: 126 QELMIQESQLGSKTLYVHPFDDERIWEGHSTIVDEVLQQLQEKNISLARIKAMVCSVGGG 185

Query: 184 XXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANIS 243
                     E+ NLA KI V+ VET GC V N SL    P+   ++S+IATSLG+  I+
Sbjct: 186 GLFSGIIKGLERNNLAGKIRVIAVETIGCDVLNKSLVNGSPITLERLSSIATSLGSPYIA 245

Query: 244 NQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTDLLETALGT 303
              F+    Y               CL++  D+N ++EPACGA++HL YH ++LE AL  
Sbjct: 246 PFAFESFNAYGCKSVVLSDQDVLATCLRYADDYNSIVEPACGASLHLCYHQEILENALEQ 305

Query: 304 KLTCDDAVLIVACGGSSNTVKEL 326
           KL+ DD V+I+ACGGS  T ++L
Sbjct: 306 KLSDDDIVIIIACGGSCMTYEDL 328

>TDEL0D06540 Chr4 (1175562..1176575) [1014 bp, 337 aa] {ON} 
          Length = 337

 Score =  264 bits (675), Expect = 5e-86,   Method: Compositional matrix adjust.
 Identities = 129/324 (39%), Positives = 190/324 (58%), Gaps = 3/324 (0%)

Query: 6   NKTPLLKHFF--PGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVF 63
           +K+PLL   F    K+ PQF+LKYE+LQPSGSFKSRGIG LI   A   +  +    +VF
Sbjct: 5   HKSPLLNRRFKESEKDGPQFFLKYETLQPSGSFKSRGIGYLINSKAKEARSRDGSDVHVF 64

Query: 64  XXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLK 123
                          + L+L CTVVVP  TK  M+ +I+  G+ VI+ G HW  AD +LK
Sbjct: 65  SSSGGNAGLAAANASKLLNLNCTVVVPVTTKRHMIDRIQNAGSQVIVHGTHWGMADTYLK 124

Query: 124 QNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXX 183
           + +M ++  + +EP+YVHPFD+PL+WEGHS M+DEI+E   +Q  +++++K I+CSV   
Sbjct: 125 EVVMKKVPSN-VEPLYVHPFDDPLVWEGHSFMIDEIVEQLQEQGRSMRDVKGIICSVGGG 183

Query: 184 XXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANIS 243
                     E++  A KIP++ VET G      SL   KPV  T++++IA+SLG+  I+
Sbjct: 184 GLYNGIVGGLERHGYAGKIPIIAVETVGADALAKSLAAGKPVRLTEVTSIASSLGSPYIA 243

Query: 244 NQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTDLLETALGT 303
              F+ A +Y                L+F  + N+++EPAC A++ L YH D L   L  
Sbjct: 244 QDSFEKAIRYKTRSFVQTDEEAVRTSLRFFQETNILVEPACAASVSLCYHVDELNKLLSC 303

Query: 304 KLTCDDAVLIVACGGSSNTVKELE 327
           KL+  D V+++ CGGS+ T+ +LE
Sbjct: 304 KLSSKDIVIVIVCGGSATTISDLE 327

>KLLA0E01805g Chr5 complement(173125..174093) [969 bp, 322 aa] {ON}
           similar to uniprot|P25379 Saccharomyces cerevisiae
           YCL064C CHA1 catabolism of hydroxy amino acids catabolic
           serine (threonine) dehydratase
          Length = 322

 Score =  246 bits (629), Expect = 3e-79,   Method: Compositional matrix adjust.
 Identities = 130/322 (40%), Positives = 183/322 (56%), Gaps = 8/322 (2%)

Query: 7   KTPLLKHFFPGKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVFXXX 66
           KTPLL    P    P F LKYE+LQP GSFKSRGI +LI      I      +  V+   
Sbjct: 7   KTPLLPFREPLNGGPTFLLKYENLQPGGSFKSRGISHLIKTTMDSISDPE-NELAVYSSS 65

Query: 67  XXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLKQNI 126
                         L +PCTV+VP +TK RM++KI + GA V+I G+HWKEAD +L++ +
Sbjct: 66  GGNAGLAAARACATLKVPCTVIVPKSTKPRMIKKIESAGAKVVIFGDHWKEADTYLREYV 125

Query: 127 MNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXXXXX 186
           M + +      +YVHPFDNP+IW+GHSTM+DEI+E  ++   +I ++K IVCSV      
Sbjct: 126 MRQSSYSNT--LYVHPFDNPIIWDGHSTMIDEIIEQLAESHTDINDVKGIVCSVGGGGLY 183

Query: 187 XXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANISNQM 246
                  E++ LA  IPV  +ET GC V + SL   +PV   +IS+IATSLG+  I    
Sbjct: 184 NGVVNGLERHGLAGSIPVFAMETDGCDVLSKSLIAGEPVVLDRISSIATSLGSTEICADS 243

Query: 247 FDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTDLLETALGTKLT 306
           F  A K++              CL+F  + ++++EPACGA++H  Y  +LL       L 
Sbjct: 244 FQKAIKFSSKSIVLDDKNVVDTCLRFFDETSILVEPACGASLHTCYRPELL-----GPLG 298

Query: 307 CDDAVLIVACGGSSNTVKELET 328
            DD V+++ CGGS NT  +L++
Sbjct: 299 PDDIVVVILCGGSCNTYDDLKS 320

>KNAG0A01150 Chr1 (6346..7041) [696 bp, 231 aa] {ON}
          Length = 231

 Score =  203 bits (516), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 100/221 (45%), Positives = 142/221 (64%), Gaps = 2/221 (0%)

Query: 116 KEADNFLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKA 175
           KEAD +L QN++ ++ KD ++PIYV+PFD+PLIWEGHST++DEI+ T +Q+   + ++K 
Sbjct: 13  KEADYYL-QNVVIDLYKD-VQPIYVNPFDDPLIWEGHSTIIDEILNTLTQENIEVGSVKG 70

Query: 176 IVCSVXXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIAT 235
           I+CS              EKY+LA  IPVV VET+GC V N SL  NKPV+   I++IA 
Sbjct: 71  IICSFSGGGLYNGIMQGLEKYDLAYNIPVVAVETKGCDVLNLSLAANKPVQLDSITSIAK 130

Query: 236 SLGTANISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTD 295
           SLG++ +S ++FD   KY+              C K+  D   V+EPACGA++H  YH +
Sbjct: 131 SLGSSVVSQKVFDNVIKYHSKSLVLNDSDALDTCFKYLDDFGTVLEPACGASVHTAYHYN 190

Query: 296 LLETALGTKLTCDDAVLIVACGGSSNTVKELETALLELNLK 336
           +LE AL  KL  DD ++I+ACGGS  T ++LE A ++L  K
Sbjct: 191 VLEEALDQKLRPDDVIIIIACGGSCATFQDLERAKVQLGNK 231

>YIL167W Chr9 (29416..30048) [633 bp, 210 aa] {OFF}  SDL1Open
           reading frame, unlikely to produce a functional protein
           in S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL167W and adjacent
           ORF, YIL168W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 210

 Score =  172 bits (437), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 85/198 (42%), Positives = 119/198 (60%)

Query: 138 IYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXXXXXXXXXXXXEKYN 197
           +YVHPFDN  IWEGHST+VDEI+E   +   ++  +KA+VCSV             ++  
Sbjct: 12  LYVHPFDNETIWEGHSTIVDEIIEQLKENDISLPRVKALVCSVGGGGLFSGIIKGLDRNQ 71

Query: 198 LADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANISNQMFDYAKKYNXXX 257
           LA+KIPVV VET GC V N SLK   PV   K++++ATSL +  I++  F+   KY    
Sbjct: 72  LAEKIPVVAVETAGCDVLNKSLKKGSPVTLEKLTSVATSLASPYIASFAFESFNKYGCKS 131

Query: 258 XXXXXXXXXXXCLKFTHDHNMVIEPACGAAIHLGYHTDLLETALGTKLTCDDAVLIVACG 317
                      CL++  D+N ++EPACGA++HL YH ++LE  L  K+  DD V+I+ACG
Sbjct: 132 VVLSDQDVLATCLRYADDYNFIVEPACGASLHLCYHPEILEDILEQKIYEDDIVIIIACG 191

Query: 318 GSSNTVKELETALLELNL 335
           GS  T ++L  A   LN+
Sbjct: 192 GSCMTYEDLVKASSTLNV 209

>YIL168W Chr9 (29032..29415) [384 bp, 127 aa] {OFF} Open reading
           frame, unlikely to produce a functional protein in
           S288C; in closely related species and other S.
           cerevisiae strain backgrounds YIL168W and adjacent
           ORF, YIL167W, constitute a single ORF encoding L-serine
           dehydratase
          Length = 127

 Score =  106 bits (264), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 55/121 (45%), Positives = 71/121 (58%), Gaps = 1/121 (0%)

Query: 5   YNKTPLLKHFFP-GKNLPQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVF 63
           Y KTPL++ F   GK    FY+K+E LQP GSFKSRGIG+LI K+          K  VF
Sbjct: 6   YEKTPLIRQFLNNGKTNSWFYVKHEMLQPGGSFKSRGIGHLIRKSNEEALSEGSGKLAVF 65

Query: 64  XXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLK 123
                          + ++L C+VVVP  TK RMV+KI++ GA VII G+HW EAD +L+
Sbjct: 66  SSSGGNAGLAAATACRSMALNCSVVVPKTTKPRMVKKIQSAGAKVIIHGDHWGEADEYLR 125

Query: 124 Q 124
            
Sbjct: 126 H 126

>SAKL0F11858g Chr6 (920767..922455) [1689 bp, 562 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 562

 Score = 70.9 bits (172), Expect = 9e-13,   Method: Compositional matrix adjust.
 Identities = 63/227 (27%), Positives = 93/227 (40%), Gaps = 17/227 (7%)

Query: 25  LKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVFXXXXXXXXXXXXXXXQRLSLP 84
           LK E L P  SFK RG  N+I K        + K   V                + L++P
Sbjct: 83  LKREDLLPVFSFKLRGAYNMIAK-----LDESQKTQGVIACSAGNHAQGVAYASKHLNIP 137

Query: 85  CTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLKQNIMNEINKDKIEPIYVHPFD 144
            T+V+P +T     Q +   G+ V++ GN + EA     + +  E     I P     FD
Sbjct: 138 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTK-LTEERGLTNIPP-----FD 191

Query: 145 NPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXXXXXXXXXXXXEKYNLADKIPV 204
           +P +  G  T+  EI+    +Q  N   +KA+ C+V             ++  +A  I V
Sbjct: 192 HPYVIAGQGTIAMEIL----RQVHNASKIKAVFCAVGGGGLITGVGAYLKR--IAPHIKV 245

Query: 205 VGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANISNQMFDYAK 251
           +GVET      +TSLK  K V    + T A       I  + F  AK
Sbjct: 246 IGVETYDAATLHTSLKAGKRVPLPNVGTFADGTSVRMIGEETFRVAK 292

>KAFR0K01700 Chr11 (352943..354682) [1740 bp, 579 aa] {ON} Anc_7.367
           YER086W
          Length = 579

 Score = 67.8 bits (164), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 62/228 (27%), Positives = 94/228 (41%), Gaps = 17/228 (7%)

Query: 25  LKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVFXXXXXXXXXXXXXXXQRLSLP 84
           LK E L P  SFK RG  N+I K        NV+   V                ++L +P
Sbjct: 100 LKREDLLPVFSFKLRGAYNMIAK-----LDDNVRNQGVIACSAGNHAQGVAYAAKKLGIP 154

Query: 85  CTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLKQNIMNEINKDKIEPIYVHPFD 144
            T+V+P +T     Q +   G+ V++ GN + EA     + +  E     I P     FD
Sbjct: 155 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAK-LSEERGLTNIPP-----FD 208

Query: 145 NPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXXXXXXXXXXXXEKYNLADKIPV 204
           +P +  G  T+  EI+    +Q  N   + A+   V             ++  +A  I V
Sbjct: 209 HPYVIAGQGTVAMEIL----RQVHNANKINAVFVPVGGGGLIAGVGAYLKR--IAPHIKV 262

Query: 205 VGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANISNQMFDYAKK 252
           +GVET      +TSL+  K  E TK+ T A       I  + F  A++
Sbjct: 263 IGVETYDATTLHTSLQNGKRTELTKVGTFADGTSVRLIGEETFRVAQE 310

>KLLA0E19779g Chr5 complement(1760800..1762503) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086W ILV1 Threonine deaminase catalyzes
           the first step in isoleucine biosynthesis expression is
           under general amino acid control ILV1 locus exhibits
           highly positioned nucleosomes whose organization is
           independent of known ILV1 regulation
          Length = 567

 Score = 62.8 bits (151), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 58/227 (25%), Positives = 88/227 (38%), Gaps = 25/227 (11%)

Query: 25  LKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVFXXXXXXXXXXXXXXXQRLSLP 84
           LK E L P  SFK RG  N+I K          K   V                  +++P
Sbjct: 88  LKREDLLPVFSFKLRGAYNMIAK-----LDETQKNAGVIACSAGNHAQGVAFSSNHMNIP 142

Query: 85  CTVVVPTATKERMVQKIRATGANVIIKGNHWKEAD----NFLKQNIMNEINKDKIEPIYV 140
            T+V+P +T     Q +   GA V++ G+ + EA        ++  M +I          
Sbjct: 143 ATIVMPVSTPSIKYQNVSRLGAQVVLYGDDFDEAKLECARLAEERGMTDIP--------- 193

Query: 141 HPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXXXXXXXXXXXXEKYNLAD 200
            PFD+P +  G  T+  EI+    +Q  N  N+ A+ C+V             ++  +A 
Sbjct: 194 -PFDHPYVIAGQGTIAMEIL----RQVQNGSNIGAVFCAVGGGGLISGIGSYLKR--IAP 246

Query: 201 KIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANISNQMF 247
            I V+GVET      + SLK  K      + T A       I  + F
Sbjct: 247 HIKVIGVETYDAATLDVSLKNGKRTPLPSVGTFADGTSVRLIGEETF 293

>CAGL0I05126g Chr9 complement(481145..482860) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P00927 Saccharomyces
           cerevisiae YER086w ILV1 anabolic serine and threonine
           dehydratase precursor
          Length = 571

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 97/264 (36%), Gaps = 17/264 (6%)

Query: 25  LKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVFXXXXXXXXXXXXXXXQRLSLP 84
           LK E L P  SFK RG  N+I K          +   V                + L +P
Sbjct: 92  LKREDLLPVFSFKLRGAYNMIAK-----LDDTQRNQGVIACSAGNHAQGVAYAARHLDIP 146

Query: 85  CTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLKQNIMNEINKDKIEPIYVHPFD 144
            T+V+P +T     Q +   G+ V++ GN + EA     + +  E     I      PFD
Sbjct: 147 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTK-LAEERGLTNIP-----PFD 200

Query: 145 NPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXXXXXXXXXXXXEKYNLADKIPV 204
           +P +  G  T+  EI+    +Q +N   + A+   V             ++  +   I +
Sbjct: 201 HPYVIAGQGTVAMEIL----RQVYNSNKIGAVFVPVGGGGLIAGVGAYLKR--VTPHIKI 254

Query: 205 VGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANISNQMFDYAKKYNXXXXXXXXXX 264
           +GVET      +TSL+ NK      + T A       I  + F  A++            
Sbjct: 255 IGVETHDAATLHTSLQRNKRTNLASVGTFADGTSVRIIGEETFRVAREVVDEIVLVNTDE 314

Query: 265 XXXXCLKFTHDHNMVIEPACGAAI 288
                     D   ++EP+   A+
Sbjct: 315 ICAAVKDVFEDTRSIVEPSGALAV 338

>NCAS0A14230 Chr1 (2801647..2803356) [1710 bp, 569 aa] {ON}
           Anc_7.367
          Length = 569

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 63/264 (23%), Positives = 98/264 (37%), Gaps = 17/264 (6%)

Query: 25  LKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVFXXXXXXXXXXXXXXXQRLSLP 84
           LK E L P  SFK RG  N+I K        + +   V                + L +P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAYAAKHLGIP 144

Query: 85  CTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLKQNIMNEINKDKIEPIYVHPFD 144
            T+V+P +T     Q +   G+ V++ GN + EA     + +  E     I      PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTK-LAEERGLTNIP-----PFD 198

Query: 145 NPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXXXXXXXXXXXXEKYNLADKIPV 204
           +P +  G  T+  EI+    +Q  N   + A+   V             ++  +A  I V
Sbjct: 199 HPYVIAGQGTVAMEIL----RQVHNANKIGAVFVPVGGGGFIAGVGAYLKR--IAPHIKV 252

Query: 205 VGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANISNQMFDYAKKYNXXXXXXXXXX 264
           +GVET      +TSLK NK      + T A       I  + F  A++            
Sbjct: 253 IGVETFDAATLHTSLKHNKRTPLPTVGTFADGTSVRVIGEETFRVAQQVVDEVVLVNTDE 312

Query: 265 XXXXCLKFTHDHNMVIEPACGAAI 288
                     D   ++EP+   A+
Sbjct: 313 ICAAVKDIFEDTRSIVEPSGALAV 336

>Ecym_4708 Chr4 (1386138..1387850) [1713 bp, 570 aa] {ON} similar to
           Ashbya gossypii ACR232C
          Length = 570

 Score = 58.5 bits (140), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 67/288 (23%), Positives = 114/288 (39%), Gaps = 22/288 (7%)

Query: 4   VYNKTPLLKHFFPGKNL-PQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYV 62
           + N++P+ +  F    L     LK E L P  SFK RG  N+I      +  +  KK  V
Sbjct: 69  IINESPISRSEFLSSRLNTDVQLKREDLLPVFSFKLRGAYNMIS----HLDDVQ-KKCGV 123

Query: 63  FXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFL 122
                           + L +P T+V+P +T     Q +   GA V++ G      DNF 
Sbjct: 124 IACSAGNHAQGVAYSAKHLGIPATIVMPVSTPSIKYQNVSRLGAEVVLYG------DNFD 177

Query: 123 KQNI-MNEINKDKIEPIY-VHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSV 180
              +  + ++++K   +Y + PFD+P +  G  T+  EI+    +Q  N   + A+ C+V
Sbjct: 178 AAKVECSRLSEEK--GLYDIPPFDHPYVIAGQGTIAMEIL----KQIQNSSKIGAVFCAV 231

Query: 181 XXXXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTA 240
                        ++   A  I V+GVET      +TS++ N     +++   A      
Sbjct: 232 GGGGLIAGVGAYIKR--AAPHIKVIGVETYDAATLHTSMQNNARTTLSQVGGFADGTSVR 289

Query: 241 NISNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDHNMVIEPACGAAI 288
            I  + F  A++                      D   V+EP+   A+
Sbjct: 290 LIGEESFRVAREVVDEVILVNTDEICAAIKDIFEDTRAVVEPSGALAV 337

>TDEL0C01800 Chr3 complement(313699..315408) [1710 bp, 569 aa] {ON}
           Anc_7.367 YER086W
          Length = 569

 Score = 56.6 bits (135), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 57/227 (25%), Positives = 88/227 (38%), Gaps = 17/227 (7%)

Query: 25  LKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVFXXXXXXXXXXXXXXXQRLSLP 84
           LK E L P  SFK RG  N+I K        + K   V                + +S+P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQKNQGVIACSAGNHAQGVAFAAKHMSIP 144

Query: 85  CTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLKQNIMNEINKDKIEPIYVHPFD 144
            T+V+P +T     Q +   G+ V++ GN + EA     + +  E     I      PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTR-LSEERGLTNIP-----PFD 198

Query: 145 NPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXXXXXXXXXXXXEKYNLADKIPV 204
           +P +  G  T+  EI+    +Q  N   + A+                 ++  +A  I +
Sbjct: 199 HPYVIAGQGTVAMEIL----RQVRNSAKIGAVFVPCGGGGLVAGIGAYLKR--IAPHIKI 252

Query: 205 VGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANISNQMFDYAK 251
           +GVET      +TSLK  K      + T A       I  + F  A+
Sbjct: 253 IGVETFDSATLHTSLKNGKRTPLASVGTFADGTSVRMIGEETFRIAQ 299

>TBLA0C05070 Chr3 (1230732..1232459) [1728 bp, 575 aa] {ON}
           Anc_7.367 YER086W
          Length = 575

 Score = 55.8 bits (133), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 61/255 (23%), Positives = 96/255 (37%), Gaps = 30/255 (11%)

Query: 4   VYNKTPLLKHFFPGKNL-PQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYV 62
           V N++P+ K       L  Q  LK E L P  SFK RG  N++ K          +K  V
Sbjct: 69  VINESPMTKGIGLSSKLNSQIQLKREDLLPVFSFKMRGAYNMVAK-----LDETQRKQGV 123

Query: 63  FXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWK----EA 118
                           + L +P T+V+P +T     + +   G+ V++ GN +     E 
Sbjct: 124 IACSAGNHAQGVAYAAKHLGIPATIVMPVSTPSIKYENVSRLGSQVVLYGNDFDSSKGEC 183

Query: 119 DNFLKQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVC 178
           +   ++  +          + + PFD+P +  G  T+  EI+         +KN  A + 
Sbjct: 184 ERLCEERGL----------VNIPPFDHPYVIAGQGTVAMEILR-------QVKN-SAKIG 225

Query: 179 SVXXXXXXXXXXXXXEKY--NLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATS 236
           +V               Y   +A  I +VGVET       TSL   K  E   + T A  
Sbjct: 226 AVFVPVGGGGLVAGIGAYLKRIAPHIKIVGVETYDAATLKTSLDNGKRTELNTVGTFADG 285

Query: 237 LGTANISNQMFDYAK 251
                I  + F  +K
Sbjct: 286 TAVKMIGEETFRVSK 300

>Suva_5.199 Chr5 (303073..304803) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 88/228 (38%), Gaps = 17/228 (7%)

Query: 25  LKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVFXXXXXXXXXXXXXXXQRLSLP 84
           LK E L P  SFK RG  N+I K        + +   V                + L +P
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAKHLKIP 151

Query: 85  CTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLKQNIMNEINKDKIEPIYVHPFD 144
            T+V+P  T     Q +   G+ V++ GN + EA     + +  E     I      PFD
Sbjct: 152 ATIVMPVCTPSIKYQNVSRLGSQVVLFGNDFDEAKAECTK-LAEERGLTNIP-----PFD 205

Query: 145 NPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXXXXXXXXXXXXEKYNLADKIPV 204
           +P +  G  T+  EI+    +Q   +  + A+   V             ++  +A  I V
Sbjct: 206 HPYVIAGQGTVAMEIL----RQVRTVNKIGAVFVPVGGGGLIAGIGAYLKR--IAPHIKV 259

Query: 205 VGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANISNQMFDYAKK 252
           +GVET      + SL+ N+      + T A       I  + F  A++
Sbjct: 260 IGVETYDAATLHNSLQRNQRTPLPAVGTFADGTSVRMIGEETFRVAQQ 307

>ACR232C Chr3 complement(767330..769012) [1683 bp, 560 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YER086W
           (ILV1)
          Length = 560

 Score = 55.1 bits (131), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 54/227 (23%), Positives = 89/227 (39%), Gaps = 17/227 (7%)

Query: 25  LKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVFXXXXXXXXXXXXXXXQRLSLP 84
           LK E L P  SFK RG  N+I  N    +K       V                + L + 
Sbjct: 82  LKREDLLPVFSFKLRGAYNMI-SNLDEYQK----SAGVIACSAGNHAQGVAFSARELGIR 136

Query: 85  CTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLKQNIMNEINKDKIEPIYVHPFD 144
             +V+PT+T       + A GA V++ G  + EA     +  + +++K    P    PFD
Sbjct: 137 AMIVMPTSTPSIKYNSVAAMGAEVVLYGKDFDEAKAECAR--LAQLHKLTDIP----PFD 190

Query: 145 NPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXXXXXXXXXXXXEKYNLADKIPV 204
           +P +  G  T+  EI+    +Q  N   + A+ C V             ++  +A  I +
Sbjct: 191 HPYVIAGQGTIATEIL----RQVHNASQIGAVFCGVGGGGLIAGIGSYLKR--IAPHIKI 244

Query: 205 VGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANISNQMFDYAK 251
           +GVET      +T+LK  +      +   A       +  + F  A+
Sbjct: 245 IGVETHDAPTLHTALKQGRRTMLPAVGCFADGTSVRMMGEETFRVAR 291

>ZYRO0B02772g Chr2 (224426..226135) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 569

 Score = 54.3 bits (129), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 89/228 (39%), Gaps = 17/228 (7%)

Query: 25  LKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVFXXXXXXXXXXXXXXXQRLSLP 84
           LK E L P  SFK RG  N+I K        N K   V                + +++P
Sbjct: 90  LKREDLLPVFSFKLRGAYNMIAK-----LDENQKNQGVIACSAGNHAQGVAYAARHMNIP 144

Query: 85  CTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLKQNIMNEINKDKIEPIYVHPFD 144
            T+V+P +T     Q +   G+ V++ GN + EA     + +  E     I      PFD
Sbjct: 145 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAK-LAEERGLTNIP-----PFD 198

Query: 145 NPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXXXXXXXXXXXXEKYNLADKIPV 204
           +P +  G  T+  EI+    +Q  N   + A+   V             ++  +A  I +
Sbjct: 199 HPYVIAGQGTVAMEIL----RQVHNSLKIGAVFVPVGGGGLIAGIGAYLKR--IAPHIKI 252

Query: 205 VGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANISNQMFDYAKK 252
           VGVET      + S+K  K      + + A       I  + F  +++
Sbjct: 253 VGVETHDAPTLSASMKTGKRELLKTVGSFADGTSVRIIGEETFRVSQE 300

>Kpol_530.16 s530 complement(41170..42870) [1701 bp, 566 aa] {ON}
           complement(41170..42870) [1701 nt, 567 aa]
          Length = 566

 Score = 53.5 bits (127), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/223 (24%), Positives = 88/223 (39%), Gaps = 17/223 (7%)

Query: 25  LKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVFXXXXXXXXXXXXXXXQRLSLP 84
           LK E L P  SFK RG  N++ K        + K   V                + L++P
Sbjct: 87  LKREDLLPVFSFKLRGAYNMMAK-----LDDSQKNQGVIACSAGNHAQGIAYAAKHLNIP 141

Query: 85  CTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLKQNIMNEINKDKIEPIYVHPFD 144
            T+V+P +T     Q +   G+ V++ GN + EA     + +  E     I      PFD
Sbjct: 142 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAR-LAEERGLTNIP-----PFD 195

Query: 145 NPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXXXXXXXXXXXXEKYNLADKIPV 204
           +P +  G  T+  EI+    +Q      + A+   V             ++  +A  I +
Sbjct: 196 HPYVIAGQGTVAMEIL----RQVHKANKIGAVFVPVGGGGLIAGVGAYLKR--IAPHIKI 249

Query: 205 VGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANISNQMF 247
           +GVET   +   TSL+  K V  + + T A       I  + F
Sbjct: 250 IGVETFDANCLYTSLQSGKRVPLSSVGTFADGTAVRLIGEETF 292

>Smik_5.225 Chr5 (337064..338794) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 53.1 bits (126), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 87/228 (38%), Gaps = 17/228 (7%)

Query: 25  LKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVFXXXXXXXXXXXXXXXQRLSLP 84
           LK E L P  SFK RG  N+I K        + +   V                + L +P
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAKHLKIP 151

Query: 85  CTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLKQNIMNEINKDKIEPIYVHPFD 144
            T+V+P  T     Q +   G+ V++ GN + EA     + +  E     I      PFD
Sbjct: 152 ATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAK-LAEERGLTNIP-----PFD 205

Query: 145 NPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXXXXXXXXXXXXEKYNLADKIPV 204
           +P +  G  T+  EI+    +Q      + A+   V             ++  +A  I V
Sbjct: 206 HPYVIAGQGTVAMEIL----RQVRTANKIGAVFVPVGGGGLIAGIGAYLKR--VAPHIKV 259

Query: 205 VGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANISNQMFDYAKK 252
           +GVET      + SL+ N+      + T A       I  + F  A++
Sbjct: 260 IGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQ 307

>YER086W Chr5 (328477..330207) [1731 bp, 576 aa] {ON}  ILV1Threonine
           deaminase, catalyzes the first step in isoleucine
           biosynthesis; expression is under general amino acid
           control; ILV1 locus exhibits highly positioned
           nucleosomes whose organization is independent of known
           ILV1 regulation
          Length = 576

 Score = 52.8 bits (125), Expect = 7e-07,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 87/228 (38%), Gaps = 17/228 (7%)

Query: 25  LKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVFXXXXXXXXXXXXXXXQRLSLP 84
           LK E L P  SFK RG  N+I K        + +   V                + L +P
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAKHLKIP 151

Query: 85  CTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLKQNIMNEINKDKIEPIYVHPFD 144
            T+V+P  T     Q +   G+ V++ GN + EA     + +  E     I      PFD
Sbjct: 152 ATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAK-LAEERGLTNIP-----PFD 205

Query: 145 NPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXXXXXXXXXXXXEKYNLADKIPV 204
           +P +  G  T+  EI+    +Q      + A+   V             ++  +A  I +
Sbjct: 206 HPYVIAGQGTVAMEIL----RQVRTANKIGAVFVPVGGGGLIAGIGAYLKR--VAPHIKI 259

Query: 205 VGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANISNQMFDYAKK 252
           +GVET      + SL+ N+      + T A       I  + F  A++
Sbjct: 260 IGVETYDAATLHNSLQRNQRTPLPVVGTFADGTSVRMIGEETFRVAQQ 307

>NDAI0A01810 Chr1 complement(400890..402602) [1713 bp, 570 aa] {ON}
           Anc_7.367
          Length = 570

 Score = 50.8 bits (120), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 55/228 (24%), Positives = 89/228 (39%), Gaps = 17/228 (7%)

Query: 25  LKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVFXXXXXXXXXXXXXXXQRLSLP 84
           LK E L P  SFK RG  N+I K        + +   V                + L++P
Sbjct: 91  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAKHLNIP 145

Query: 85  CTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLKQNIMNEINKDKIEPIYVHPFD 144
            T+V+P +T     Q +   G+ V++ GN + EA     + +  E     I      PFD
Sbjct: 146 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECTK-LAEERGLTNIP-----PFD 199

Query: 145 NPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXXXXXXXXXXXXEKYNLADKIPV 204
           +P +  G  T+  EI+    +Q  N   + A+   V             ++  +A  I +
Sbjct: 200 HPYVIAGQGTVAMEIL----RQVHNANKIGAVFVPVGGGGLVAGVGAYLKR--IAPHIKI 253

Query: 205 VGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANISNQMFDYAKK 252
           +GVET       TSLK  +    + +   A       I  + F  A++
Sbjct: 254 IGVETHDAATLQTSLKHGRRTPLSVVGPFADGTSVRLIGEETFRVAQE 301

>Skud_5.205 Chr5 (322688..324418) [1731 bp, 576 aa] {ON} YER086W
           (REAL)
          Length = 576

 Score = 50.8 bits (120), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 54/228 (23%), Positives = 87/228 (38%), Gaps = 17/228 (7%)

Query: 25  LKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVFXXXXXXXXXXXXXXXQRLSLP 84
           LK E L P  SFK RG  N+I K        + +   V                + L +P
Sbjct: 97  LKREDLLPVFSFKLRGAYNMIAK-----LDDSQRNQGVIACSAGNHAQGVAFAAKHLKIP 151

Query: 85  CTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLKQNIMNEINKDKIEPIYVHPFD 144
            T+V+P  T     Q +   G+ V++ GN + EA     + +  E     I      PFD
Sbjct: 152 ATIVMPVCTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAK-LAEERGLTNIP-----PFD 205

Query: 145 NPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXXXXXXXXXXXXEKYNLADKIPV 204
           +P +  G  T+  EI+    +Q      + A+   V             ++  +A  I V
Sbjct: 206 HPYVIAGQGTVAMEIL----RQVRTANKIGAVFVPVGGGGLIAGIGAYLKR--VAPHIKV 259

Query: 205 VGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANISNQMFDYAKK 252
           +GVET      + SL+ N+      + + A       I  + F  A++
Sbjct: 260 IGVETFDAPTLHNSLQRNQRTPLPVVGSFADGTSVRMIGEETFRVAQQ 307

>TPHA0F03130 Chr6 complement(685292..686998) [1707 bp, 568 aa] {ON}
           Anc_7.367 YER086W
          Length = 568

 Score = 49.3 bits (116), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 52/228 (22%), Positives = 86/228 (37%), Gaps = 17/228 (7%)

Query: 25  LKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVFXXXXXXXXXXXXXXXQRLSLP 84
           LK + L P  SFK RG  N++ K          K   V                + L +P
Sbjct: 89  LKRDDLLPVFSFKLRGAYNMMAK-----LDDTQKNQGVIACSAGNHAQGVAYAAKHLKIP 143

Query: 85  CTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLKQNIMNEINKDKIEPIYVHPFD 144
            T+V+P +T     Q +   G+ V++ GN + EA     + +  E     I      PFD
Sbjct: 144 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEAKAECAR-LAEERGLTNIP-----PFD 197

Query: 145 NPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXXXXXXXXXXXXEKYNLADKIPV 204
           +P +  G  T+  EI+    +Q      + A+   V             ++  +A  I +
Sbjct: 198 HPYVIAGQGTVAMEIL----RQVHMSSKIGAVFVPVGGGGLIAGVGTYLKR--IAPHIKI 251

Query: 205 VGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANISNQMFDYAKK 252
           +GVET       TSL+  K      + + A       +  + F  A++
Sbjct: 252 IGVETYDACALYTSLQSGKRAALESVGSFADGTAVRLLGEETFRVAQE 299

>KNAG0C03690 Chr3 complement(722238..723971) [1734 bp, 577 aa] {ON}
           Anc_7.367 YER086W
          Length = 577

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 57/264 (21%), Positives = 96/264 (36%), Gaps = 17/264 (6%)

Query: 25  LKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVFXXXXXXXXXXXXXXXQRLSLP 84
           LK E L P  SFK RG  N++ K          K   V                + L +P
Sbjct: 98  LKREDLLPVFSFKLRGAYNMMAK-----LDDTQKNQGVIACSAGNHAQGVAFAAKHLDIP 152

Query: 85  CTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLKQNIMNEINKDKIEPIYVHPFD 144
            T+V+P +T     Q +   G+ V++ GN + EA     +    +++K++     + PFD
Sbjct: 153 ATIVMPVSTPSIKYQNVSRLGSQVVLYGNDFDEA-----KAECTKLSKER-GLTNIPPFD 206

Query: 145 NPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXXXXXXXXXXXXEKYNLADKIPV 204
           +P +  G  T+  EI+     ++ +I N K     V                 +A  I +
Sbjct: 207 HPYVIAGQGTVAMEIL-----RQVHIAN-KIGAVFVPVGGGGLVAGVGAYLKRIAPHIKI 260

Query: 205 VGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANISNQMFDYAKKYNXXXXXXXXXX 264
           +GVET       TSL+  +      + T A       I  + F  ++             
Sbjct: 261 IGVETFDASTLYTSLQRGRRTSLPSVGTFADGTSVKLIGEETFRISQDVVDEVVLVNTDE 320

Query: 265 XXXXCLKFTHDHNMVIEPACGAAI 288
                     D   ++EP+   A+
Sbjct: 321 ICAAVKDIFEDTRSIVEPSGALAV 344

>Kwal_33.14822 s33 complement(830029..831717) [1689 bp, 562 aa] {ON}
           YER086W (ILV1) - threonine deaminase [contig 101] FULL
          Length = 562

 Score = 47.0 bits (110), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 60/264 (22%), Positives = 90/264 (34%), Gaps = 17/264 (6%)

Query: 25  LKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVFXXXXXXXXXXXXXXXQRLSLP 84
           LK E L P  SFK RG  N++ K A            V                + L++P
Sbjct: 83  LKREDLLPVFSFKLRGAYNMMAKLAE-----GQGNKGVIACSAGNHAQGVAFASRHLNIP 137

Query: 85  CTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLKQNIMNEINKDKIEPIYVHPFD 144
             +V+P  T     Q +   G  V++ GN + EA       I  E     I      PFD
Sbjct: 138 AIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEA-KIECARISEERGLTNIP-----PFD 191

Query: 145 NPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXXXXXXXXXXXXEKYNLADKIPV 204
           +P +  G  T+  EI+    +Q  N   + A+   V             ++  +A  I +
Sbjct: 192 HPYVIAGQGTVAMEIL----RQVHNASKIGAVFVPVGGGGLVAGVAAYLKR--IAPHIKI 245

Query: 205 VGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANISNQMFDYAKKYNXXXXXXXXXX 264
           VGVET       TSL        T + T A       I  + F   + +           
Sbjct: 246 VGVETYDSATLKTSLDAGCRTPLTSVGTFADGTSVRMIGEETFRICEDFVDEVVLVNTDE 305

Query: 265 XXXXCLKFTHDHNMVIEPACGAAI 288
                     D   ++EP+   A+
Sbjct: 306 ICAAVKDIFEDTRSIVEPSGALAV 329

>KLTH0B04884g Chr2 (400193..401914) [1722 bp, 573 aa] {ON} highly
           similar to uniprot|P00927 Saccharomyces cerevisiae
           YER086W ILV1 Threonine deaminase catalyzes the first
           step in isoleucine biosynthesis expression is under
           general amino acid control ILV1 locus exhibits highly
           positioned nucleosomes whose organization is independent
           of known ILV1 regulation
          Length = 573

 Score = 46.6 bits (109), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 54/223 (24%), Positives = 83/223 (37%), Gaps = 17/223 (7%)

Query: 25  LKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVFXXXXXXXXXXXXXXXQRLSLP 84
           LK E L P  SFK RG  N++ K +   K   V                     + L++P
Sbjct: 94  LKREDLLPVFSFKLRGAYNMMAKLSEAQKNQGV-----IACSAGNHAQGVAFASRHLNIP 148

Query: 85  CTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLKQNIMNEINKDKIEPIYVHPFD 144
             +V+P  T     Q +   G  V++ GN + EA     + I  E     I      PFD
Sbjct: 149 AIIVMPVNTPSIKYQNVSRLGGQVVLYGNDFDEAKTECTR-ISEERGLTNIP-----PFD 202

Query: 145 NPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXXXXXXXXXXXXEKYNLADKIPV 204
           +P +  G  T+  EI+    +Q  N   + A+   V             ++  +A  I +
Sbjct: 203 HPYVIAGQGTVAMEIL----RQVHNAAKIGAVFVPVGGGGLVAGVAAYLKR--IAPHIKI 256

Query: 205 VGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANISNQMF 247
           +GVET       TSL+       + + T A       I  + F
Sbjct: 257 IGVETYDSATLKTSLEAGTRTPLSTVGTFADGTSVRMIGEETF 299

>SAKL0A10626g Chr1 complement(932879..933841) [963 bp, 320 aa] {ON}
           similar to uniprot|P36007 Saccharomyces cerevisiae
           YKL218C SRY1 3-hydroxyaspartate dehydratase deaminates
           L- threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia required for survival in the presence of
           hydroxyaspartate
          Length = 320

 Score = 44.3 bits (103), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 40/161 (24%), Positives = 67/161 (41%), Gaps = 12/161 (7%)

Query: 6   NKTPLLKHFFPGKNL-PQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVFX 64
           NKTP+L        L  + Y K E+ Q  G+FK RG  N +LK     +        V  
Sbjct: 21  NKTPVLTSRTVNAELGAEVYFKCENFQRIGAFKFRGAMNTLLKLTQEQRAAG-----VVA 75

Query: 65  XXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLKQ 124
                         + L +P T+V+P       V+     GAN I++ + + E     ++
Sbjct: 76  FSSGNHAQAIALSAKLLGVPATIVMPNDAPAAKVRATAGYGAN-IVRYDRYTED----RE 130

Query: 125 NIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQ 165
            I   + ++K   + V P+D+P +  G  T   E++E   +
Sbjct: 131 QIGRALAEEKGLTL-VPPYDHPDVIAGQGTAAKELIEEVGE 170

>YKL218C Chr11 complement(17359..18339) [981 bp, 326 aa] {ON}
           SRY13-hydroxyaspartate dehydratase, deaminates
           L-threo-3-hydroxyaspartate to form oxaloacetate and
           ammonia; required in the presence of hydroxyaspartate;
           highly similar to mouse serine racemase (Srr) but has no
           serine racemase activity
          Length = 326

 Score = 43.9 bits (102), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 75/320 (23%), Positives = 115/320 (35%), Gaps = 41/320 (12%)

Query: 6   NKTPLLKHFFPGKNL-PQFYLKYESLQPSGSFKSRGIGNLI--LKNAIRIKKINVKKPYV 62
           NKTP+L        L  Q Y K E+ Q  G+FK RG  N +  L +  R K        V
Sbjct: 21  NKTPVLTSRMLNDRLGAQIYFKGENFQRVGAFKFRGAMNAVSKLSDEKRSKG-------V 73

Query: 63  FXXXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFL 122
                           + L++P T+V+P       V      GA+ II+ N + E    +
Sbjct: 74  IAFSSGNHAQAIALSAKLLNVPATIVMPEDAPALKVAATAGYGAH-IIRYNRYTEDREQI 132

Query: 123 KQNIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXX 182
            + +  E          + P+D+P +  G  T   E++E   Q       L A+   V  
Sbjct: 133 GRQLAAEHGF-----ALIPPYDHPDVIAGQGTSAKELLEEVGQ-------LDALF--VPL 178

Query: 183 XXXXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANI 242
                         +L+    + GVE +  +    S +    V      TIA    T ++
Sbjct: 179 GGGGLLSGSALAARSLSPGCKIFGVEPEAGNDGQQSFRSGSIVHINTPKTIADGAQTQHL 238

Query: 243 SNQMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDH-NMVIEP-ACGAAIHLGYHTDLL--E 298
               F   ++ N              C+ F  +   +V+EP AC     LG+   LL  E
Sbjct: 239 GEYTFAIIRE-NVDDILTVSDQELVKCMHFLAERMKVVVEPTAC-----LGFAGALLKKE 292

Query: 299 TALGTKLTCDDAVLIVACGG 318
             +G K      V I+  GG
Sbjct: 293 ELVGKK------VGIILSGG 306

>Skud_11.2 Chr11 complement(1812..2792) [981 bp, 326 aa] {ON}
           YKL218C (REAL)
          Length = 326

 Score = 43.1 bits (100), Expect = 6e-04,   Method: Compositional matrix adjust.
 Identities = 66/296 (22%), Positives = 108/296 (36%), Gaps = 29/296 (9%)

Query: 6   NKTPLLKHFFPGKNL-PQFYLKYESLQPSGSFKSRGIGNLILKNAIRIKKINVKKPYVFX 64
           NKTP+L        L  + Y K E+ Q  G+FK RG  N + K + + +K       V  
Sbjct: 21  NKTPVLTSRTLNDRLEAEVYFKGENYQRVGAFKFRGAMNAVSKLSDKERKKG-----VIA 75

Query: 65  XXXXXXXXXXXXXXQRLSLPCTVVVPTATKERMVQKIRATGANVIIKGNHWKEADNFLKQ 124
                         +  ++P T+++P       V      GA+ IIK N + E    + +
Sbjct: 76  FSSGNHAQAIALSAKLFNVPATIIMPEDAPALKVAATAGYGAH-IIKYNRYTEDREHIGR 134

Query: 125 NIMNEINKDKIEPIYVHPFDNPLIWEGHSTMVDEIMETFSQQKFNIKNLKAIVCSVXXXX 184
            +       K   + + P+D+P +  G  T   E+ E        +  L A+   V    
Sbjct: 135 QLAA-----KHGYVLIPPYDHPDVIAGQGTSAKELFE-------EVGELDALF--VPLGG 180

Query: 185 XXXXXXXXXEKYNLADKIPVVGVETQGCHVFNTSLKLNKPVEFTKISTIATSLGTANISN 244
                       +L+    V GVE +  +    S K    V     STIA    T ++  
Sbjct: 181 GGLLSGSALAARSLSPGCKVFGVEPEAGNDGQQSFKSGSIVHIDTPSTIADGAQTQHLGE 240

Query: 245 QMFDYAKKYNXXXXXXXXXXXXXXCLKFTHDH-NMVIEP-ACGAAIHLGYHTDLLE 298
             +   ++ N              C+ F  +   +V+EP AC     LG+   LL+
Sbjct: 241 YTYAVIRE-NVDDILTVSDEELVECMHFLAERMKLVVEPTAC-----LGFAGALLK 290

>Suva_10.514 Chr10 complement(878137..880479) [2343 bp, 780 aa] {ON}
           YLR397C (REAL)
          Length = 780

 Score = 32.3 bits (72), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 34/143 (23%), Positives = 57/143 (39%), Gaps = 18/143 (12%)

Query: 39  RGIGNLILKNAIRIKKINVKKPYVFXXXXXXXXX------XXXXXXQRLSLPCTVVVPTA 92
           R +GN+IL + + IKK  V+ PY                       Q+L   C +V+P  
Sbjct: 103 RSVGNMILGDRLEIKKAQVQPPYATKVAIGSLQGCDILECIEEKVIQKLLDDCGIVMPGM 162

Query: 93  TKERMVQKIRATGANVIIKGNHWKEADNFLKQNIMNEINKDKI-----EPIYVHPFDNPL 147
               +  K      +VII       +D+ L      ++N D +       IY+ P   P+
Sbjct: 163 IFHNVKTKTDDDSIDVII----TDASDDSLPDVNQIDLNSDAVYGMLEGQIYLSP---PV 215

Query: 148 IWEGHSTMVDEIMETFSQQKFNI 170
           I+   ST +    E  + +K+N+
Sbjct: 216 IFRKGSTHITFTKEMQANRKYNL 238

>Smik_17.27 Chr17 complement(29476..31542) [2067 bp, 688 aa] {ON}
           YKL222C (REAL)
          Length = 688

 Score = 31.2 bits (69), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 12/20 (60%), Positives = 16/20 (80%)

Query: 277 NMVIEPACGAAIHLGYHTDL 296
           NM+I+ AC  AI+LG HTD+
Sbjct: 303 NMLIQMACSIAINLGLHTDI 322

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.135    0.396 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 32,535,659
Number of extensions: 1237750
Number of successful extensions: 3309
Number of sequences better than 10.0: 60
Number of HSP's gapped: 3286
Number of HSP's successfully gapped: 60
Length of query: 350
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 240
Effective length of database: 40,868,139
Effective search space: 9808353360
Effective search space used: 9808353360
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 66 (30.0 bits)