Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_2002.461.52ON1123112352570.0
TDEL0C064901.52ON1153117430000.0
TPHA0E036401.52ON1137117329650.0
ZYRO0F17402g1.52ON1189121528440.0
NCAS0B086001.52ON1117116328380.0
Suva_2.6871.52ON1128116227350.0
Skud_4.7831.52ON1135116626990.0
KAFR0D041001.52ON1117115926920.0
YDR507C (GIN4)1.52ON1142117726780.0
KLTH0F01672g1.52ON1164117626580.0
Smik_4.7891.52ON1136116826580.0
KLLA0C01650g1.52ON1112116126430.0
KNAG0F002901.52ON1125117625790.0
NDAI0A006601.52ON1022116325080.0
CAGL0K05709g1.52ON1103115624790.0
SAKL0C01716g1.52ON121560519830.0
AFR696C1.52ON114259019440.0
Ecym_10581.52ON116458618900.0
TBLA0A071501.52ON139153218880.0
Suva_3.1901.52ON102483717410.0
Skud_3.391.52ON101757215860.0
Smik_3.541.52ON103256515560.0
YCL024W (KCC4)1.52ON103757714930.0
Kwal_33.132251.52ON96438512051e-147
KLTH0D05566g2.479ON112835310171e-119
Ecym_73922.479ON143438910221e-117
ABL034W2.479ON142535310121e-116
Kwal_26.77882.479ON126735310021e-116
KLLA0F13552g2.479ON126736810001e-115
SAKL0E02860g2.479ON13773569901e-113
Smik_11.1392.479ON15345089931e-113
YKL101W (HSL1)2.479ON15183929921e-113
TBLA0I011502.479ON17453859951e-112
Skud_11.1262.479ON15183929791e-111
KAFR0D032002.479ON14484899731e-111
Suva_11.1232.479ON15263899731e-110
KNAG0A065402.479ON14323779691e-110
TDEL0A025502.479ON13693979621e-109
Kpol_431.92.479ON15524659571e-108
ZYRO0G03366g2.479ON16164049481e-107
NCAS0A057702.479ON14613859411e-106
CAGL0K08514g2.479ON14893969221e-104
NDAI0D027502.479ON15153598424e-93
TPHA0G032002.479ON15343148257e-91
Kwal_33.13222singletonOFF1481206213e-74
CAGL0M08910g5.611ON6122806184e-68
TPHA0C004705.611ON6315106161e-67
Kpol_1018.655.611ON6012716131e-67
KLLA0A03806g5.611ON6022736132e-67
NCAS0A080805.611ON6232716142e-67
TPHA0D028405.611ON6342706142e-67
Suva_2.6515.611ON6332716091e-66
TBLA0E033605.611ON6542716101e-66
YDR477W (SNF1)5.611ON6332716091e-66
Smik_4.7545.611ON6322716081e-66
Ecym_55885.611ON6132716052e-66
KNAG0B032305.611ON6412766054e-66
Skud_4.7515.611ON6342716045e-66
Kpol_495.145.611ON6242716029e-66
NDAI0H009405.611ON6852906059e-66
KAFR0C058605.611ON6442716012e-65
AEL230W5.611ON6082775982e-65
TDEL0A047805.611ON6212715956e-65
Kwal_47.182335.611ON5982685938e-65
ZYRO0A05544g5.611ON6312765922e-64
SAKL0G06952g5.611ON5992685902e-64
KLTH0G05698g5.611ON5972685857e-64
Kwal_26.87098.654ON8292895351e-55
KLTH0D10714g8.654ON8722895315e-55
CAGL0M02519g8.654ON7563035213e-54
TPHA0G017108.654ON8052855223e-54
ZYRO0F06842g8.654ON8432895209e-54
NDAI0E023208.654ON9322925212e-53
SAKL0H07084g8.654ON9192885193e-53
KNAG0J015908.654ON8053325144e-53
TDEL0A060008.654ON7902825101e-52
NDAI0J012508.279ON11763105171e-52
Kpol_1072.298.654ON8932895112e-52
Suva_16.1698.654ON8582965092e-52
TPHA0J008208.279ON12182915143e-52
TBLA0B039708.654ON12083055125e-52
KAFR0H025408.654ON8173505055e-52
YPL141C (FRK1)8.654ON8653025066e-52
KAFR0A037308.654ON7882915038e-52
NCAS0C015908.654ON8642965031e-51
Ecym_42918.279ON11452915072e-51
Smik_4.3678.279ON10662865062e-51
CAGL0J03872g8.654ON6612934923e-51
AGR058W8.279ON10712915044e-51
KNAG0G021108.279ON11923065054e-51
Kpol_1012.68.654ON6282944904e-51
Skud_16.1408.654ON8652935004e-51
NCAS0B037408.279ON10492895025e-51
SAKL0H16632g8.279ON10622915027e-51
Suva_2.2838.279ON10892865027e-51
NDAI0B020708.279ON12582895029e-51
CAGL0M11396g8.279ON11922895011e-50
NDAI0E012908.654ON7292934911e-50
Smik_15.4178.654ON8062914931e-50
Ecym_83398.654ON9202864961e-50
Skud_4.3838.279ON10652864982e-50
NCAS0B014708.654ON7272974902e-50
YDR122W (KIN1)8.279ON10642864982e-50
Smik_6.3398.654ON8652934942e-50
Kpol_1066.468.279ON12252844992e-50
TBLA0C046008.279ON13152864983e-50
NCAS0B050908.279ON12102964973e-50
TPHA0D011408.654ON6223034824e-50
KAFR0B028008.279ON10952894954e-50
KLLA0F19536g8.279ON11042914938e-50
TDEL0F040608.279ON11262844921e-49
Skud_15.3998.654ON8072914861e-49
KLTH0G13288g8.279ON11422914912e-49
Suva_8.2848.654ON8082914852e-49
ACR119W8.654ON9312864872e-49
Skud_12.1648.279ON11602914902e-49
CAGL0B01925g8.279ON9442894872e-49
YLR096W (KIN2)8.279ON11472914884e-49
Smik_12.1558.279ON11622914875e-49
ZYRO0D06776g8.279ON12042864876e-49
KNAG0A030408.654ON6442914738e-49
YOR233W (KIN4)8.654ON8002914799e-49
Suva_10.1808.279ON11592914832e-48
CAGL0M02299g8.668ON8932804792e-48
TBLA0C017508.654ON9812894741e-47
KNAG0H031408.279ON9362864623e-46
KLLA0D07348g8.654ON9092864613e-46
SAKL0H06754g8.668ON8842774552e-45
ZYRO0F07194g8.668ON9382904542e-45
NDAI0E023908.668ON8832964506e-45
KNAG0J016708.668ON10093874482e-44
NCAS0C016708.668ON8962774462e-44
TBLA0B038608.668ON9882804445e-44
Ecym_24058.668ON8552804302e-42
KLLA0F11319g8.668ON8433354292e-42
TDEL0A061408.668ON8612784273e-42
TPHA0G016308.668ON8712754265e-42
ACR133C8.668ON8512804256e-42
KLTH0D11044g8.668ON8492904248e-42
Kpol_1072.198.668ON8962774231e-41
KNAG0D010906.222ON3722964011e-41
Kwal_26.87518.668ON8482764222e-41
Kwal_56.237178.279ON8581894185e-41
Suva_16.1608.668ON9182924195e-41
YPL150W8.668ON9012904186e-41
Skud_16.1328.668ON9242934151e-40
Smik_6.3478.668ON9172924132e-40
KLLA0F11143g8.676ON8132774094e-40
NDAI0G053001.374ON4372993911e-39
NCAS0A088801.374ON4222993901e-39
NCAS0D006301.374ON4272913892e-39
Smik_6.3508.676ON8222894033e-39
Kwal_56.224766.31ON6972293994e-39
KNAG0I014801.374ON4402773864e-39
KNAG0J017008.676ON8202834006e-39
KLTH0C10912g6.31ON6972293977e-39
CAGL0F04741g1.374ON4422993857e-39
CAGL0L07326g2.352ON5063103887e-39
YFR014C (CMK1)1.374ON4462753858e-39
AAR009W1.374ON4532683841e-38
YPL153C (RAD53)8.676ON8212893971e-38
Skud_16.1298.676ON8272893972e-38
TDEL0B063201.374ON4442873822e-38
Suva_16.1578.676ON8322943962e-38
Ecym_30356.31ON7402093932e-38
ACL006W6.31ON7082093923e-38
NCAS0D021006.31ON7262073923e-38
TBLA0B004906.31ON7872373943e-38
TPHA0O011201.374ON4292733793e-38
KLTH0H11396g1.374ON4372753794e-38
Smik_7.3191.374ON4462773794e-38
KAFR0H024308.676ON7842813925e-38
NDAI0H035201.374ON4582713796e-38
SAKL0D07656g1.374ON4322703776e-38
Kwal_0.961.374ON4272913776e-38
Kpol_1069.131.374ON4272773776e-38
Suva_6.781.374ON4452753777e-38
NDAI0E021108.676ON9032873927e-38
Ecym_12751.374ON4512743788e-38
KAFR0C044801.374ON4352753768e-38
KLTH0D11242g8.676ON7952793909e-38
CAGL0M02233g8.676ON7672963891e-37
KLLA0F23155g1.374ON4272683751e-37
Kwal_26.87968.676ON7962793891e-37
Suva_13.1636.31ON7052423852e-37
KNAG0E008506.31ON7112423842e-37
Kpol_1065.36.222ON3762843693e-37
Suva_15.1551.374ON4522753733e-37
Skud_6.891.374ON4462773723e-37
KAFR0K002806.222ON3602143664e-37
SAKL0E01584g6.31ON6952313825e-37
NDAI0F016006.222ON4122193687e-37
Kwal_56.240916.222ON3812143667e-37
Skud_13.1546.31ON7052093817e-37
Smik_13.1596.31ON7052423808e-37
Kpol_1037.206.31ON7042353808e-37
Kpol_1072.168.676ON7952813828e-37
Skud_15.1441.374ON4492733698e-37
YMR001C (CDC5)6.31ON7052423808e-37
SAKL0H06534g8.676ON8042813829e-37
KAFR0G026906.31ON7132263801e-36
TBLA0B038408.676ON8582803821e-36
YDL101C (DUN1)2.352ON5132953721e-36
TDEL0A062208.676ON7942813811e-36
KAFR0C042801.336ON5342963721e-36
TBLA0A020306.214ON4032743642e-36
TPHA0J004206.31ON7072353782e-36
CAGL0J11638g6.31ON7462083782e-36
KAFR0K003306.214ON3732913612e-36
KAFR0H025108.668ON8793533792e-36
NCAS0C013708.676ON7992793783e-36
YOL016C (CMK2)1.374ON4472733653e-36
KLTH0H04180g6.214ON3532693593e-36
NDAI0C026806.31ON7502003754e-36
NCAS0A011006.214ON3542783584e-36
CAGL0I09504g1.336ON5282503684e-36
TBLA0D050101.374ON4342783635e-36
TPHA0E028206.222ON3842223595e-36
Skud_16.766.214ON3822783595e-36
KLLA0E01585g2.352ON5122923675e-36
YPL203W (TPK2)6.214ON3802783596e-36
Suva_4.1452.352ON5142963666e-36
SAKL0E05984g2.352ON5052923657e-36
CAGL0K10604g1.374ON4462773627e-36
ZYRO0E05588g1.374ON4712773639e-36
Smik_6.4086.214ON3812783579e-36
Kwal_56.240596.214ON3532693559e-36
ZYRO0E07018g6.222ON3672143561e-35
KLTH0H03982g6.222ON3982143581e-35
TDEL0G043806.31ON7222293721e-35
KNAG0D011406.214ON3952783571e-35
Smik_15.1531.374ON4422733601e-35
Smik_4.1352.352ON5132963632e-35
ZYRO0C07480g6.31ON7743003712e-35
KLLA0C06138g6.31ON7082313692e-35
NCAS0B044906.222ON3492123513e-35
KAFR0K024502.352ON5112953613e-35
KAFR0I020101.374ON4322793563e-35
TPHA0G016008.676ON8452813694e-35
SAKL0C05368g1.182ON4183063545e-35
Suva_16.1046.214ON3832783525e-35
Skud_4.1542.352ON5132963595e-35
AFL188C2.352ON4723093567e-35
ACR142W8.676ON8372863669e-35
ZYRO0F07370g8.676ON7622793641e-34
CAGL0G09020g6.214ON3612693471e-34
Kpol_1023.266.31ON7392303631e-34
TDEL0G028202.352ON4972953551e-34
TBLA0A020506.222ON4342763511e-34
Smik_6.4146.222ON3672183472e-34
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_2002.46
         (1123 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON} (95107...  2029   0.0  
TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa]...  1160   0.0  
TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {...  1146   0.0  
ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa...  1100   0.0  
NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_...  1097   0.0  
Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] ...  1058   0.0  
Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] ...  1044   0.0  
KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {...  1041   0.0  
YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON...  1036   0.0  
KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} simil...  1028   0.0  
Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] ...  1028   0.0  
KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} simil...  1022   0.0  
KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52...   998   0.0  
NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52    970   0.0  
CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa]...   959   0.0  
SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} simil...   768   0.0  
AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON...   753   0.0  
Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar ...   732   0.0  
TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON} Anc_...   731   0.0  
Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 a...   675   0.0  
Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W (R...   615   0.0  
Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W (R...   603   0.0  
YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein...   579   0.0  
Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016...   468   e-147
KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakl...   396   e-119
Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON...   398   e-117
ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic h...   394   e-116
Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101...   390   e-116
KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa...   389   e-115
SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa] ...   385   e-113
Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL10...   387   e-113
YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}  HSL1Nim1...   386   e-113
TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {...   387   e-112
Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL10...   381   e-111
KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2....   379   e-111
Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL10...   379   e-110
KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON} Anc_...   377   e-110
TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2....   375   e-109
Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}...   373   e-108
ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} simil...   369   e-107
NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON} Anc_...   367   e-106
CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]...   359   e-104
NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2....   328   4e-93
TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2....   322   7e-91
Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507...   243   3e-74
CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa] ...   242   4e-68
TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611...   241   1e-67
Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON} (1897...   240   1e-67
KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {...   240   2e-67
NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa] ...   241   2e-67
TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON}              241   2e-67
Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477...   239   1e-66
TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {O...   239   1e-66
YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}  SNF1AMP-...   239   1e-66
Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477...   238   1e-66
Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {O...   237   2e-66
KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {O...   237   4e-66
Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477...   237   5e-66
Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON} (33810..3...   236   9e-66
NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {O...   237   9e-66
KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON} Anc_5...   236   2e-65
AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic ho...   234   2e-65
TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.6...   233   6e-65
Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {...   233   8e-65
ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly...   232   2e-64
SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} simila...   231   2e-64
KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} simila...   229   7e-64
Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C...   210   1e-55
KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} simila...   209   5e-55
CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa] ...   205   3e-54
TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {O...   205   3e-54
ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} simila...   204   9e-54
NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON}              205   2e-53
SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {...   204   3e-53
KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8....   202   4e-53
TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON} Anc_8...   201   1e-52
NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa] ...   203   1e-52
Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {O...   201   2e-52
Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {...   200   2e-52
TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON} Anc_8...   202   3e-52
TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {...   201   5e-52
KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {O...   199   5e-52
YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON} ...   199   6e-52
KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.6...   198   8e-52
NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654    198   1e-51
Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON...   199   2e-51
Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W...   199   2e-51
CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} simil...   194   3e-51
AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic h...   198   4e-51
KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8....   199   4e-51
Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON} (11581.....   193   4e-51
Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {...   197   4e-51
NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {...   197   5e-51
SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa...   197   7e-51
Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W...   197   7e-51
NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON}             197   9e-51
CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON} si...   197   1e-50
NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {O...   193   1e-50
Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233...   194   1e-50
Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar t...   195   1e-50
Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W...   196   2e-50
NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654    193   2e-50
YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}  KIN1Serin...   196   2e-50
Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C ...   194   2e-50
Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON} (82874...   196   2e-50
TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON} Anc_...   196   3e-50
NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON}             196   3e-50
TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.6...   190   4e-50
KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8....   195   4e-50
KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON} sim...   194   8e-50
TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8....   194   1e-49
Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233...   191   1e-49
KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa...   193   2e-49
Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W ...   191   2e-49
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...   192   2e-49
Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR09...   193   2e-49
CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} simila...   192   2e-49
YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}  KIN2Seri...   192   4e-49
Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR09...   192   5e-49
ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa] ...   192   6e-49
KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {O...   186   8e-49
YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}  KIN4Serin...   189   9e-49
Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR09...   190   2e-48
CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} simil...   189   2e-48
TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.6...   187   1e-47
KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {O...   182   3e-46
KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} simila...   182   3e-46
SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} simila...   179   2e-45
ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {...   179   2e-45
NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {O...   177   6e-45
KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa] ...   177   2e-44
NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {O...   176   2e-44
TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.6...   175   5e-44
Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar t...   170   2e-42
KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} simi...   169   2e-42
TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa] ...   169   3e-42
TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.6...   168   5e-42
ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON} S...   168   6e-42
KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {...   167   8e-42
Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON} (44906....   167   1e-41
KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {O...   159   1e-41
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...   167   2e-41
Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {...   165   5e-41
Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150...   166   5e-41
YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein ki...   165   6e-41
Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150...   164   1e-40
Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON...   163   2e-40
KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]...   162   4e-40
NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON} Anc_1...   155   1e-39
NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON} Anc_1...   154   1e-39
NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {O...   154   2e-39
Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C ...   159   3e-39
Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {...   158   4e-39
KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.3...   153   4e-39
KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON}             158   6e-39
KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly...   157   7e-39
CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} simila...   152   7e-39
CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} simil...   154   7e-39
YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}  ...   152   8e-39
AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic ho...   152   1e-38
YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON} ...   157   1e-38
Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {...   157   2e-38
TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON} Anc_1...   151   2e-38
Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {...   157   2e-38
Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON} s...   155   2e-38
ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic ho...   155   3e-38
NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31     155   3e-38
TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}...   156   3e-38
TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {...   150   3e-38
KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {...   150   4e-38
Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON...   150   4e-38
KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {O...   155   5e-38
NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON}              150   6e-38
SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {...   149   6e-38
Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON} YOL...   149   6e-38
Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {O...   149   6e-38
Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C (...   149   7e-38
NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {O...   155   7e-38
Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}...   150   8e-38
KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.3...   149   8e-38
KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} simila...   154   9e-38
CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa] ...   154   1e-37
KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} simi...   149   1e-37
Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C...   154   1e-37
Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {...   152   2e-37
KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {O...   152   2e-37
Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON} ...   146   3e-37
Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {...   148   3e-37
Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C (...   147   3e-37
KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON...   145   4e-37
SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {...   151   5e-37
NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {O...   146   7e-37
Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209...   145   7e-37
Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {...   151   7e-37
Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {...   150   8e-37
Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON} (41658....   150   8e-37
Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {O...   151   8e-37
Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {...   146   8e-37
YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON} ...   150   8e-37
SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {...   151   9e-37
KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {O...   150   1e-36
TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {O...   151   1e-36
YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}  ...   147   1e-36
TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON} Anc_8...   151   1e-36
KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.3...   147   1e-36
TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {O...   144   2e-36
TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON...   150   2e-36
CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa...   150   2e-36
KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.21...   143   2e-36
KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {O...   150   2e-36
NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {O...   150   3e-36
YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON} ...   145   3e-36
KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly...   142   3e-36
NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {O...   149   4e-36
NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON}              142   4e-36
CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} simila...   146   4e-36
TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa] ...   144   5e-36
TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {O...   142   5e-36
Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W...   142   5e-36
KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 ...   145   5e-36
YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}  TPK2cAMP-...   142   6e-36
Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON...   145   6e-36
SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [151...   145   7e-36
CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa...   144   7e-36
ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} simila...   144   9e-36
Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON...   142   9e-36
Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {...   141   9e-36
ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} simila...   141   1e-35
KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {...   142   1e-35
TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.3...   147   1e-35
KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON}              142   1e-35
Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {...   143   1e-35
Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON...   144   2e-35
ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly...   147   2e-35
KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} simila...   146   2e-35
NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141    139   3e-35
KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 ...   143   3e-35
KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {O...   141   3e-35
TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {O...   146   4e-35
SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {...   140   5e-35
Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203...   140   5e-35
Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON...   142   5e-35
AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON} Syn...   141   7e-35
ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic ho...   145   9e-35
ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} simila...   144   1e-34
CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly...   138   1e-34
Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON} (51805....   144   1e-34
TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494...   141   1e-34
TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON}              139   1e-34
Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C ...   138   2e-34
Kpol_1004.19 s1004 (36090..36101,36217..37689) [1485 bp, 494 aa]...   140   3e-34
Kpol_1033.50 s1033 complement(126043..127197) [1155 bp, 384 aa] ...   137   3e-34
ZYRO0G08844g Chr7 complement(711678..712766) [1089 bp, 362 aa] {...   137   3e-34
KNAG0A05670 Chr1 complement(847460..849016) [1557 bp, 518 aa] {O...   140   3e-34
YPL209C Chr16 complement(156490..157593) [1104 bp, 367 aa] {ON} ...   137   3e-34
KAFR0I02440 Chr9 complement(493668..495128) [1461 bp, 486 aa] {O...   139   3e-34
NDAI0A00960 Chr1 complement(197205..198431) [1227 bp, 408 aa] {O...   138   4e-34
Ecym_2397 Chr2 complement(771343..773961) [2619 bp, 872 aa] {ON}...   143   4e-34
NDAI0F01650 Chr6 (403635..404738) [1104 bp, 367 aa] {ON} Anc_6.214    136   4e-34
Skud_16.70 Chr16 complement(129918..131021) [1104 bp, 367 aa] {O...   136   4e-34
Ecym_5624 Chr5 (1256658..1258022) [1365 bp, 454 aa] {ON} similar...   138   5e-34
KLLA0B02332g Chr2 complement(206863..207948) [1086 bp, 361 aa] {...   136   5e-34
NCAS0B05910 Chr2 (1120092..1121645) [1554 bp, 517 aa] {ON} Anc_2...   139   6e-34
Kwal_33.13846 s33 complement(419630..420757) [1128 bp, 375 aa] {...   136   6e-34
Skud_10.50 Chr10 complement(84697..85890) [1194 bp, 397 aa] {ON}...   137   7e-34
CAGL0E05720g Chr5 (569265..570341) [1077 bp, 358 aa] {ON} simila...   135   8e-34
TBLA0B07330 Chr2 complement(1745229..1746821,1746990..1747013) [...   139   8e-34
YJL164C Chr10 complement(109966..111159) [1194 bp, 397 aa] {ON} ...   136   9e-34
Ecym_2203 Chr2 (401590..402648) [1059 bp, 352 aa] {ON} similar t...   135   1e-33
TPHA0E02840 Chr5 (594381..595589) [1209 bp, 402 aa] {ON} Anc_6.2...   136   1e-33
SAKL0A04466g Chr1 (413816..414937) [1122 bp, 373 aa] {ON} highly...   135   1e-33
KLTH0F04840g Chr6 complement(427194..428339) [1146 bp, 381 aa] {...   135   1e-33
Smik_10.66 Chr10 complement(108043..109236) [1194 bp, 397 aa] {O...   135   2e-33
TDEL0C03710 Chr3 (653934..655169) [1236 bp, 411 aa] {ON} Anc_1.1...   135   2e-33
AFL090W Chr6 (274336..275376) [1041 bp, 346 aa] {ON} Syntenic ho...   134   2e-33
Skud_11.58 Chr11 complement(120855..122042) [1188 bp, 395 aa] {O...   135   2e-33
TDEL0E05310 Chr5 (972769..973893) [1125 bp, 374 aa] {ON} Anc_6.2...   134   2e-33
KLLA0D03190g Chr4 (267933..269051) [1119 bp, 372 aa] {ON} highly...   134   2e-33
KAFR0F01800 Chr6 complement(350480..351754) [1275 bp, 424 aa] {O...   135   3e-33
CAGL0M08404g Chr13 complement(836791..838179) [1389 bp, 462 aa] ...   136   3e-33
Suva_11.56 Chr11 complement(119479..120675) [1197 bp, 398 aa] {O...   135   3e-33
KLLA0B07205g Chr2 complement(624606..625973) [1368 bp, 455 aa] {...   136   3e-33
KNAG0C02080 Chr3 complement(404332..405588) [1257 bp, 418 aa] {O...   135   5e-33
KNAG0C01060 Chr3 complement(205965..207374) [1410 bp, 469 aa] {O...   135   5e-33
Suva_6.245 Chr6 (438131..439315) [1185 bp, 394 aa] {ON} YJL164C ...   134   6e-33
TPHA0F02430 Chr6 complement(535865..538261) [2397 bp, 798 aa] {O...   139   6e-33
TDEL0E05220 Chr5 complement(957515..958597) [1083 bp, 360 aa] {O...   133   6e-33
KNAG0C01820 Chr3 (355604..357376) [1773 bp, 590 aa] {ON}              137   7e-33
Smik_11.62 Chr11 complement(120153..121346) [1194 bp, 397 aa] {O...   133   1e-32
TPHA0O01400 Chr15 complement(277678..279258) [1581 bp, 526 aa] {...   135   1e-32
KNAG0C02440 Chr3 complement(475652..476857) [1206 bp, 401 aa] {O...   133   1e-32
TBLA0C00720 Chr3 (149299..151149) [1851 bp, 616 aa] {ON} Anc_1.4...   137   1e-32
YKL166C Chr11 complement(134509..135705) [1197 bp, 398 aa] {ON} ...   133   1e-32
SAKL0A04246g Chr1 complement(396019..397221) [1203 bp, 400 aa] {...   133   2e-32
TPHA0C04570 Chr3 (985491..987071) [1581 bp, 526 aa] {ON} Anc_2.3...   135   2e-32
ZYRO0A07546g Chr1 complement(619278..620747,620833..620847) [148...   134   2e-32
AFL101C Chr6 complement(249144..250247) [1104 bp, 367 aa] {ON} S...   132   2e-32
Kpol_2002.75 s2002 complement(168123..169394) [1272 bp, 423 aa] ...   133   2e-32
TBLA0B08250 Chr2 complement(1968879..1972922) [4044 bp, 1347 aa]...   138   3e-32
TBLA0C05830 Chr3 complement(1408930..1410210) [1281 bp, 426 aa] ...   132   3e-32
KAFR0B05410 Chr2 complement(1111152..1112771) [1620 bp, 539 aa] ...   134   3e-32
NDAI0B04700 Chr2 complement(1164332..1165918) [1587 bp, 528 aa] ...   134   3e-32
NCAS0I02840 Chr9 (528136..529344) [1209 bp, 402 aa] {ON} Anc_1.2...   132   4e-32
Kwal_47.17263 s47 complement(321115..324498) [3384 bp, 1127 aa] ...   137   4e-32
NDAI0B00210 Chr2 (27983..29185) [1203 bp, 400 aa] {ON} Anc_1.182      131   4e-32
ZYRO0G18502g Chr7 (1528075..1529265) [1191 bp, 396 aa] {ON} simi...   131   4e-32
NCAS0B08280 Chr2 (1579804..1581033) [1230 bp, 409 aa] {ON} Anc_1...   131   5e-32
AEL115C Chr5 complement(405062..406222) [1161 bp, 386 aa] {ON} S...   130   6e-32
NDAI0B03190 Chr2 complement(815759..817309) [1551 bp, 516 aa] {O...   133   7e-32
KLTH0F09988g Chr6 complement(868693..869931) [1239 bp, 412 aa] {...   131   8e-32
TPHA0B03850 Chr2 (909219..910841) [1623 bp, 540 aa] {ON} Anc_1.4...   133   8e-32
KLTH0D06006g Chr4 complement(532589..535453) [2865 bp, 954 aa] {...   136   9e-32
ZYRO0B01166g Chr2 complement(97168..100059) [2892 bp, 963 aa] {O...   136   9e-32
Ecym_8095 Chr8 (205952..207106) [1155 bp, 384 aa] {ON} similar t...   130   1e-31
Smik_2.417 Chr2 (735214..736797) [1584 bp, 527 aa] {ON} YBR274W ...   132   1e-31
KLTH0H10318g Chr8 complement(888661..890128,890228..890316) [155...   132   1e-31
KLLA0E11947g Chr5 complement(1060048..1061892) [1845 bp, 614 aa]...   133   2e-31
NDAI0K02100 Chr11 complement(469575..472304) [2730 bp, 909 aa] {...   135   2e-31
Ecym_2744 Chr2 complement(1442759..1444465) [1707 bp, 568 aa] {O...   132   2e-31
KLTH0A06776g Chr1 complement(562932..567503) [4572 bp, 1523 aa] ...   135   3e-31
Kwal_56.22693 s56 complement(239982..242936) [2955 bp, 984 aa] {...   134   3e-31
Kwal_23.3590 s23 complement(353755..355254) [1500 bp, 499 aa] {O...   131   3e-31
TPHA0E03300 Chr5 (703575..704912) [1338 bp, 445 aa] {ON} Anc_1.1...   130   3e-31
Suva_15.65 Chr15 (102271..105513) [3243 bp, 1080 aa] {ON} YOL100...   134   3e-31
Kpol_1014.8 s1014 (13007..14368) [1362 bp, 453 aa] {ON} (13007.....   130   3e-31
YOL100W Chr15 (129237..132482) [3246 bp, 1081 aa] {ON}  PKH2Seri...   134   4e-31
KLTH0H12650g Chr8 (1072961..1074592) [1632 bp, 543 aa] {ON} simi...   131   4e-31
Suva_16.97 Chr16 complement(165977..167083) [1107 bp, 368 aa] {O...   127   4e-31
KAFR0G00480 Chr7 complement(131066..132268) [1203 bp, 400 aa] {O...   128   5e-31
SAKL0A01254g Chr1 (119884..124560) [4677 bp, 1558 aa] {ON} simil...   134   5e-31
KNAG0E01390 Chr5 (275055..276776) [1722 bp, 573 aa] {ON} Anc_1.4...   131   5e-31
Kpol_1018.54 s1018 (163688..166192) [2505 bp, 834 aa] {ON} (1636...   133   5e-31
KLLA0C12485g Chr3 (1060167..1062944) [2778 bp, 925 aa] {ON} simi...   133   5e-31
ABL028W Chr2 (345953..348121) [2169 bp, 722 aa] {ON} Syntenic ho...   132   6e-31
KLLA0D09328g Chr4 complement(788565..791705) [3141 bp, 1046 aa] ...   133   9e-31
NCAS0C04120 Chr3 complement(840008..842755) [2748 bp, 915 aa] {O...   132   1e-30
Smik_7.93 Chr7 complement(158441..160132) [1692 bp, 563 aa] {ON}...   130   1e-30
KLLA0B12716g Chr2 (1109939..1112089) [2151 bp, 716 aa] {ON} simi...   132   1e-30
YBR274W Chr2 (749594..751177) [1584 bp, 527 aa] {ON}  CHK1Serine...   129   1e-30
NCAS0B07380 Chr2 complement(1396315..1397898) [1584 bp, 527 aa] ...   129   1e-30
Kwal_26.7861 s26 complement(544126..546993) [2868 bp, 955 aa] {O...   132   1e-30
Kpol_1033.55 s1033 (138831..140555,140557..140895) [2064 bp, 687...   131   1e-30
TPHA0D02740 Chr4 (566279..568819) [2541 bp, 846 aa] {ON} Anc_5.5...   132   2e-30
SAKL0E03608g Chr5 complement(291806..294007) [2202 bp, 733 aa] {...   131   2e-30
Kpol_1054.2 s1054 complement(4365..7655) [3291 bp, 1096 aa] {ON}...   132   2e-30
SAKL0D06534g Chr4 complement(538606..540091,540155..540237) [156...   129   2e-30
Skud_7.92 Chr7 complement(169006..170697) [1692 bp, 563 aa] {ON}...   129   2e-30
NCAS0A12350 Chr1 complement(2446237..2447236,2447319..2448559) [...   131   2e-30
Kpol_1018.162 s1018 (414868..416904) [2037 bp, 678 aa] {ON} (414...   130   2e-30
KAFR0E01040 Chr5 complement(214744..216252) [1509 bp, 502 aa] {O...   128   2e-30
TDEL0B05820 Chr2 complement(1031136..1032863) [1728 bp, 575 aa] ...   129   3e-30
ZYRO0B09196g Chr2 complement(721019..722569) [1551 bp, 516 aa] {...   128   3e-30
NCAS0C04940 Chr3 (1006185..1009535) [3351 bp, 1116 aa] {ON} Anc_...   131   3e-30
Kwal_26.7635 s26 (451306..453381) [2076 bp, 691 aa] {ON} YKL126W...   130   4e-30
TPHA0O01030 Chr15 complement(191875..193890) [2016 bp, 671 aa] {...   129   4e-30
KLTH0D04818g Chr4 (439491..441566) [2076 bp, 691 aa] {ON} simila...   129   4e-30
Ecym_2194 Chr2 complement(381633..382733) [1101 bp, 366 aa] {ON}...   125   5e-30
NDAI0G03470 Chr7 complement(829975..832455) [2481 bp, 826 aa] {O...   130   5e-30
YGL158W Chr7 (207033..208571) [1539 bp, 512 aa] {ON}  RCK1Protei...   127   5e-30
KLTH0C09548g Chr3 (792218..795199) [2982 bp, 993 aa] {ON} simila...   130   5e-30
Skud_15.54 Chr15 (88576..91824) [3249 bp, 1082 aa] {ON} YOL100W ...   130   5e-30
Skud_2.406 Chr2 (718522..720105) [1584 bp, 527 aa] {ON} YBR274W ...   127   5e-30
TBLA0I00280 Chr9 (42870..46820) [3951 bp, 1316 aa] {ON} Anc_2.49...   130   6e-30
KNAG0D00390 Chr4 (53459..58429) [4971 bp, 1656 aa] {ON} Anc_6.34...   130   7e-30
Smik_3.94 Chr3 (128344..130155) [1812 bp, 603 aa] {ON} YCR008W (...   128   7e-30
KAFR0J02620 Chr10 complement(502187..504265) [2079 bp, 692 aa] {...   129   7e-30
ZYRO0G02530g Chr7 (194463..196577) [2115 bp, 704 aa] {ON} highly...   129   9e-30
Skud_3.73 Chr3 (110742..112556) [1815 bp, 604 aa] {ON} YCR008W (...   127   1e-29
Suva_11.99 Chr11 (192143..194197) [2055 bp, 684 aa] {ON} YMR104C...   128   1e-29
SAKL0D09240g Chr4 (764130..765761) [1632 bp, 543 aa] {ON} some s...   127   1e-29
TDEL0D05320 Chr4 complement(965082..968255) [3174 bp, 1057 aa] {...   129   1e-29
KNAG0B05350 Chr2 complement(1034166..1036676) [2511 bp, 836 aa] ...   129   1e-29
Sklu_YGOB_Anc_2.496 Chr5 (185447..187306) [1860 bp, 619 aa] {ON}...   127   1e-29
KLLA0F01276g Chr6 complement(120001..121560) [1560 bp, 519 aa] {...   126   1e-29
KLTH0E06776g Chr5 complement(622147..625575) [3429 bp, 1142 aa] ...   129   1e-29
CAGL0C05005g Chr3 complement(467626..470856) [3231 bp, 1076 aa] ...   129   1e-29
YCR008W Chr3 (128470..130281) [1812 bp, 603 aa] {ON}  SAT4Ser/Th...   127   1e-29
Suva_3.33 Chr3 (42176..44020) [1845 bp, 614 aa] {ON} YCR008W (REAL)   127   1e-29
Skud_8.39 Chr8 complement(76730..79501) [2772 bp, 923 aa] {ON} Y...   129   1e-29
Smik_8.42 Chr8 complement(74075..76894) [2820 bp, 939 aa] {ON} Y...   129   2e-29
AER264C Chr5 complement(1120017..1124468) [4452 bp, 1483 aa] {ON...   129   2e-29
TDEL0A02220 Chr1 (402496..404565) [2070 bp, 689 aa] {ON} Anc_2.4...   127   2e-29
NDAI0K01370 Chr11 (313672..315714) [2043 bp, 680 aa] {ON}             127   2e-29
KNAG0D00210 Chr4 complement(22721..25222) [2502 bp, 833 aa] {ON}...   128   2e-29
TDEL0D02040 Chr4 (395555..397138) [1584 bp, 527 aa] {ON} Anc_1.3...   126   2e-29
YKL126W Chr11 (205707..207749) [2043 bp, 680 aa] {ON}  YPK1Serin...   127   2e-29
KAFR0D01220 Chr4 (246927..250094) [3168 bp, 1055 aa] {ON} Anc_7....   129   2e-29
YHL007C Chr8 complement(95118..97937) [2820 bp, 939 aa] {ON}  ST...   128   2e-29
KLLA0B13607g Chr2 (1191592..1194561) [2970 bp, 989 aa] {ON} simi...   128   2e-29
CAGL0K02673g Chr11 complement(241338..244085) [2748 bp, 915 aa] ...   128   3e-29
Kwal_23.6325 s23 complement(1533223..1537851) [4629 bp, 1542 aa]...   129   3e-29
NCAS0A05050 Chr1 complement(1002107..1004788) [2682 bp, 893 aa] ...   128   3e-29
TDEL0A07860 Chr1 (1365985..1368498) [2514 bp, 837 aa] {ON} Anc_6...   127   3e-29
Skud_11.103 Chr11 (192587..194629) [2043 bp, 680 aa] {ON} YMR104...   127   3e-29
NCAS0C03690 Chr3 (741930..744881) [2952 bp, 983 aa] {ON}              128   3e-29
Smik_3.173 Chr3 complement(242285..246307) [4023 bp, 1340 aa] {O...   128   3e-29
CAGL0C03509g Chr3 complement(350846..353533) [2688 bp, 895 aa] {...   127   4e-29
CAGL0L07810g Chr12 complement(859653..861443) [1791 bp, 596 aa] ...   125   4e-29
Smik_11.113 Chr11 (191688..193730) [2043 bp, 680 aa] {ON} YMR104...   126   4e-29
KNAG0I01360 Chr9 complement(262712..264556) [1845 bp, 614 aa] {O...   125   5e-29
Suva_4.535 Chr4 (921278..922861) [1584 bp, 527 aa] {ON} YBR274W ...   124   5e-29
TBLA0I01370 Chr9 complement(294202..296526) [2325 bp, 774 aa] {O...   127   5e-29
Suva_14.402 Chr14 (690198..692915) [2718 bp, 905 aa] {ON} YNR047...   127   6e-29
CAGL0I07513g Chr9 (722045..725275) [3231 bp, 1076 aa] {ON} simil...   127   7e-29
KLTH0A07458g Chr1 (620459..623080) [2622 bp, 873 aa] {ON} simila...   126   8e-29
NDAI0H02340 Chr8 complement(568767..570887) [2121 bp, 706 aa] {O...   125   8e-29
Suva_8.47 Chr8 complement(91615..94557) [2943 bp, 980 aa] {ON} Y...   126   9e-29
Smik_15.57 Chr15 (92331..95576) [3246 bp, 1081 aa] {ON} YOL100W ...   126   9e-29
Kwal_56.23841 s56 (732202..733500) [1299 bp, 432 aa] {ON} YLR113...   122   9e-29
TPHA0G02910 Chr7 (624676..626727) [2052 bp, 683 aa] {ON} Anc_2.4...   125   9e-29
Skud_14.379 Chr14 (677081..679774) [2694 bp, 897 aa] {ON} YNR047...   126   9e-29
NCAS0F01460 Chr6 complement(290441..292465) [2025 bp, 674 aa] {O...   125   1e-28
YCR091W Chr3 (274404..276566) [2163 bp, 720 aa] {ON}  KIN82Putat...   125   1e-28
Skud_3.146 Chr3 complement(227229..231233) [4005 bp, 1334 aa] {O...   127   1e-28
TPHA0G03290 Chr7 (702953..705874) [2922 bp, 973 aa] {ON} Anc_2.4...   126   1e-28
TPHA0P01050 Chr16 complement(212259..215624) [3366 bp, 1121 aa] ...   126   1e-28
Smik_4.767 Chr4 complement(1353354..1355630) [2277 bp, 758 aa] {...   125   1e-28
KLLA0E03587g Chr5 complement(323764..325707) [1944 bp, 647 aa] {...   125   1e-28
Skud_3.165 Chr3 (258916..261066) [2151 bp, 716 aa] {ON} YCR091W ...   125   1e-28
KAFR0A01760 Chr1 complement(363462..366119) [2658 bp, 885 aa] {O...   126   1e-28
Smik_14.377 Chr14 (666338..669025) [2688 bp, 895 aa] {ON} YNR047...   125   1e-28
TDEL0D04460 Chr4 complement(813075..815816) [2742 bp, 913 aa] {O...   125   1e-28
NDAI0H02470 Chr8 complement(597707..601942) [4236 bp, 1411 aa] {...   126   1e-28
Kpol_1050.13 s1050 (34788..36578) [1791 bp, 596 aa] {ON} (34788....   124   1e-28
NCAS0A04360 Chr1 (880768..882822) [2055 bp, 684 aa] {ON} Anc_2.446    125   1e-28
NDAI0A03870 Chr1 (867910..870597) [2688 bp, 895 aa] {ON} Anc_2.496    125   2e-28
Ecym_3586 Chr3 complement(1112070..1115303) [3234 bp, 1077 aa] {...   125   2e-28
TPHA0M02080 Chr13 (426966..429635) [2670 bp, 889 aa] {ON} Anc_6....   125   2e-28
CAGL0M11748g Chr13 (1168856..1170199) [1344 bp, 447 aa] {ON} hig...   121   2e-28
TBLA0E02290 Chr5 complement(563483..567385) [3903 bp, 1300 aa] {...   125   2e-28
Ecym_2434 Chr2 complement(843308..846676) [3369 bp, 1122 aa] {ON...   125   2e-28
YNR047W Chr14 (708523..711204) [2682 bp, 893 aa] {ON}  FPK1Ser/T...   125   2e-28
KAFR0B02140 Chr2 (417972..420662) [2691 bp, 896 aa] {ON} Anc_8.1...   125   2e-28
Suva_2.666 Chr2 complement(1183839..1186133) [2295 bp, 764 aa] {...   124   3e-28
TDEL0A02720 Chr1 complement(491618..494365) [2748 bp, 915 aa] {O...   125   3e-28
Kwal_23.6458 s23 (1592349..1594955) [2607 bp, 868 aa] {ON} YNR04...   124   3e-28
KNAG0J01290 Chr10 complement(230493..232019) [1527 bp, 508 aa] {...   122   3e-28
CAGL0K03399g Chr11 complement(311316..313427) [2112 bp, 703 aa] ...   124   3e-28
SAKL0H24706g Chr8 (2145552..2149100) [3549 bp, 1182 aa] {ON} sim...   125   4e-28
NCAS0F01580 Chr6 complement(313801..317949) [4149 bp, 1382 aa] {...   125   4e-28
NDAI0G05060 Chr7 complement(1227369..1229495) [2127 bp, 708 aa] ...   123   4e-28
TBLA0A10690 Chr1 (2642723..2645632) [2910 bp, 969 aa] {ON} Anc_4...   124   4e-28
ZYRO0A03894g Chr1 (307915..309273) [1359 bp, 452 aa] {ON} simila...   120   4e-28
AER195C Chr5 complement(1005431..1006945) [1515 bp, 504 aa] {ON}...   121   4e-28
TDEL0E01710 Chr5 complement(330667..332706) [2040 bp, 679 aa] {O...   123   5e-28
Suva_7.106 Chr7 (202969..204540) [1572 bp, 523 aa] {ON} YGL158W ...   121   5e-28
YDR490C Chr4 complement(1431968..1434268) [2301 bp, 766 aa] {ON}...   123   5e-28
TPHA0C00160 Chr3 complement(17339..19603) [2265 bp, 754 aa] {ON}...   123   5e-28
Kwal_0.155 s0 (84856..86619) [1764 bp, 587 aa] {ON} YLR248W (RCK...   122   5e-28
KAFR0D03020 Chr4 (596365..598398) [2034 bp, 677 aa] {ON} Anc_2.4...   123   5e-28
ZYRO0D17468g Chr4 (1439376..1441958) [2583 bp, 860 aa] {ON} weak...   124   5e-28
Kpol_1028.40 s1028 (95617..100392) [4776 bp, 1591 aa] {ON} (9561...   124   5e-28
Kpol_1042.20 s1042 (45090..47261) [2172 bp, 723 aa] {ON} (45090....   123   6e-28
CAGL0M10153g Chr13 complement(1010688..1013291) [2604 bp, 867 aa...   124   6e-28
TBLA0I02400 Chr9 complement(548975..554167) [5193 bp, 1730 aa] {...   124   6e-28
TPHA0G02480 Chr7 (509815..511860) [2046 bp, 681 aa] {ON} Anc_2.4...   123   6e-28
Kpol_1028.16 s1028 complement(45186..47825) [2640 bp, 879 aa] {O...   124   6e-28
KLTH0G12738g Chr7 complement(1085500..1086804) [1305 bp, 434 aa]...   120   6e-28
NCAS0A08610 Chr1 complement(1700839..1702704) [1866 bp, 621 aa] ...   122   7e-28
Ecym_6040 Chr6 complement(77854..80544) [2691 bp, 896 aa] {ON} s...   123   7e-28
Skud_4.764 Chr4 complement(1351725..1353995) [2271 bp, 756 aa] {...   123   8e-28
KLLA0C18568g Chr3 (1639958..1642282) [2325 bp, 774 aa] {ON} simi...   123   8e-28
ZYRO0A05214g Chr1 complement(418443..421268) [2826 bp, 941 aa] {...   123   9e-28
SAKL0B12364g Chr2 (1060853..1063021) [2169 bp, 722 aa] {ON} high...   122   9e-28
Ecym_2457 Chr2 (888054..890165) [2112 bp, 703 aa] {ON} similar t...   122   1e-27
NDAI0G04290 Chr7 complement(1030530..1033871) [3342 bp, 1113 aa]...   123   1e-27
Kpol_1037.6 s1037 (12601..15534) [2934 bp, 977 aa] {ON} (12601.....   123   1e-27
ZYRO0D04752g Chr4 complement(397364..398215,398290..398907) [147...   120   1e-27
YCR073C Chr3 complement(242588..246583) [3996 bp, 1331 aa] {ON} ...   123   1e-27
TPHA0M01840 Chr13 complement(380953..385818) [4866 bp, 1621 aa] ...   123   1e-27
Kpol_543.55 s543 (126256..127533) [1278 bp, 425 aa] {ON} (126256...   119   1e-27
TDEL0D03950 Chr4 (720229..721710) [1482 bp, 493 aa] {ON} Anc_3.2...   120   1e-27
Suva_10.202 Chr10 (380079..381386) [1308 bp, 435 aa] {ON} YLR113...   119   1e-27
KAFR0C01440 Chr3 complement(295468..298755) [3288 bp, 1095 aa] {...   122   1e-27
KNAG0A06750 Chr1 (1053919..1056294) [2376 bp, 791 aa] {ON} Anc_2...   122   2e-27
Kwal_47.16761 s47 (100315..102549) [2235 bp, 744 aa] {ON} YHR205...   122   2e-27
NCAS0E02230 Chr5 (429499..430176,430250..431104) [1533 bp, 510 a...   120   2e-27
SAKL0E03344g Chr5 (272024..273754) [1731 bp, 576 aa] {ON} simila...   120   2e-27
ZYRO0E04246g Chr5 complement(322215..324035) [1821 bp, 606 aa] {...   121   2e-27
CAGL0K07458g Chr11 complement(737165..739279) [2115 bp, 704 aa] ...   121   2e-27
TBLA0C02940 Chr3 complement(706091..711022) [4932 bp, 1643 aa] {...   123   2e-27
Smik_12.173 Chr12 (351727..353034) [1308 bp, 435 aa] {ON} YLR113...   119   2e-27
Ecym_2499 Chr2 complement(976395..981020) [4626 bp, 1541 aa] {ON...   123   2e-27
Skud_7.114 Chr7 (211645..213153) [1509 bp, 502 aa] {ON} YGL158W ...   119   2e-27
NCAS0D04710 Chr4 complement(901442..903856) [2415 bp, 804 aa] {O...   122   2e-27
Suva_3.110 Chr3 complement(160016..164146) [4131 bp, 1376 aa] {O...   122   2e-27
ZYRO0B06512g Chr2 complement(521075..524410) [3336 bp, 1111 aa] ...   122   2e-27
TBLA0B01630 Chr2 (360963..364850) [3888 bp, 1295 aa] {ON} Anc_3....   122   2e-27
KLLA0F07623g Chr6 (720246..723935) [3690 bp, 1229 aa] {ON} simil...   122   2e-27
Kpol_1055.24 s1055 complement(57430..60243) [2814 bp, 937 aa] {O...   122   2e-27
TPHA0B00240 Chr2 complement(44468..46525) [2058 bp, 685 aa] {ON}...   121   2e-27
SAKL0H16038g Chr8 complement(1401627..1402931) [1305 bp, 434 aa]...   118   2e-27
Ecym_8399 Chr8 (821221..824766) [3546 bp, 1181 aa] {ON} similar ...   122   2e-27
KNAG0G02300 Chr7 (528489..529748) [1260 bp, 419 aa] {ON} Anc_8.3...   118   2e-27
NCAS0A05570 Chr1 (1093653..1096409) [2757 bp, 918 aa] {ON} Anc_6...   122   3e-27
TBLA0F00240 Chr6 complement(45510..49256) [3747 bp, 1248 aa] {ON...   122   3e-27
Skud_1.44 Chr1 (95573..99643) [4071 bp, 1356 aa] {ON} YAL017W (R...   122   3e-27
TPHA0H00410 Chr8 (79426..82197) [2772 bp, 923 aa] {ON} Anc_8.141...   121   3e-27
KNAG0I02830 Chr9 (549811..554358) [4548 bp, 1515 aa] {ON} Anc_1....   122   3e-27
NDAI0D03420 Chr4 (806856..809261) [2406 bp, 801 aa] {ON} Anc_4.384    121   3e-27
KLLA0C08525g Chr3 (744554..749209) [4656 bp, 1551 aa] {ON} simil...   122   3e-27
NCAS0C03380 Chr3 complement(664012..665310) [1299 bp, 432 aa] {O...   117   3e-27
TDEL0H03640 Chr8 complement(600211..603924) [3714 bp, 1237 aa] {...   122   3e-27
NCAS0A10290 Chr1 complement(2051582..2053111) [1530 bp, 509 aa] ...   119   4e-27
Smik_3.189 Chr3 (273885..276044) [2160 bp, 719 aa] {ON} YCR091W ...   120   4e-27
NDAI0D04110 Chr4 (966439..967560) [1122 bp, 373 aa] {ON} Anc_4.192    116   4e-27
TDEL0A07560 Chr1 complement(1316498..1321225) [4728 bp, 1575 aa]...   122   4e-27
NDAI0K02390 Chr11 (537260..539920) [2661 bp, 886 aa] {ON} Anc_6....   121   4e-27
ZYRO0G00506g Chr7 complement(38488..40854) [2367 bp, 788 aa] {ON...   120   4e-27
Skud_12.181 Chr12 (354407..355702) [1296 bp, 431 aa] {ON} YLR113...   117   4e-27
KLLA0F12188g Chr6 (1122745..1124385) [1641 bp, 546 aa] {ON} some...   119   4e-27
NCAS0A06440 Chr1 (1270771..1273020) [2250 bp, 749 aa] {ON} Anc_4...   120   4e-27
Smik_7.115 Chr7 (201140..202663) [1524 bp, 507 aa] {ON} YGL158W ...   118   5e-27
KNAG0M00190 Chr13 complement(25224..27602) [2379 bp, 792 aa] {ON...   120   5e-27
NDAI0G02700 Chr7 complement(618268..619611) [1344 bp, 447 aa] {O...   117   5e-27
KLTH0C08932g Chr3 (749308..750867) [1560 bp, 519 aa] {ON} simila...   118   5e-27
TPHA0H02630 Chr8 complement(614048..618151) [4104 bp, 1367 aa] {...   121   5e-27
Kwal_0.307 s0 (145676..147145) [1470 bp, 490 aa] {OFF} YCR008W (...   118   5e-27
Ecym_6307 Chr6 (578677..580227) [1551 bp, 516 aa] {ON} similar t...   118   5e-27
Kwal_YGOB_0.307 s0 (145676..147175) [1500 bp, 500 aa] {ON} ANNOT...   118   5e-27
KNAG0I02670 Chr9 complement(524008..526734) [2727 bp, 908 aa] {O...   120   5e-27
Kpol_265.1 s265 (4826..7099) [2274 bp, 757 aa] {ON} (4826..7099)...   120   5e-27
KNAG0A06290 Chr1 (958438..960516) [2079 bp, 692 aa] {ON} Anc_2.4...   120   5e-27
SAKL0C09174g Chr3 complement(833618..836833) [3216 bp, 1071 aa] ...   120   6e-27
NCAS0A05370 Chr1 complement(1061671..1066197) [4527 bp, 1508 aa]...   121   6e-27
KLLA0B13112g Chr2 complement(1146006..1148198) [2193 bp, 730 aa]...   120   6e-27
KAFR0B06980 Chr2 (1452754..1455081) [2328 bp, 775 aa] {ON} Anc_4...   120   6e-27
Kwal_55.20326 s55 complement(351010..353262) [2253 bp, 750 aa] {...   119   8e-27
TBLA0H01330 Chr8 complement(297718..299163) [1446 bp, 481 aa] {O...   117   8e-27
NDAI0I00340 Chr9 (65047..70557) [5511 bp, 1836 aa] {ON} Anc_6.341     120   8e-27
KAFR0F03970 Chr6 (777047..778201) [1155 bp, 384 aa] {ON} Anc_4.1...   115   8e-27
Ecym_4266 Chr4 complement(564935..566329) [1395 bp, 464 aa] {ON}...   117   8e-27
CAGL0G04609g Chr7 complement(437162..440059) [2898 bp, 965 aa] {...   120   9e-27
CAGL0L12474g Chr12 complement(1347340..1348248) [909 bp, 302 aa]...   113   9e-27
KAFR0B02980 Chr2 (623470..624804) [1335 bp, 444 aa] {ON} Anc_8.3...   116   9e-27
Suva_7.83 Chr7 complement(159329..161038) [1710 bp, 569 aa] {ON}...   118   9e-27
KLLA0F14190g Chr6 (1311121..1315137) [4017 bp, 1338 aa] {ON} uni...   120   1e-26
KNAG0K00680 Chr11 (120919..124206) [3288 bp, 1095 aa] {ON} Anc_3...   120   1e-26
KLTH0E11220g Chr5 (1005953..1005969,1006040..1006931) [909 bp, 3...   113   1e-26
TBLA0A08290 Chr1 complement(2039328..2041376) [2049 bp, 682 aa] ...   119   1e-26
Kpol_1035.17 s1035 complement(39908..41503) [1596 bp, 531 aa] {O...   117   1e-26
KNAG0E00360 Chr5 (54187..55563) [1377 bp, 458 aa] {ON}                116   1e-26
TPHA0H00760 Chr8 complement(152442..155384) [2943 bp, 980 aa] {O...   119   1e-26
KLLA0F24618g Chr6 complement(2288943..2290613) [1671 bp, 556 aa]...   117   1e-26
YMR104C Chr13 complement(473420..475453) [2034 bp, 677 aa] {ON} ...   119   1e-26
KLLA0F20053g Chr6 (1867209..1868543) [1335 bp, 444 aa] {ON} high...   116   1e-26
Kwal_26.7154 s26 (237387..241028) [3642 bp, 1213 aa] {ON} YOL045...   120   1e-26
Suva_15.411 Chr15 (716095..718542) [2448 bp, 815 aa] {ON} YHR205...   119   1e-26
TDEL0D00330 Chr4 complement(55638..57872) [2235 bp, 744 aa] {ON}...   119   1e-26
YHR205W Chr8 (509363..511837) [2475 bp, 824 aa] {ON}  SCH9AGC fa...   119   1e-26
AFR377C Chr6 complement(1116589..1118769) [2181 bp, 726 aa] {ON}...   119   1e-26
KLTH0D17204g Chr4 complement(1426818..1429085) [2268 bp, 755 aa]...   119   1e-26
Smik_13.290 Chr13 complement(457921..459951) [2031 bp, 676 aa] {...   119   1e-26
Smik_8.295 Chr8 (484074..486548) [2475 bp, 824 aa] {ON} YHR205W ...   119   1e-26
YAL017W Chr1 (120225..124295) [4071 bp, 1356 aa] {ON}  PSK1One o...   119   1e-26
TPHA0H01630 Chr8 (371333..374443) [3111 bp, 1036 aa] {ON} Anc_5....   119   1e-26
KLTH0D03454g Chr4 (327039..331340) [4302 bp, 1433 aa] {ON} simil...   119   2e-26
KNAG0A02310 Chr1 complement(216545..217453) [909 bp, 302 aa] {ON...   112   2e-26
Suva_13.281 Chr13 complement(455094..457136) [2043 bp, 680 aa] {...   118   2e-26
NDAI0I00250 Chr9 (42174..44867) [2694 bp, 897 aa] {ON} Anc_3.177...   119   2e-26
TDEL0B06160 Chr2 complement(1086672..1088327) [1656 bp, 551 aa] ...   117   2e-26
SAKL0A00484g Chr1 complement(57938..60544) [2607 bp, 868 aa] {ON...   119   2e-26
Kwal_26.7355 s26 (326867..331207) [4341 bp, 1446 aa] {ON} YJL095...   119   2e-26
CAGL0F00913g Chr6 (97023..100643) [3621 bp, 1206 aa] {ON} simila...   119   2e-26
KAFR0D03390 Chr4 (667896..670292) [2397 bp, 798 aa] {ON} Anc_2.4...   118   2e-26
KAFR0I02100 Chr9 (431876..433258) [1383 bp, 460 aa] {ON} Anc_1.3...   115   2e-26
ACL053C Chr3 complement(273163..276708) [3546 bp, 1181 aa] {ON} ...   119   2e-26
KAFR0C04780 Chr3 (948771..951131) [2361 bp, 786 aa] {ON} Anc_6.3...   118   2e-26
Skud_8.272 Chr8 (478199..480706) [2508 bp, 835 aa] {ON} YHR205W ...   118   2e-26
SAKL0D05522g Chr4 (437018..441442) [4425 bp, 1474 aa] {ON} simil...   119   2e-26
TPHA0H02390 Chr8 (561244..563436) [2193 bp, 730 aa] {ON} Anc_6.3...   118   2e-26
NCAS0J00960 Chr10 (157010..159121) [2112 bp, 703 aa] {ON}             117   3e-26
TPHA0I00920 Chr9 (204753..209057) [4305 bp, 1434 aa] {ON} Anc_1....   119   3e-26
TBLA0B02310 Chr2 (539362..541821) [2460 bp, 819 aa] {ON} Anc_3.9...   118   3e-26
CAGL0F09075g Chr6 (894761..897001) [2241 bp, 746 aa] {ON} simila...   117   3e-26
YJL095W Chr10 (247255..251691) [4437 bp, 1478 aa] {ON}  BCK1Mito...   119   3e-26
Ecym_7473 Chr7 (963826..966045) [2220 bp, 739 aa] {ON} similar t...   117   3e-26
TBLA0D04420 Chr4 complement(1097314..1099356) [2043 bp, 680 aa] ...   117   4e-26
TDEL0H04100 Chr8 complement(706443..707306,707369..707974) [1470...   115   4e-26
ADL389W Chr4 (27641..29776) [2136 bp, 711 aa] {ON} Syntenic homo...   117   4e-26
KAFR0F04340 Chr6 (848844..853628) [4785 bp, 1594 aa] {ON} Anc_6....   118   4e-26
SAKL0H24750g Chr8 complement(2152673..2155420) [2748 bp, 915 aa]...   117   4e-26
KLTH0D01386g Chr4 (129448..130053,130132..130974) [1449 bp, 482 ...   115   4e-26
CAGL0L03520g Chr12 complement(403100..407443) [4344 bp, 1447 aa]...   118   4e-26
CAGL0B03509g Chr2 complement(349638..351431) [1794 bp, 597 aa] {...   116   5e-26
Kpol_1044.3 s1044 (4910..5845,5849..7711) [2799 bp, 932 aa] {ON}...   117   5e-26
AGR048C Chr7 complement(807464..808825) [1362 bp, 453 aa] {ON} S...   114   5e-26
YLR113W Chr12 (371620..372927) [1308 bp, 435 aa] {ON}  HOG1Mitog...   114   5e-26
ZYRO0E05170g Chr5 complement(390866..392593) [1728 bp, 575 aa] {...   116   5e-26
KAFR0A01420 Chr1 (276454..280650) [4197 bp, 1398 aa] {ON} Anc_1....   118   6e-26
Kwal_56.22788 s56 complement(281404..282951) [1548 bp, 515 aa] {...   115   6e-26
KLLA0B03586g Chr2 complement(326871..329075) [2205 bp, 734 aa] {...   117   6e-26
KLTH0A01320g Chr1 (118671..121115) [2445 bp, 814 aa] {ON} simila...   117   6e-26
CAGL0F00649g Chr6 (71961..73505) [1545 bp, 514 aa] {ON} similar ...   115   7e-26
KLLA0C04191g Chr3 (384198..386591) [2394 bp, 797 aa] {ON} weakly...   117   7e-26
YNR031C Chr14 complement(680694..685433) [4740 bp, 1579 aa] {ON}...   117   7e-26
ZYRO0D06182g Chr4 complement(529121..530416) [1296 bp, 431 aa] {...   114   7e-26
Suva_14.385 Chr14 complement(661987..666732) [4746 bp, 1581 aa] ...   117   7e-26
KNAG0D04810 Chr4 (867817..872139) [4323 bp, 1440 aa] {ON} Anc_7....   117   7e-26
NDAI0J01990 Chr10 (491491..493758) [2268 bp, 755 aa] {ON} Anc_4....   116   7e-26
Kpol_541.49 s541 complement(156530..159514) [2985 bp, 994 aa] {O...   117   7e-26
TBLA0B08520 Chr2 complement(2038517..2041321) [2805 bp, 934 aa] ...   117   8e-26
SAKL0H11638g Chr8 complement(994049..994946,995016..995032) [915...   110   8e-26
NDAI0G05470 Chr7 (1340175..1344842) [4668 bp, 1555 aa] {ON} Anc_...   117   8e-26
CAGL0B04301g Chr2 (420544..422172) [1629 bp, 542 aa] {ON} simila...   115   8e-26
Kpol_487.14 s487 complement(56520..58394) [1875 bp, 624 aa] {ON}...   115   8e-26
NDAI0A07190 Chr1 (1636773..1638380) [1608 bp, 535 aa] {ON} Anc_3...   115   8e-26
KAFR0D03100 Chr4 complement(610106..611635) [1530 bp, 509 aa] {O...   114   8e-26
Skud_1.72 Chr1 (141337..144261) [2925 bp, 974 aa] {ON} YAR019C (...   117   9e-26
ADR167W Chr4 (994581..997202) [2622 bp, 873 aa] {ON} Syntenic ho...   117   9e-26
Smik_1.50 Chr1 (103132..107205) [4074 bp, 1357 aa] {ON} YAL017W ...   117   9e-26
SAKL0B05082g Chr2 (436707..438896) [2190 bp, 729 aa] {ON} simila...   116   9e-26
TDEL0F04290 Chr6 (801456..802739) [1284 bp, 427 aa] {ON} Anc_8.3...   113   1e-25
KNAG0G01250 Chr7 complement(280791..283364) [2574 bp, 857 aa] {O...   116   1e-25
AFR335C Chr6 complement(1046756..1049857) [3102 bp, 1033 aa] {ON...   117   1e-25
CAGL0H06259g Chr8 (615045..619055) [4011 bp, 1336 aa] {ON} simil...   117   1e-25
SAKL0B09856g Chr2 complement(830531..834355) [3825 bp, 1274 aa] ...   117   1e-25
TPHA0C01780 Chr3 complement(407048..407965) [918 bp, 305 aa] {ON...   110   1e-25
Suva_1.50 Chr1 (96474..100556) [4083 bp, 1360 aa] {ON} YAL017W (...   117   1e-25
TPHA0A04170 Chr1 (937692..939233) [1542 bp, 513 aa] {ON} Anc_3.2...   114   1e-25
NDAI0C01700 Chr3 complement(367077..370139) [3063 bp, 1020 aa] {...   116   1e-25
KAFR0H01530 Chr8 complement(283589..284509) [921 bp, 306 aa] {ON...   110   1e-25
ZYRO0C02288g Chr3 complement(181604..184327) [2724 bp, 907 aa] {...   116   1e-25
CAGL0B02739g Chr2 complement(262590..264620) [2031 bp, 676 aa] {...   115   1e-25
TBLA0D02240 Chr4 complement(561856..566547) [4692 bp, 1563 aa] {...   117   1e-25
Kpol_183.1 s183 (158..2257) [2100 bp, 699 aa] {ON} (158..2257) [...   115   1e-25
TDEL0F00930 Chr6 complement(160181..163573) [3393 bp, 1130 aa] {...   116   1e-25
NDAI0G03030 Chr7 (704910..708269) [3360 bp, 1119 aa] {ON}             116   1e-25
KAFR0C00930 Chr3 complement(186877..189687) [2811 bp, 936 aa] {O...   116   2e-25
TPHA0P01270 Chr16 complement(254480..257137) [2658 bp, 885 aa] {...   115   2e-25
ZYRO0G15290g Chr7 complement(1237119..1241582) [4464 bp, 1487 aa...   116   2e-25
KLTH0F16676g Chr6 complement(1351362..1353998) [2637 bp, 878 aa]...   115   2e-25
Kpol_463.8 s463 complement(18696..23039) [4344 bp, 1447 aa] {ON}...   116   2e-25
Kpol_1037.52 s1037 complement(128841..130379) [1539 bp, 512 aa] ...   114   2e-25
KAFR0K00700 Chr11 complement(153981..158126) [4146 bp, 1381 aa] ...   116   2e-25
SAKL0C08844g Chr3 (811712..813307) [1596 bp, 531 aa] {ON} simila...   114   2e-25
KLLA0C00979g Chr3 (73295..74746) [1452 bp, 483 aa] {ON} similar ...   113   2e-25
KLTH0E06754g Chr5 (619163..621784) [2622 bp, 873 aa] {ON} simila...   115   2e-25
NDAI0H03460 Chr8 complement(836849..838726) [1878 bp, 625 aa] {O...   114   2e-25
NDAI0G05190 Chr7 complement(1258638..1260452) [1815 bp, 604 aa] ...   114   2e-25
NCAS0D04600 Chr4 (875553..880604) [5052 bp, 1683 aa] {ON} Anc_6....   116   2e-25
CAGL0K02167g Chr11 complement(192297..195785) [3489 bp, 1162 aa]...   115   2e-25
Skud_13.262 Chr13 complement(448758..450791) [2034 bp, 677 aa] {...   114   2e-25
ABR014W Chr2 (417708..420623) [2916 bp, 971 aa] {ON} Syntenic ho...   115   2e-25
AFR092W Chr6 (595092..599363) [4272 bp, 1423 aa] {ON} Syntenic h...   115   2e-25
Skud_14.362 Chr14 complement(648801..653540) [4740 bp, 1579 aa] ...   115   3e-25
ACR281C Chr3 complement(864528..868307) [3780 bp, 1259 aa] {ON} ...   115   3e-25
SAKL0D08294g Chr4 (692455..693966) [1512 bp, 503 aa] {ON} some s...   113   3e-25
Smik_14.360 Chr14 complement(638655..643406) [4752 bp, 1583 aa] ...   115   3e-25
Kpol_1007.17 s1007 (32671..32687,32861..33767) [924 bp, 307 aa] ...   109   3e-25
NCAS0A08770 Chr1 complement(1733181..1734890) [1710 bp, 569 aa] ...   114   3e-25
Kwal_27.9763 s27 (54483..57089) [2607 bp, 868 aa] {ON} YAR019C (...   115   3e-25
KLTH0E04334g Chr5 complement(391495..393723) [2229 bp, 742 aa] {...   114   3e-25
CAGL0M03729g Chr13 complement(420316..422901) [2586 bp, 861 aa] ...   115   3e-25
ZYRO0B07854g Chr2 complement(613992..616007) [2016 bp, 671 aa] {...   114   3e-25
CAGL0L11550g Chr12 (1232015..1235233) [3219 bp, 1072 aa] {ON} si...   115   3e-25
KNAG0C06060 Chr3 (1183766..1186654) [2889 bp, 962 aa] {ON} Anc_5...   115   3e-25
Smik_14.34 Chr14 (53272..55788) [2517 bp, 838 aa] {ON} YNL298W (...   114   3e-25
NCAS0A09470 Chr1 complement(1883183..1887730) [4548 bp, 1515 aa]...   115   4e-25
AEL185C Chr5 complement(291129..292676) [1548 bp, 515 aa] {ON} S...   112   4e-25
TPHA0O00670 Chr15 (125331..127088) [1758 bp, 585 aa] {ON} Anc_1....   113   4e-25
NCAS0C04100 Chr3 (834997..837714) [2718 bp, 905 aa] {ON} Anc_8.141    114   4e-25
SAKL0G01848g Chr7 (154547..157204) [2658 bp, 885 aa] {ON} weakly...   114   4e-25
KLTH0B09042g Chr2 (736520..738112) [1593 bp, 530 aa] {ON} simila...   112   4e-25
KLTH0G05214g Chr7 (423793..425754) [1962 bp, 653 aa] {ON} weakly...   114   4e-25
KNAG0K01240 Chr11 (243154..246096) [2943 bp, 980 aa] {ON} Anc_3....   114   4e-25
KLTH0E16126g Chr5 complement(1427208..1429814) [2607 bp, 868 aa]...   114   4e-25
Skud_10.119 Chr10 (215299..219744) [4446 bp, 1481 aa] {ON} YJL09...   115   5e-25
Kwal_55.21545 s55 complement(882294..884891) [2598 bp, 865 aa] {...   114   5e-25
Kwal_47.17252 s47 (318148..320766) [2619 bp, 872 aa] {ON} YGL180...   114   5e-25
KAFR0A08360 Chr1 complement(1677561..1680050) [2490 bp, 829 aa] ...   114   5e-25
YGL179C Chr7 complement(163409..165091) [1683 bp, 560 aa] {ON}  ...   112   5e-25
KLLA0C14278g Chr3 (1240990..1242615) [1626 bp, 541 aa] {ON} simi...   112   5e-25
SAKL0C12386g Chr3 complement(1108341..1110923) [2583 bp, 860 aa]...   114   5e-25
NDAI0G03450 Chr7 (822716..825562) [2847 bp, 948 aa] {ON} Anc_8.141    114   6e-25
NCAS0C02470 Chr3 complement(460460..461378,461483..461499) [936 ...   108   6e-25
ZYRO0D05500g Chr4 (473262..477050) [3789 bp, 1262 aa] {ON} weakl...   114   6e-25
KLTH0H11858g Chr8 (1013677..1015374) [1698 bp, 565 aa] {ON} some...   112   6e-25
Ecym_3547 Chr3 complement(1034494..1036107) [1614 bp, 537 aa] {O...   112   6e-25
Suva_7.82 Chr7 (156049..158751) [2703 bp, 900 aa] {ON} YGL180W (...   114   6e-25
ABL055C Chr2 complement(295495..297105) [1611 bp, 536 aa] {ON} S...   112   6e-25
CAGL0K11550g Chr11 (1118971..1120587) [1617 bp, 538 aa] {ON} sim...   112   7e-25
Kwal_23.5290 s23 complement(1095011..1097470) [2460 bp, 819 aa] ...   114   7e-25
TDEL0B01540 Chr2 complement(272561..273458,273562..273578) [915 ...   108   7e-25
Kpol_2001.30 s2001 (87817..90093) [2277 bp, 758 aa] {ON} (87817....   113   7e-25
ZYRO0F08074g Chr6 (654009..654025,654107..655004) [915 bp, 304 a...   108   8e-25
SAKL0G06402g Chr7 (535632..537986) [2355 bp, 784 aa] {ON} simila...   113   8e-25
TBLA0A04720 Chr1 (1168895..1172683) [3789 bp, 1262 aa] {ON} Anc_...   114   8e-25
ZYRO0G19074g Chr7 complement(1580648..1583413) [2766 bp, 921 aa]...   114   8e-25
KLLA0C17160g Chr3 (1498959..1501454) [2496 bp, 831 aa] {ON} simi...   113   9e-25
Smik_7.92 Chr7 (155049..157742) [2694 bp, 897 aa] {ON} YGL180W (...   113   9e-25
Suva_14.42 Chr14 (65645..68239) [2595 bp, 864 aa] {ON} YNL298W (...   113   9e-25
ZYRO0D08184g Chr4 (706856..711601) [4746 bp, 1581 aa] {ON} simil...   114   9e-25
Skud_5.249 Chr5 complement(400867..404310) [3444 bp, 1147 aa] {O...   114   1e-24
Skud_14.40 Chr14 (62496..65006) [2511 bp, 836 aa] {ON} YNL298W (...   113   1e-24
CAGL0L06006g Chr12 complement(672704..675532) [2829 bp, 942 aa] ...   113   1e-24
Kwal_14.2497 s14 complement(784224..785480) [1257 bp, 418 aa] {O...   110   1e-24
Skud_7.91 Chr7 (165681..168374) [2694 bp, 897 aa] {ON} YGL180W (...   113   1e-24
YGL180W Chr7 (160065..162758) [2694 bp, 897 aa] {ON}  ATG1Protei...   113   1e-24
TPHA0A01630 Chr1 complement(328040..329347) [1308 bp, 435 aa] {O...   110   1e-24
Suva_6.169 Chr6 complement(300200..304654) [4455 bp, 1484 aa] {O...   113   1e-24
KLTH0D02486g Chr4 (247566..251237) [3672 bp, 1223 aa] {ON} simil...   113   1e-24
KAFR0C05130 Chr3 (1018035..1019402) [1368 bp, 455 aa] {ON} Anc_7...   110   1e-24
KNAG0B04320 Chr2 complement(821265..824348) [3084 bp, 1027 aa] {...   113   2e-24
Smik_1.79 Chr1 complement(149839..152763) [2925 bp, 974 aa] {ON}...   112   2e-24
KAFR0D04950 Chr4 (971956..974982) [3027 bp, 1008 aa] {ON} Anc_5....   112   2e-24
YNL298W Chr14 (68915..71443) [2529 bp, 842 aa] {ON}  CLA4Cdc42p-...   112   2e-24
Kpol_1066.45 s1066 complement(76786..79428) [2643 bp, 880 aa] {O...   112   2e-24
Skud_15.519 Chr15 complement(932720..934216) [1497 bp, 498 aa] {...   110   2e-24
Suva_16.286 Chr16 complement(495354..496254,496351..496367) [918...   106   2e-24
KAFR0A06190 Chr1 complement(1251546..1253690) [2145 bp, 714 aa] ...   112   2e-24
Skud_2.141 Chr2 complement(264097..265677) [1581 bp, 526 aa] {ON...   110   2e-24
Smik_10.147 Chr10 (239101..243537) [4437 bp, 1478 aa] {ON} YJL09...   112   2e-24
Skud_16.251 Chr16 complement(457106..458006,458108..458124) [918...   106   2e-24
TBLA0D02230 Chr4 (557816..561280) [3465 bp, 1154 aa] {ON} Anc_8....   112   2e-24
AEL083W Chr5 (470964..472574) [1611 bp, 536 aa] {ON} Syntenic ho...   110   2e-24
Smik_15.535 Chr15 complement(940569..942050) [1482 bp, 493 aa] {...   110   2e-24
Ecym_4523 Chr4 (1039929..1042070) [2142 bp, 713 aa] {ON} similar...   111   3e-24
Ecym_5505 Chr5 (1027605..1030616) [3012 bp, 1003 aa] {ON} simila...   112   3e-24
TBLA0I01800 Chr9 complement(401728..403617) [1890 bp, 629 aa] {O...   111   3e-24
ZYRO0F13310g Chr6 (1092612..1096322) [3711 bp, 1236 aa] {ON} som...   112   3e-24
KAFR0C04590 Chr3 complement(917915..922321) [4407 bp, 1468 aa] {...   112   3e-24
ZYRO0G19052g Chr7 (1576638..1580033) [3396 bp, 1131 aa] {ON} sim...   112   3e-24
TDEL0E00690 Chr5 (144269..146770) [2502 bp, 833 aa] {ON} Anc_3.6...   111   3e-24
KLLA0A02497g Chr1 (218592..219680) [1089 bp, 362 aa] {ON} highly...   107   3e-24
Ecym_6344 Chr6 complement(664647..668840) [4194 bp, 1397 aa] {ON...   112   3e-24
KNAG0F00170 Chr6 (13778..15409) [1632 bp, 543 aa] {ON} Anc_1.24 ...   110   4e-24
Kpol_1040.20 s1040 (57057..60950) [3894 bp, 1297 aa] {ON} (57057...   112   4e-24
ABL011C Chr2 complement(378257..380362) [2106 bp, 701 aa] {ON} S...   110   4e-24
YHR102W Chr8 (316572..319814) [3243 bp, 1080 aa] {ON}  KIC1Prote...   111   4e-24
CAGL0D02244g Chr4 complement(229504..230967) [1464 bp, 487 aa] {...   109   4e-24
ADR379C Chr4 complement(1386598..1388076) [1479 bp, 492 aa] {ON}...   109   4e-24
TPHA0N00370 Chr14 (68298..69650) [1353 bp, 450 aa] {ON} Anc_7.41...   108   5e-24
ACL104C Chr3 complement(157357..160200) [2844 bp, 947 aa] {ON} S...   111   5e-24
YLR362W Chr12 (849866..852019) [2154 bp, 717 aa] {ON}  STE11Sign...   110   5e-24
Suva_2.157 Chr2 complement(275484..277064) [1581 bp, 526 aa] {ON...   109   5e-24
AAL029W Chr1 (289989..291593) [1605 bp, 534 aa] {ON} Syntenic ho...   109   5e-24
KNAG0B01780 Chr2 (326438..331180) [4743 bp, 1580 aa] {ON} Anc_1....   111   6e-24
Suva_15.297 Chr15 (518854..520850,520945..522172) [3225 bp, 1074...   111   6e-24
Suva_2.642 Chr2 (1147428..1148865,1149541..1150805) [2703 bp, 90...   110   6e-24
Kwal_33.13112 s33 (76807..78324) [1518 bp, 505 aa] {ON} YDR523C ...   108   6e-24
YAR019C Chr1 complement(172211..175135) [2925 bp, 974 aa] {ON}  ...   110   6e-24
Kwal_27.11803 s27 (952938..953678) [741 bp, 246 aa] {ON} YPL031C...   103   6e-24
Suva_10.464 Chr10 (809505..811721) [2217 bp, 738 aa] {ON} YLR362...   110   6e-24
NDAI0A06130 Chr1 complement(1391744..1394203) [2460 bp, 819 aa] ...   110   7e-24
NDAI0K01480 Chr11 complement(337108..338706) [1599 bp, 532 aa] {...   108   7e-24
TDEL0D01400 Chr4 (269367..273656) [4290 bp, 1429 aa] {ON} Anc_1....   111   7e-24
TDEL0B04700 Chr2 (834336..836996) [2661 bp, 886 aa] {ON} Anc_8.1...   110   7e-24
Kwal_26.7682 s26 complement(470565..472121) [1557 bp, 518 aa] {O...   108   7e-24
TPHA0B01010 Chr2 complement(229538..231634) [2097 bp, 698 aa] {O...   110   8e-24
Skud_2.4 Chr2 complement(4805..8260) [3456 bp, 1151 aa] {ON} YBL...   110   8e-24
Suva_8.405 Chr8 complement(730738..732348) [1611 bp, 536 aa] {ON...   108   8e-24
Ecym_4652 Chr4 (1272725..1276156) [3432 bp, 1143 aa] {ON} simila...   110   8e-24
TBLA0C01320 Chr3 complement(289223..290626) [1404 bp, 467 aa] {O...   108   8e-24
TBLA0E02790 Chr5 complement(693136..695562) [2427 bp, 808 aa] {O...   110   9e-24
KNAG0D02140 Chr4 complement(362745..365357) [2613 bp, 870 aa] {O...   110   9e-24
TDEL0C03050 Chr3 (545862..549299) [3438 bp, 1145 aa] {ON} Anc_7....   110   9e-24
TDEL0E01820 Chr5 complement(348423..349403) [981 bp, 326 aa] {ON...   105   9e-24
Kpol_1031.10 s1031 (25064..28447) [3384 bp, 1127 aa] {ON} (25064...   110   9e-24
NCAS0I02850 Chr9 (529637..532042) [2406 bp, 801 aa] {ON} Anc_1.180    110   1e-23
Skud_12.329 Chr12 (580813..582645) [1833 bp, 610 aa] {ON} YLR248...   109   1e-23
Kpol_541.48 s541 (152877..153692,153695..156046) [3168 bp, 1055 ...   110   1e-23
KAFR0A05090 Chr1 (1011918..1013924) [2007 bp, 668 aa] {ON}            109   1e-23
TBLA0A03570 Chr1 (892930..895857) [2928 bp, 975 aa] {ON} Anc_5.4...   110   1e-23
ACR191C Chr3 complement(680398..683847) [3450 bp, 1149 aa] {ON} ...   110   1e-23
NDAI0A08560 Chr1 complement(1969778..1973731) [3954 bp, 1317 aa]...   110   1e-23
KNAG0C02430 Chr3 complement(472213..474804) [2592 bp, 863 aa] {O...   110   1e-23
KLTH0F04730g Chr6 complement(417013..419133) [2121 bp, 706 aa] {...   109   1e-23
Suva_15.124 Chr15 (215781..219101) [3321 bp, 1106 aa] {ON} YOL04...   110   1e-23
NCAS0A09960 Chr1 complement(1993554..1995926) [2373 bp, 790 aa] ...   109   1e-23
Smik_12.450 Chr12 (788896..791106) [2211 bp, 736 aa] {ON} YLR362...   109   1e-23
YPL031C Chr16 complement(492018..492918,493021..493037) [918 bp,...   104   1e-23
Smik_12.321 Chr12 (579087..580919) [1833 bp, 610 aa] {ON} YLR248...   108   1e-23
Ecym_3525 Chr3 (993328..995784) [2457 bp, 818 aa] {ON} similar t...   109   1e-23
TDEL0E02180 Chr5 complement(408232..411195) [2964 bp, 987 aa] {O...   109   1e-23
NCAS0H01940 Chr8 (374913..377960) [3048 bp, 1015 aa] {ON} Anc_5....   109   2e-23
Smik_15.122 Chr15 (209665..212970) [3306 bp, 1101 aa] {ON} YOL04...   109   2e-23
YKL116C Chr11 complement(221344..222900) [1557 bp, 518 aa] {ON} ...   107   2e-23
Suva_6.246 Chr6 (439815..442373) [2559 bp, 852 aa] {ON} YJL165C ...   109   2e-23
Kpol_1072.31 s1072 complement(67104..68684) [1581 bp, 526 aa] {O...   107   2e-23
Smik_10.65 Chr10 complement(104987..107545) [2559 bp, 852 aa] {O...   109   2e-23
TPHA0L00500 Chr12 (83710..86589) [2880 bp, 959 aa] {ON} Anc_7.86...   109   2e-23
NCAS0A04440 Chr1 complement(895181..896935) [1755 bp, 584 aa] {O...   108   2e-23
SAKL0C07722g Chr3 (717419..720157) [2739 bp, 912 aa] {ON} simila...   109   2e-23
TPHA0C04650 Chr3 complement(1006190..1007119) [930 bp, 309 aa] {...   103   2e-23
Skud_12.447 Chr12 (790003..792210) [2208 bp, 735 aa] {ON} YLR362...   108   2e-23
Smik_8.180 Chr8 (292993..296214) [3222 bp, 1073 aa] {ON} YHR102W...   109   2e-23
Skud_10.49 Chr10 complement(81651..84206) [2556 bp, 851 aa] {ON}...   108   2e-23
YOR351C Chr15 complement(995018..996511) [1494 bp, 497 aa] {ON} ...   107   2e-23
Ecym_2640 Chr2 complement(1232617..1236594) [3978 bp, 1325 aa] {...   109   2e-23
Smik_2.146 Chr2 complement(275270..276850) [1581 bp, 526 aa] {ON...   107   2e-23
AGL242C Chr7 complement(246896..247790,247838..247854) [912 bp, ...   103   2e-23
Suva_2.11 Chr2 complement(17473..18858) [1386 bp, 461 aa] {ON} Y...   106   2e-23
YDR466W Chr4 (1395121..1397817) [2697 bp, 898 aa] {ON}  PKH3Prot...   108   2e-23
Skud_8.163 Chr8 (290415..293645) [3231 bp, 1076 aa] {ON} YHR102W...   109   2e-23
TDEL0A04580 Chr1 (816247..818331) [2085 bp, 694 aa] {ON} Anc_5.5...   108   2e-23
NCAS0B08300 Chr2 (1582859..1584796) [1938 bp, 645 aa] {ON} Anc_1...   108   3e-23
AEL205W Chr5 (246871..249252) [2382 bp, 793 aa] {ON} Syntenic ho...   108   3e-23
Kpol_1000.14 s1000 complement(36018..38015) [1998 bp, 665 aa] {O...   108   3e-23
YOL045W Chr15 (243497..246802) [3306 bp, 1101 aa] {ON}  PSK2One ...   108   3e-23
Ecym_7414 Chr7 (848665..850440) [1776 bp, 591 aa] {ON} similar t...   107   3e-23
TBLA0H01660 Chr8 complement(377521..380511) [2991 bp, 996 aa] {O...   108   3e-23
SAKL0F13618g Chr6 (1085967..1089494) [3528 bp, 1175 aa] {ON} sim...   108   3e-23
KAFR0C03010 Chr3 (598970..601342) [2373 bp, 790 aa] {ON} Anc_8.1...   108   3e-23
KLLA0D11990g Chr4 complement(1022895..1023792,1023928..1023944) ...   103   3e-23
YBL105C Chr2 complement(14241..17696) [3456 bp, 1151 aa] {ON}  P...   108   3e-23
Suva_11.108 Chr11 complement(207520..209070) [1551 bp, 516 aa] {...   107   3e-23
Skud_11.113 Chr11 complement(207796..209355) [1560 bp, 519 aa] {...   107   3e-23
SAKL0C00946g Chr3 (84995..86689) [1695 bp, 564 aa] {ON} similar ...   107   3e-23
YBR028C Chr2 complement(294425..296002) [1578 bp, 525 aa] {ON}  ...   107   3e-23
NCAS0I00470 Chr9 (74336..77584) [3249 bp, 1082 aa] {ON} Anc_7.86      108   4e-23
KLLA0E06447g Chr5 complement(577669..581154) [3486 bp, 1161 aa] ...   108   4e-23
KLLA0E21693g Chr5 complement(1936438..1939488) [3051 bp, 1016 aa...   108   4e-23
YLR248W Chr12 (634252..636084) [1833 bp, 610 aa] {ON}  RCK2Prote...   107   4e-23
KLLA0A07403g Chr1 (661261..663900) [2640 bp, 879 aa] {ON} simila...   108   5e-23
TPHA0H00420 Chr8 complement(82575..85691) [3117 bp, 1038 aa] {ON...   108   5e-23
Smik_2.13 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   108   5e-23
Smik_2.14 Chr2 complement(14021..17473) [3453 bp, 1150 aa] {ON} ...   108   5e-23
ACL054W Chr3 (269703..272621) [2919 bp, 972 aa] {ON} Syntenic ho...   107   5e-23
TPHA0B01520 Chr2 complement(336164..339616) [3453 bp, 1150 aa] {...   108   6e-23
KNAG0I00590 Chr9 (100275..102068) [1794 bp, 597 aa] {ON}              106   7e-23
TBLA0F01550 Chr6 complement(385184..386716) [1533 bp, 510 aa] {O...   105   7e-23
KNAG0K02370 Chr11 complement(475088..477739) [2652 bp, 883 aa] {...   107   7e-23
TDEL0C03740 Chr3 (658468..660702) [2235 bp, 744 aa] {ON} Anc_1.1...   107   7e-23
NCAS0E03010 Chr5 (599358..602810) [3453 bp, 1150 aa] {ON} Anc_7....   107   7e-23
ZYRO0A06446g Chr1 complement(513126..515957) [2832 bp, 943 aa] {...   107   7e-23
NDAI0E03170 Chr5 complement(677441..678392,678524..678543) [972 ...   102   7e-23
KNAG0A06390 Chr1 complement(974644..976254) [1611 bp, 536 aa] {O...   105   7e-23
AGR334W Chr7 (1355098..1356693) [1596 bp, 531 aa] {ON} Syntenic ...   105   7e-23
NCAS0A02180 Chr1 (410419..411489) [1071 bp, 356 aa] {ON} Anc_4.192    103   8e-23
Smik_4.128 Chr4 (244339..244354,244439..245331) [909 bp, 302 aa]...   102   8e-23
KLTH0E11924g Chr5 (1059134..1060030) [897 bp, 298 aa] {ON} highl...   102   8e-23
TBLA0E04970 Chr5 (1272310..1273944) [1635 bp, 544 aa] {ON} Anc_4...   105   8e-23
Ecym_6145 Chr6 complement(266766..267863) [1098 bp, 365 aa] {ON}...   103   8e-23
NDAI0B00220 Chr2 (29825..32470) [2646 bp, 881 aa] {ON} Anc_1.180      107   9e-23
ZYRO0C06776g Chr3 complement(508813..511485) [2673 bp, 890 aa] {...   107   1e-22
Smik_5.275 Chr5 (426176..429601) [3426 bp, 1141 aa] {ON} YER129W...   107   1e-22
KAFR0A03710 Chr1 (758918..760399) [1482 bp, 493 aa] {ON} Anc_8.6...   105   1e-22
NDAI0B02500 Chr2 (625206..629036) [3831 bp, 1276 aa] {ON} Anc_8....   107   1e-22
Smik_11.125 Chr11 complement(208208..209764) [1557 bp, 518 aa] {...   105   1e-22
NDAI0A00940 Chr1 complement(193710..195800) [2091 bp, 696 aa] {O...   106   1e-22
Kwal_27.10004 s27 complement(156153..158360) [2208 bp, 735 aa] {...   106   1e-22
Suva_5.250 Chr5 (392904..396323) [3420 bp, 1139 aa] {ON} YER129W...   107   1e-22
NCAS0A07990 Chr1 complement(1578473..1581346) [2874 bp, 957 aa] ...   106   1e-22
Suva_10.345 Chr10 (601536..603365) [1830 bp, 609 aa] {ON} YLR248...   105   1e-22
CAGL0M09361g Chr13 complement(928484..931918) [3435 bp, 1144 aa]...   107   1e-22
Skud_4.742 Chr4 (1315170..1317881) [2712 bp, 903 aa] {ON} YDR466...   106   1e-22
YJL165C Chr10 complement(106894..109461) [2568 bp, 855 aa] {ON} ...   106   1e-22
KNAG0B05880 Chr2 (1155395..1157695) [2301 bp, 766 aa] {ON} Anc_4...   106   1e-22
TPHA0A02770 Chr1 complement(597703..600129) [2427 bp, 808 aa] {O...   106   1e-22
Ecym_2531 Chr2 (1034031..1034047,1034135..1035023) [906 bp, 301 ...   101   1e-22
Kpol_520.17 s520 complement(37953..41447) [3495 bp, 1164 aa] {ON...   106   1e-22
TPHA0M00300 Chr13 (59377..61701) [2325 bp, 774 aa] {ON} Anc_3.16...   106   1e-22
TBLA0A01630 Chr1 complement(385348..386386,386496..386512) [1056...   102   1e-22
Skud_4.146 Chr4 (263181..263196,263281..264173) [909 bp, 302 aa]...   101   2e-22
Skud_15.112 Chr15 (202308..205613) [3306 bp, 1101 aa] {ON} YOL04...   106   2e-22
Kwal_33.13831 s33 complement(413256..415358) [2103 bp, 700 aa] {...   105   2e-22
CAGL0I06248g Chr9 (600351..602792) [2442 bp, 813 aa] {ON} simila...   106   2e-22
NDAI0E04610 Chr5 (1042690..1046154) [3465 bp, 1154 aa] {ON} Anc_...   106   2e-22
KLTH0C05478g Chr3 complement(471760..475254) [3495 bp, 1164 aa] ...   106   2e-22
Kwal_47.18307 s47 complement(776521..778386) [1866 bp, 621 aa] {...   105   2e-22
KLTH0D05082g Chr4 complement(457124..458680) [1557 bp, 518 aa] {...   104   2e-22
KNAG0A03060 Chr1 complement(375640..377142) [1503 bp, 500 aa] {O...   103   2e-22
NCAS0I02060 Chr9 (386630..388573) [1944 bp, 647 aa] {ON} Anc_3.1...   105   3e-22
YDL108W Chr4 (267698..267725,267807..268699) [921 bp, 306 aa] {O...   100   3e-22
NCAS0B04580 Chr2 (831695..835255) [3561 bp, 1186 aa] {ON} Anc_8....   105   3e-22
Ecym_6196 Chr6 (364576..365652) [1077 bp, 358 aa] {ON} similar t...   101   3e-22
KNAG0F02900 Chr6 (549477..551426) [1950 bp, 649 aa] {ON}              104   3e-22
KNAG0C04310 Chr3 complement(842994..846503) [3510 bp, 1169 aa] {...   105   3e-22
TPHA0L01240 Chr12 (263357..264814) [1458 bp, 485 aa] {ON} Anc_8....   103   3e-22
KAFR0F01790 Chr6 complement(347491..349884) [2394 bp, 797 aa] {O...   105   3e-22
KAFR0E01580 Chr5 (318991..320280) [1290 bp, 429 aa] {ON} Anc_5.2...   102   3e-22
Suva_16.170 Chr16 complement(296877..298406) [1530 bp, 509 aa] {...   103   3e-22
NDAI0E01310 Chr5 complement(260484..262094) [1611 bp, 536 aa] {O...   103   4e-22
Ecym_1030 Chr1 (56043..57365) [1323 bp, 440 aa] {ON} similar to ...   102   4e-22
AFR019W Chr6 (471481..472560) [1080 bp, 359 aa] {ON} Syntenic ho...   101   4e-22
TBLA0I00910 Chr9 complement(170526..173945) [3420 bp, 1139 aa] {...   105   4e-22
TDEL0A02330 Chr1 complement(420205..421662) [1458 bp, 485 aa] {O...   103   4e-22
Smik_16.204 Chr16 complement(369272..370021) [750 bp, 249 aa] {O...    99   4e-22
Kwal_14.1273 s14 complement(259953..261200) [1248 bp, 415 aa] {O...   102   4e-22
Kwal_27.10581 s27 complement(403249..406713) [3465 bp, 1154 aa] ...   105   4e-22
KLTH0G18194g Chr7 (1570885..1572132) [1248 bp, 415 aa] {ON} weak...   102   5e-22
KAFR0G01080 Chr7 complement(243965..247417) [3453 bp, 1150 aa] {...   105   5e-22
KNAG0A05580 Chr1 (830643..831560) [918 bp, 305 aa] {ON} Anc_2.33...   100   5e-22
Kpol_1031.67 s1031 (174170..175663) [1494 bp, 497 aa] {ON} (1741...   102   6e-22
CAGL0G05720g Chr7 complement(547617..549833) [2217 bp, 738 aa] {...   104   6e-22
YER129W Chr5 (417281..420709) [3429 bp, 1142 aa] {ON}  SAK1Upstr...   104   6e-22
Suva_15.46 Chr15 (81948..83909) [1962 bp, 653 aa] {ON} YOL113W (...   103   6e-22
ZYRO0G02816g Chr7 complement(213421..214980) [1560 bp, 519 aa] {...   102   6e-22
Kpol_1033.63 s1033 complement(158652..160205) [1554 bp, 517 aa] ...   102   7e-22
KLTH0H08316g Chr8 (730027..731094) [1068 bp, 355 aa] {ON} simila...   100   7e-22
NDAI0H01020 Chr8 complement(225366..228566) [3201 bp, 1066 aa] {...   104   7e-22
YPL140C Chr16 complement(287514..289034) [1521 bp, 506 aa] {ON} ...   102   7e-22
TBLA0F00860 Chr6 (219628..222570) [2943 bp, 980 aa] {ON} Anc_3.1...   104   7e-22
Smik_4.745 Chr4 (1316457..1319201) [2745 bp, 914 aa] {ON} YDR466...   104   7e-22
KLLA0A06820g Chr1 complement(615686..618004) [2319 bp, 772 aa] {...   103   7e-22
NCAS0B01450 Chr2 (237824..239341) [1518 bp, 505 aa] {ON} Anc_8.652    102   9e-22
AEL284C Chr5 complement(106480..107919) [1440 bp, 479 aa] {ON} S...   102   9e-22
AEL118C Chr5 complement(399738..401789) [2052 bp, 683 aa] {ON} S...   103   9e-22
KLTH0F00946g Chr6 (73412..74950) [1539 bp, 512 aa] {ON} similar ...   102   1e-21
TBLA0I01310 Chr9 (279407..281245) [1839 bp, 612 aa] {ON} Anc_2.4...   102   1e-21
Smik_11.60 Chr11 complement(116793..118970) [2178 bp, 725 aa] {O...   103   1e-21
Ecym_5251 Chr5 (522785..525466) [2682 bp, 893 aa] {ON} similar t...   103   1e-21
Smik_11.97 Chr11 (168854..170491) [1638 bp, 545 aa] {ON} YKL139W...   102   1e-21
Ecym_8400 Chr8 complement(825315..828515) [3201 bp, 1066 aa] {ON...   103   1e-21
KNAG0G01240 Chr7 (277868..280597) [2730 bp, 909 aa] {ON} Anc_8.1...   103   1e-21
NCAS0B02350 Chr2 complement(394128..395018) [891 bp, 296 aa] {ON...    98   1e-21
AER223C Chr5 complement(1044971..1047679) [2709 bp, 902 aa] {ON}...   103   2e-21
SAKL0C07348g Chr3 (677348..679933) [2586 bp, 861 aa] {ON} some s...   103   2e-21
SAKL0C05280g Chr3 complement(502205..504490) [2286 bp, 761 aa] {...   102   2e-21
NDAI0C05340 Chr3 (1236394..1237296) [903 bp, 300 aa] {ON}              98   2e-21
AFR724C Chr6 complement(1770338..1771660) [1323 bp, 440 aa] {ON}...   100   2e-21
Ecym_8098 Chr8 (210698..212857) [2160 bp, 719 aa] {ON} similar t...   102   2e-21
KAFR0K02490 Chr11 (515669..518356) [2688 bp, 895 aa] {ON} Anc_5....   102   2e-21
Smik_6.338 Chr6 (535192..536727) [1536 bp, 511 aa] {ON} YPL140C ...   100   2e-21
Suva_4.138 Chr4 (256421..257197) [777 bp, 258 aa] {ON} YDL108W (...    97   3e-21
Ecym_4647 Chr4 (1261859..1263511) [1653 bp, 550 aa] {ON} similar...   101   3e-21
ZYRO0D07502g Chr4 complement(652782..654320) [1539 bp, 512 aa] {...   100   3e-21
Kpol_1002.111 s1002 (277615..278664) [1050 bp, 349 aa] {ON} (277...    98   3e-21
Skud_16.141 Chr16 complement(259166..260707) [1542 bp, 513 aa] {...   100   3e-21
CAGL0K04301g Chr11 (405248..406315) [1068 bp, 355 aa] {ON} simil...    98   3e-21
KLLA0C04213g Chr3 (386815..387999) [1185 bp, 394 aa] {ON} simila...    99   4e-21
KLTH0C02662g Chr3 complement(240347..242674) [2328 bp, 775 aa] {...   101   4e-21
CAGL0I05390g Chr9 complement(508677..510041) [1365 bp, 454 aa] {...   100   4e-21
KAFR0G00460 Chr7 complement(128077..130023) [1947 bp, 648 aa] {O...   101   4e-21
TBLA0F00820 Chr6 (209607..211844) [2238 bp, 745 aa] {ON} Anc_3.1...   101   4e-21
NCAS0D00710 Chr4 (122875..124737) [1863 bp, 620 aa] {ON}              100   4e-21
KLTH0F06468g Chr6 (559256..561769) [2514 bp, 837 aa] {ON} simila...   101   4e-21
NCAS0F02190 Chr6 complement(435844..437706) [1863 bp, 620 aa] {O...   100   4e-21
NCAS0B06000 Chr2 complement(1134919..1135808,1135909..1135957) [...    97   5e-21
Kwal_23.5668 s23 (1263868..1268937) [5070 bp, 1689 aa] {ON} YDR2...   102   5e-21
Skud_4.225 Chr4 complement(400160..401992) [1833 bp, 610 aa] {ON...   100   5e-21
KAFR0E03030 Chr5 (606567..607457) [891 bp, 296 aa] {ON} Anc_8.51...    97   5e-21
KAFR0C03020 Chr3 complement(601565..603121) [1557 bp, 518 aa] {O...   100   5e-21
TBLA0B09590 Chr2 (2272405..2273328) [924 bp, 307 aa] {ON} Anc_2....    97   5e-21
SAKL0H07128g Chr8 complement(623681..625141) [1461 bp, 486 aa] {...   100   5e-21
Ecym_6301 Chr6 complement(566248..567324) [1077 bp, 358 aa] {ON}...    98   5e-21
Kwal_YGOB_27.11919 s27 (1003201..1003830,1004866..1005135) [900 ...    97   6e-21
CAGL0K06479g Chr11 (637125..640100) [2976 bp, 991 aa] {ON} some ...   101   6e-21
TDEL0A05980 Chr1 (1049221..1050771) [1551 bp, 516 aa] {ON} Anc_8...   100   6e-21
SAKL0C12870g Chr3 (1145051..1146142) [1092 bp, 363 aa] {ON} high...    98   6e-21
Skud_11.88 Chr11 (169115..170659) [1545 bp, 514 aa] {ON} YKL139W...   100   6e-21
Kwal_55.22001 s55 (1069907..1070998) [1092 bp, 363 aa] {ON} YNL3...    98   6e-21
NCAS0I02080 Chr9 (390551..392875) [2325 bp, 774 aa] {ON} Anc_3.162    100   6e-21
Smik_15.39 Chr15 (72332..74314) [1983 bp, 660 aa] {ON} YOL113W (...   100   7e-21
YKL139W Chr11 (182958..184544) [1587 bp, 528 aa] {ON}  CTK1Catal...   100   7e-21
KLLA0B09790g Chr2 complement(855327..856214) [888 bp, 295 aa] {O...    96   7e-21
KAFR0B04630 Chr2 (964764..966302) [1539 bp, 512 aa] {ON} Anc_1.3...    99   8e-21
SAKL0H19668g Chr8 (1736301..1737674) [1374 bp, 457 aa] {ON} high...    99   8e-21
CAGL0H07535g Chr8 (736241..737137) [897 bp, 298 aa] {ON} highly ...    96   9e-21
ACL191C Chr3 complement(26475..27572) [1098 bp, 365 aa] {ON} Syn...    97   9e-21
Suva_14.158 Chr14 complement(289281..291650) [2370 bp, 789 aa] {...   100   9e-21
ZYRO0B04906g Chr2 (395546..398089) [2544 bp, 847 aa] {ON} simila...   100   9e-21
Kwal_27.11919 s27 (1003201..1003827) [627 bp, 209 aa] {OFF} YBR1...    94   9e-21
NDAI0A06630 Chr1 complement(1514165..1515943) [1779 bp, 592 aa] ...   100   1e-20
Kwal_17.2687 s17 complement(6084..7172) [1089 bp, 362 aa] {ON} Y...    97   1e-20
TBLA0B03990 Chr2 complement(910314..912455) [2142 bp, 713 aa] {O...   100   1e-20
CAGL0K01661g Chr11 complement(147781..149229) [1449 bp, 482 aa] ...    99   1e-20
TDEL0D04560 Chr4 (835822..837885) [2064 bp, 687 aa] {ON} Anc_3.1...   100   1e-20
TPHA0G02990 Chr7 complement(640488..642098) [1611 bp, 536 aa] {O...    99   1e-20
AFR205C Chr6 complement(805580..806953) [1374 bp, 457 aa] {ON} S...    98   1e-20
YMR291W Chr13 (852630..854390) [1761 bp, 586 aa] {ON}  TDA1Prote...    99   1e-20
TDEL0G00630 Chr7 complement(128151..129764) [1614 bp, 537 aa] {O...    99   1e-20
YOL113W Chr15 (104326..106293) [1968 bp, 655 aa] {ON}  SKM1Membe...   100   1e-20
ZYRO0C13156g Chr3 complement(1041022..1042068) [1047 bp, 348 aa]...    97   1e-20
ZYRO0F06798g Chr6 (558198..559676) [1479 bp, 492 aa] {ON} simila...    99   1e-20
KAFR0A06790 Chr1 complement(1371892..1372806) [915 bp, 304 aa] {...    96   1e-20
KLTH0F18942g Chr6 (1535941..1537032) [1092 bp, 363 aa] {ON} high...    97   1e-20
NCAS0E01150 Chr5 complement(217594..219315) [1722 bp, 573 aa] {O...    99   1e-20
TDEL0A02010 Chr1 (365325..366782) [1458 bp, 485 aa] {ON} Anc_2.4...    98   2e-20
TBLA0F02350 Chr6 complement(578797..580467) [1671 bp, 556 aa] {O...    99   2e-20
YKL168C Chr11 complement(131288..133462) [2175 bp, 724 aa] {ON} ...    99   2e-20
YDL028C Chr4 complement(400997..403291) [2295 bp, 764 aa] {ON}  ...    99   2e-20
ADR317C Chr4 complement(1263080..1265539) [2460 bp, 819 aa] {ON}...   100   2e-20
TBLA0A01660 Chr1 complement(391368..392828) [1461 bp, 486 aa] {O...    98   2e-20
Smik_4.207 Chr4 complement(381159..383456) [2298 bp, 765 aa] {ON...    99   2e-20
SAKL0H10758g Chr8 complement(930403..931302) [900 bp, 299 aa] {O...    95   2e-20
Skud_13.465 Chr13 (826172..827929) [1758 bp, 585 aa] {ON} YMR291...    99   2e-20
Skud_4.97 Chr4 (168099..169670) [1572 bp, 523 aa] {ON} YDL159W (...    98   2e-20
ZYRO0G18546g Chr7 (1530693..1533050) [2358 bp, 785 aa] {ON} simi...    99   2e-20
SAKL0B11044g Chr2 complement(962142..962940,963019..963086,96315...    98   2e-20
NDAI0E03760 Chr5 (817014..818765) [1752 bp, 583 aa] {ON} Anc_7.41      99   2e-20
Skud_4.223 Chr4 complement(395836..398145) [2310 bp, 769 aa] {ON...    99   2e-20
KLLA0C03938g Chr3 complement(358851..360632) [1782 bp, 593 aa] {...    99   2e-20
TPHA0F03520 Chr6 (755480..757756) [2277 bp, 758 aa] {ON} Anc_1.5...    99   3e-20
Suva_1.86 Chr1 complement(150761..153685) [2925 bp, 974 aa] {ON}...    99   3e-20
Kwal_33.14167 s33 (554863..557379) [2517 bp, 838 aa] {ON} YDL028...    99   3e-20
TBLA0A08430 Chr1 complement(2075682..2076773) [1092 bp, 363 aa] ...    96   3e-20
Kpol_1055.25 s1055 complement(62930..67933) [5004 bp, 1667 aa] {...   100   3e-20
Suva_11.54 Chr11 complement(116221..118401) [2181 bp, 726 aa] {O...    99   3e-20
Ecym_3371 Chr3 (706573..706597,706675..707570) [921 bp, 306 aa] ...    95   3e-20
NCAS0C01580 Chr3 (291554..292873) [1320 bp, 439 aa] {ON} Anc_8.652     97   3e-20
Suva_13.481 Chr13 (834531..836279) [1749 bp, 582 aa] {ON} YMR291...    98   3e-20
Kpol_530.41 s530 (94710..96326) [1617 bp, 538 aa] {ON} (94710..9...    97   4e-20
Suva_4.223 Chr4 complement(395869..397719) [1851 bp, 616 aa] {ON...    98   4e-20
KLTH0B07106g Chr2 (571005..573260) [2256 bp, 751 aa] {ON} simila...    98   4e-20
Suva_11.86 Chr11 (169096..170685) [1590 bp, 529 aa] {ON} YKL139W...    97   4e-20
Suva_2.105 Chr2 (186428..187489) [1062 bp, 353 aa] {ON} YBL016W ...    95   4e-20
Kpol_513.7 s513 (14160..15050) [891 bp, 296 aa] {ON} (14160..150...    94   4e-20
Smik_13.507 Chr13 (835298..837058) [1761 bp, 586 aa] {ON} YMR291...    97   5e-20
TPHA0L01470 Chr12 (303604..304497) [894 bp, 297 aa] {ON} Anc_8.5...    94   5e-20
KLLA0D08415g Chr4 (714473..716797) [2325 bp, 774 aa] {ON} simila...    98   5e-20
ACR196C Chr3 complement(692321..693913) [1593 bp, 530 aa] {ON} S...    97   5e-20
ADR058C Chr4 complement(810939..811826) [888 bp, 295 aa] {ON} Sy...    94   5e-20
Suva_4.411 Chr4 (729465..730361) [897 bp, 298 aa] {ON} YBR160W (...    94   5e-20
SAKL0H01364g Chr8 complement(143450..145141) [1692 bp, 563 aa] {...    97   5e-20
Kwal_26.7552 s26 (416444..417829) [1386 bp, 461 aa] {ON} YKL139W...    96   5e-20
KAFR0F00380 Chr6 complement(91358..92800) [1443 bp, 480 aa] {ON}...    97   5e-20
NCAS0C02510 Chr3 complement(468113..469390) [1278 bp, 425 aa] {O...    96   5e-20
ZYRO0G20306g Chr7 complement(1675578..1677227) [1650 bp, 549 aa]...    97   6e-20
TPHA0C02880 Chr3 (623723..624778) [1056 bp, 351 aa] {ON} Anc_8.1...    95   6e-20
KAFR0C02840 Chr3 (559821..560873) [1053 bp, 350 aa] {ON} Anc_8.1...    95   6e-20
NDAI0A06620 Chr1 complement(1510218..1512461) [2244 bp, 747 aa] ...    98   6e-20
SAKL0H11748g Chr8 complement(1002207..1003541) [1335 bp, 444 aa]...    96   6e-20
CAGL0H10318g Chr8 complement(1006299..1007222) [924 bp, 307 aa] ...    94   6e-20
Smik_2.300 Chr2 (546211..547107) [897 bp, 298 aa] {ON} YBR160W (...    94   6e-20
Suva_11.65 Chr11 complement(134606..136120) [1515 bp, 504 aa] {O...    97   6e-20
KLLA0E14785g Chr5 complement(1323743..1324675) [933 bp, 310 aa] ...    94   6e-20
Kwal_14.1416 s14 (315842..316939) [1098 bp, 365 aa] {ON} YGR040W...    95   6e-20
NCAS0A00280 Chr1 (40406..42013) [1608 bp, 535 aa] {ON} Anc_1.24        97   7e-20
NDAI0B02900 Chr2 complement(737651..738709) [1059 bp, 352 aa] {O...    94   7e-20
Kwal_27.11777 s27 (942591..943985) [1395 bp, 464 aa] {ON} YPL026...    96   7e-20
Smik_4.79 Chr4 (149246..150796) [1551 bp, 516 aa] {ON} YDL159W (...    97   7e-20
KLTH0G06468g Chr7 complement(513119..518251) [5133 bp, 1710 aa] ...    98   7e-20
Kpol_1045.46 s1045 complement(106567..108372) [1806 bp, 601 aa] ...    97   7e-20
TBLA0A08810 Chr1 (2161249..2162304) [1056 bp, 351 aa] {ON} Anc_8...    94   7e-20
Skud_2.287 Chr2 (527443..528339) [897 bp, 298 aa] {ON} YBR160W (...    93   7e-20
Kpol_534.14 s534 (34465..34591,34724..35616) [1020 bp, 339 aa] {...    94   7e-20
ZYRO0F12122g Chr6 complement(984069..985910) [1842 bp, 613 aa] {...    97   8e-20
Ecym_6136 Chr6 complement(248721..250187) [1467 bp, 488 aa] {ON}...    96   8e-20
Kpol_529.18 s529 (52782..55118) [2337 bp, 778 aa] {ON} (52782..5...    97   9e-20
Kwal_26.8703 s26 (905007..906341) [1335 bp, 444 aa] {ON} YOR231W...    96   9e-20
SAKL0E04092g Chr5 complement(326532..327901,327970..327982) [138...    96   1e-19
KLTH0G17512g Chr7 complement(1518329..1519426) [1098 bp, 365 aa]...    94   1e-19
YDL159W Chr4 (172481..174028) [1548 bp, 515 aa] {ON}  STE7Signal...    96   1e-19
YDR283C Chr4 complement(1025070..1030049) [4980 bp, 1659 aa] {ON...    98   1e-19
TPHA0D03940 Chr4 (825250..826989) [1740 bp, 579 aa] {ON} Anc_3.4...    96   1e-19
CAGL0J03828g Chr10 (365325..366728) [1404 bp, 467 aa] {ON} simil...    96   1e-19
YBR160W Chr2 (560078..560974) [897 bp, 298 aa] {ON}  CDC28Cataly...    93   1e-19
TDEL0B01250 Chr2 complement(228145..229038) [894 bp, 297 aa] {ON...    93   1e-19
Smik_15.415 Chr15 (722292..723815) [1524 bp, 507 aa] {ON} YOR231...    96   1e-19
TDEL0F00840 Chr6 (144884..146875) [1992 bp, 663 aa] {ON} Anc_2.9...    97   1e-19
Skud_15.397 Chr15 (711559..713082) [1524 bp, 507 aa] {ON} YOR231...    96   1e-19
YDL025C Chr4 complement(405344..407206) [1863 bp, 620 aa] {ON}  ...    96   1e-19
SAKL0D06666g Chr4 (551260..552522) [1263 bp, 420 aa] {ON} some s...    95   1e-19
Kwal_23.4276 s23 complement(648061..649626) [1566 bp, 521 aa] {O...    96   1e-19
SAKL0B04488g Chr2 (395136..396242) [1107 bp, 368 aa] {ON} highly...    94   1e-19
Suva_4.87 Chr4 (160236..161810) [1575 bp, 524 aa] {ON} YDL159W (...    96   1e-19
KLLA0F23507g Chr6 complement(2198603..2200066) [1464 bp, 487 aa]...    95   1e-19
ZYRO0G16632g Chr7 (1360854..1365827) [4974 bp, 1657 aa] {ON} hig...    97   1e-19
NCAS0B05560 Chr2 complement(1050313..1051371) [1059 bp, 352 aa] ...    94   1e-19
TDEL0D04600 Chr4 (843530..845917) [2388 bp, 795 aa] {ON} Anc_3.1...    97   2e-19
Skud_4.546 Chr4 complement(967636..972618) [4983 bp, 1660 aa] {O...    97   2e-19
ADR174C Chr4 complement(1008796..1010811) [2016 bp, 671 aa] {ON}...    96   2e-19
Ecym_2566 Chr2 (1105239..1106126) [888 bp, 295 aa] {ON} similar ...    92   2e-19
Suva_2.449 Chr2 complement(789612..794603) [4992 bp, 1663 aa] {O...    97   2e-19
SAKL0G10978g Chr7 (929164..930729) [1566 bp, 521 aa] {ON} highly...    96   2e-19
Smik_4.209 Chr4 complement(385530..386995,387230..387623) [1860 ...    96   2e-19
Smik_4.532 Chr4 complement(956572..961554) [4983 bp, 1660 aa] {O...    97   2e-19
Suva_8.282 Chr8 (511665..513185) [1521 bp, 506 aa] {ON} YOR231W ...    95   2e-19
CAGL0H09152g Chr8 complement(895722..898055) [2334 bp, 777 aa] {...    96   2e-19
Ecym_6092 Chr6 (178965..180299) [1335 bp, 444 aa] {ON} similar t...    94   2e-19
KNAG0L00520 Chr12 (79786..80892) [1107 bp, 368 aa] {ON} Anc_7.86...    94   2e-19
TPHA0G01730 Chr7 complement(355001..356779) [1779 bp, 592 aa] {O...    96   2e-19
ZYRO0B04796g Chr2 (385611..387683) [2073 bp, 690 aa] {ON} simila...    96   2e-19
Skud_11.56 Chr11 complement(117617..119776) [2160 bp, 719 aa] {O...    96   2e-19
KLTH0D10670g Chr4 (877472..878806) [1335 bp, 444 aa] {ON} some s...    94   2e-19
Suva_4.221 Chr4 complement(391492..393789) [2298 bp, 765 aa] {ON...    96   2e-19
ADL283W Chr4 (205173..205197,205250..206145) [921 bp, 306 aa] {O...    92   2e-19
NCAS0C04540 Chr3 complement(929920..931056) [1137 bp, 378 aa] {O...    93   2e-19
NDAI0G06150 Chr7 (1519393..1521780) [2388 bp, 795 aa] {ON} Anc_1...    96   2e-19
Smik_6.136 Chr6 (219577..220686) [1110 bp, 369 aa] {ON} YGR052W ...    93   2e-19
KNAG0A03900 Chr1 complement(520500..521390) [891 bp, 296 aa] {ON...    92   2e-19
Kwal_33.14434 s33 complement(672031..674310) [2280 bp, 759 aa] {...    96   3e-19
Smik_2.101 Chr2 (186008..187069) [1062 bp, 353 aa] {ON} YBL016W ...    93   3e-19
NCAS0A14050 Chr1 complement(2763082..2764551) [1470 bp, 489 aa] ...    94   3e-19
CAGL0H01199g Chr8 (110610..115556) [4947 bp, 1648 aa] {ON} highl...    96   3e-19
KLLA0E07437g Chr5 complement(672690..673787) [1098 bp, 365 aa] {...    93   3e-19
TPHA0P01380 Chr16 (278259..279380) [1122 bp, 373 aa] {ON} Anc_3....    93   3e-19
NCAS0A04220 Chr1 (855791..857353) [1563 bp, 520 aa] {ON} Anc_2.425     94   3e-19
Ecym_6425 Chr6 (825834..828095) [2262 bp, 753 aa] {ON} similar t...    96   3e-19
KLLA0E12145g Chr5 (1080245..1081612) [1368 bp, 455 aa] {ON} simi...    94   3e-19
TPHA0B02440 Chr2 (560189..561592) [1404 bp, 467 aa] {ON} Anc_5.2...    94   3e-19
YBL016W Chr2 (192451..193512) [1062 bp, 353 aa] {ON}  FUS3Mitoge...    92   3e-19
CAGL0M13541g Chr13 (1333846..1335714) [1869 bp, 622 aa] {ON} sim...    95   3e-19
SAKL0F11110g Chr6 (868447..869832) [1386 bp, 461 aa] {ON} simila...    94   3e-19
KAFR0F03900 Chr6 (763094..764203) [1110 bp, 369 aa] {ON} Anc_4.1...    92   4e-19
ACR117W Chr3 (557738..559312) [1575 bp, 524 aa] {ON} Syntenic ho...    94   4e-19
ZYRO0A12826g Chr1 (1014651..1015751) [1101 bp, 366 aa] {ON} high...    92   4e-19
Ecym_2357 Chr2 (700079..701914) [1836 bp, 611 aa] {ON} similar t...    95   4e-19
KAFR0G00440 Chr7 (124896..127328) [2433 bp, 810 aa] {ON} Anc_1.1...    95   4e-19
TDEL0G02620 Chr7 (501589..501613,501677..502566) [915 bp, 304 aa...    91   4e-19
KLTH0D04356g Chr4 (405904..405987,406076..407401) [1410 bp, 469 ...    94   4e-19
CAGL0K01617g Chr11 complement(143308..145632) [2325 bp, 774 aa] ...    95   4e-19
Skud_15.39 Chr15 (69445..71412) [1968 bp, 655 aa] {ON} YOL113W (...    95   4e-19
Smik_8.97 Chr8 complement(148421..149857) [1437 bp, 478 aa] {ON}...    94   5e-19
Ecym_7361 Chr7 complement(753862..755313) [1452 bp, 483 aa] {ON}...    94   5e-19
Ecym_5241 Chr5 complement(495748..497586) [1839 bp, 612 aa] {ON}...    94   6e-19
YGR052W Chr7 (593596..594705) [1110 bp, 369 aa] {ON}  FMP48Putat...    92   6e-19
KAFR0E01490 Chr5 (298209..303167) [4959 bp, 1652 aa] {ON} Anc_5....    96   6e-19
AAL083W Chr1 (196774..201870) [5097 bp, 1698 aa] {ON} Syntenic h...    95   6e-19
KLTH0F09504g Chr6 (824743..824770,824831..825729) [927 bp, 308 a...    91   6e-19
ZYRO0A07062g Chr1 (576600..576615,576675..577561) [903 bp, 300 a...    91   6e-19
ZYRO0F08778g Chr6 (702733..703626) [894 bp, 297 aa] {ON} highly ...    91   6e-19
CAGL0J11308g Chr10 (1099969..1102155) [2187 bp, 728 aa] {ON} sim...    94   7e-19
Skud_2.90 Chr2 (176138..177199) [1062 bp, 353 aa] {ON} YBL016W (...    91   7e-19
KAFR0B01510 Chr2 complement(284425..286092) [1668 bp, 555 aa] {O...    94   7e-19
Ecym_4773 Chr4 complement(1504949..1506541) [1593 bp, 530 aa] {O...    93   8e-19
TBLA0H03440 Chr8 (840759..841643) [885 bp, 294 aa] {ON} Anc_8.51...    90   8e-19
NDAI0C04000 Chr3 (907842..912812) [4971 bp, 1656 aa] {ON} Anc_5....    95   8e-19
YOR231W Chr15 (772601..774127) [1527 bp, 508 aa] {ON}  MKK1Mitog...    93   8e-19
Kpol_448.13 s448 (25051..27063) [2013 bp, 670 aa] {ON} (25051..2...    94   8e-19
Suva_15.216 Chr15 complement(376197..377624) [1428 bp, 475 aa] {...    93   8e-19
ADL168C Chr4 complement(398517..399605) [1089 bp, 362 aa] {ON} S...    91   8e-19
Kpol_1018.137 s1018 complement(366178..367914) [1737 bp, 578 aa]...    94   9e-19
KLLA0C10802g Chr3 complement(926916..931934) [5019 bp, 1672 aa] ...    95   9e-19
KAFR0D02900 Chr4 (575853..577313) [1461 bp, 486 aa] {ON} Anc_7.5...    93   9e-19
Kwal_23.5576 s23 complement(1223517..1225031) [1515 bp, 504 aa] ...    93   9e-19
YNL183C Chr14 complement(293137..295509) [2373 bp, 790 aa] {ON} ...    94   1e-18
CAGL0L05632g Chr12 (612478..614511) [2034 bp, 677 aa] {ON} simil...    94   1e-18
KAFR0F02220 Chr6 (432967..435210) [2244 bp, 747 aa] {ON} Anc_3.1...    94   1e-18
ADR300C Chr4 complement(1222344..1225016) [2673 bp, 890 aa] {ON}...    94   1e-18
KLLA0E17073g Chr5 complement(1515721..1518279) [2559 bp, 852 aa]...    94   1e-18
TDEL0E03520 Chr5 (657779..659251) [1473 bp, 490 aa] {ON} Anc_5.2...    92   1e-18
Kpol_499.3 s499 complement(6075..7199) [1125 bp, 374 aa] {ON} co...    91   1e-18
TDEL0B04490 Chr2 (792559..793629) [1071 bp, 356 aa] {ON} Anc_8.1...    91   1e-18
Ecym_2042 Chr2 complement(67312..68397) [1086 bp, 361 aa] {ON} s...    91   1e-18
NDAI0B03310 Chr2 complement(844616..845557) [942 bp, 313 aa] {ON...    90   1e-18
NCAS0D00400 Chr4 complement(61545..63716) [2172 bp, 723 aa] {ON}...    93   1e-18
KAFR0D04500 Chr4 (887515..889989) [2475 bp, 824 aa] {ON} Anc_1.5...    94   1e-18
SAKL0C07458g Chr3 complement(687452..689395) [1944 bp, 647 aa] {...    93   2e-18
Kpol_1044.26 s1044 complement(60216..62666) [2451 bp, 816 aa] {O...    93   2e-18
Kwal_33.14192 s33 complement(563582..565315) [1734 bp, 577 aa] {...    93   2e-18
Skud_8.86 Chr8 complement(149508..150953) [1446 bp, 481 aa] {ON}...    92   2e-18
Skud_11.67 Chr11 complement(135815..137341) [1527 bp, 508 aa] {O...    92   2e-18
ZYRO0F11418g Chr6 complement(936573..938117) [1545 bp, 514 aa] {...    92   2e-18
KAFR0A07560 Chr1 (1525225..1527504) [2280 bp, 759 aa] {ON} Anc_2...    93   2e-18
YHR030C Chr8 complement(168890..170344) [1455 bp, 484 aa] {ON}  ...    92   2e-18
ZYRO0G16082g Chr7 complement(1320266..1321714) [1449 bp, 482 aa]...    92   2e-18
NCAS0A09750 Chr1 (1940202..1942370) [2169 bp, 722 aa] {ON}             93   2e-18
KLTH0G06974g Chr7 (556626..558125) [1500 bp, 499 aa] {ON} highly...    92   2e-18
Ecym_8337 Chr8 (679844..681460) [1617 bp, 538 aa] {ON} similar t...    92   2e-18
TDEL0E03300 Chr5 complement(621448..626409) [4962 bp, 1653 aa] {...    94   2e-18
KLLA0D07304g Chr4 (623352..624749) [1398 bp, 465 aa] {ON} some s...    92   2e-18
KNAG0F03410 Chr6 (640115..645094) [4980 bp, 1659 aa] {ON}              94   2e-18
TBLA0A10420 Chr1 (2562614..2564092) [1479 bp, 492 aa] {ON} Anc_5...    92   2e-18
KNAG0A01330 Chr1 complement(34784..35977) [1194 bp, 397 aa] {ON}...    91   2e-18
Kpol_1031.32 s1031 (76827..78821) [1995 bp, 664 aa] {ON} (76827....    92   2e-18
KLTH0E16104g Chr5 complement(1425822..1427042) [1221 bp, 406 aa]...    91   2e-18
NDAI0K01150 Chr11 complement(264377..266527) [2151 bp, 716 aa] {...    92   2e-18
KAFR0B03170 Chr2 complement(656163..658025) [1863 bp, 620 aa] {O...    92   2e-18
SAKL0G08250g Chr7 (703212..705707) [2496 bp, 831 aa] {ON} simila...    93   2e-18
CAGL0I08349g Chr9 complement(813998..816001) [2004 bp, 667 aa] {...    92   2e-18
CAGL0E01683g Chr5 complement(166821..167948) [1128 bp, 375 aa] {...    90   3e-18
TBLA0J00990 Chr10 (224999..227335) [2337 bp, 778 aa] {ON} Anc_1....    92   3e-18
Smik_6.178 Chr6 (291601..293322) [1722 bp, 573 aa] {ON} YGR092W ...    92   3e-18
NCAS0A06680 Chr1 (1320265..1321704) [1440 bp, 479 aa] {ON} Anc_5...    91   3e-18
Suva_14.32 Chr14 complement(52757..53884) [1128 bp, 375 aa] {ON}...    90   3e-18
Ecym_5236 Chr5 (486270..488864) [2595 bp, 864 aa] {ON} similar t...    92   3e-18
TPHA0D01770 Chr4 (365255..370279) [5025 bp, 1674 aa] {ON} Anc_5....    93   3e-18
Smik_14.147 Chr14 complement(272373..274742) [2370 bp, 789 aa] {...    92   3e-18
AER232C Chr5 complement(1066272..1067981) [1710 bp, 569 aa] {ON}...    92   3e-18
KAFR0E01810 Chr5 complement(372094..373524) [1431 bp, 476 aa] {O...    91   3e-18
NCAS0F02520 Chr6 (495799..500631) [4833 bp, 1610 aa] {ON} Anc_5....    93   3e-18
Suva_4.33 Chr4 complement(63334..65427) [2094 bp, 697 aa] {ON} Y...    92   3e-18
Kpol_1018.148 s1018 (393064..394413) [1350 bp, 449 aa] {ON} (393...    91   3e-18
Skud_7.350 Chr7 (580913..582022) [1110 bp, 369 aa] {ON} YGR052W ...    90   4e-18
NDAI0H00610 Chr8 complement(141913..143022) [1110 bp, 369 aa] {O...    89   4e-18
SAKL0G10384g Chr7 complement(883824..888848) [5025 bp, 1674 aa] ...    93   4e-18
Skud_7.391 Chr7 (652479..654200) [1722 bp, 573 aa] {ON} YGR092W ...    91   4e-18
ADR313W Chr4 (1255930..1257666) [1737 bp, 578 aa] {ON} Syntenic ...    91   4e-18
TBLA0B03590 Chr2 (834488..837022) [2535 bp, 844 aa] {ON} Anc_8.7...    92   4e-18
Kpol_1065.6 s1065 (12266..12916,12918..13280,13332..13340,13394....    91   5e-18
AER222C Chr5 complement(1043479..1044750) [1272 bp, 423 aa] {ON}...    90   5e-18
ZYRO0A02772g Chr1 complement(223226..224473) [1248 bp, 415 aa] {...    90   5e-18
YDR247W Chr4 (956013..957398) [1386 bp, 461 aa] {ON}  VHS1Cytopl...    90   5e-18
Kwal_YGOB_23.3471 s23 (305207..305234,305298..306196) [927 bp, 3...    88   6e-18
Smik_4.494 Chr4 (900954..902321) [1368 bp, 455 aa] {ON} YDR247W ...    90   6e-18
Suva_16.439 Chr16 (755102..756796) [1695 bp, 564 aa] {ON} YPR111...    91   6e-18
KAFR0C01720 Chr3 (351078..352208) [1131 bp, 376 aa] {ON} Anc_3.4...    89   6e-18
TDEL0F03120 Chr6 (570471..572192) [1722 bp, 573 aa] {ON} Anc_3.4...    91   6e-18
TBLA0B01990 Chr2 complement(458264..461623) [3360 bp, 1119 aa] {...    92   7e-18
TPHA0O01620 Chr15 (321912..324359) [2448 bp, 815 aa] {ON} Anc_2....    91   7e-18
KNAG0K01250 Chr11 (246241..247467) [1227 bp, 408 aa] {ON} Anc_3....    89   7e-18
Suva_7.375 Chr7 (643870..645591) [1722 bp, 573 aa] {ON} YGR092W ...    91   7e-18
NDAI0G03920 Chr7 complement(934765..935889) [1125 bp, 374 aa] {O...    89   7e-18
TDEL0A01120 Chr1 complement(189217..191466) [2250 bp, 749 aa] {O...    91   8e-18
TBLA0C03140 Chr3 (759258..760763) [1506 bp, 501 aa] {ON} Anc_5.2...    90   8e-18
TDEL0D02650 Chr4 complement(505536..506636) [1101 bp, 366 aa] {O...    89   8e-18
YGR092W Chr7 (668189..669907) [1719 bp, 572 aa] {ON}  DBF2Ser/Th...    91   8e-18
TPHA0J00630 Chr10 (139476..140600) [1125 bp, 374 aa] {ON} Anc_4....    89   8e-18
TBLA0C02310 Chr3 complement(546887..548596) [1710 bp, 569 aa] {O...    90   8e-18
ZYRO0D03344g Chr4 complement(278347..280326) [1980 bp, 659 aa] {...    91   9e-18
Ecym_6044 Chr6 complement(84500..85756) [1257 bp, 418 aa] {ON} s...    89   9e-18
Skud_16.398 Chr16 (712145..713827) [1683 bp, 560 aa] {ON} YPR111...    90   9e-18
KNAG0B01130 Chr2 complement(208528..210279) [1752 bp, 583 aa] {O...    90   9e-18
Smik_16.354 Chr16 (625456..627150) [1695 bp, 564 aa] {ON} YPR111...    90   1e-17
TBLA0D05640 Chr4 (1380616..1383066) [2451 bp, 816 aa] {ON} Anc_1...    91   1e-17
ZYRO0C12408g Chr3 (979857..981593) [1737 bp, 578 aa] {ON} highly...    90   1e-17
Ecym_1313 Chr1 complement(633556..634455) [900 bp, 299 aa] {ON} ...    87   1e-17
NCAS0C01110 Chr3 (207664..209664) [2001 bp, 666 aa] {ON} Anc_8.716     91   1e-17
TDEL0C02110 Chr3 (364853..366340) [1488 bp, 495 aa] {ON} Anc_7.3...    89   1e-17
KNAG0G01430 Chr7 complement(322758..323822) [1065 bp, 354 aa] {O...    88   1e-17
KLLA0D14905g Chr4 (1256065..1257768) [1704 bp, 567 aa] {ON} simi...    90   1e-17
KAFR0G01810 Chr7 (386620..389130) [2511 bp, 836 aa] {ON} Anc_1.2...    91   1e-17
KLTH0F06578g Chr6 complement(568519..570309) [1791 bp, 596 aa] {...    90   1e-17
TPHA0H01500 Chr8 complement(336652..339639) [2988 bp, 995 aa] {O...    91   1e-17
CAGL0J06072g Chr10 complement(574501..576822) [2322 bp, 773 aa] ...    91   1e-17
TDEL0A00600 Chr1 complement(101753..102877) [1125 bp, 374 aa] {O...    88   1e-17
CAGL0J04290g Chr10 complement(403542..404615) [1074 bp, 357 aa] ...    88   1e-17
KAFR0H01460 Chr8 complement(269957..271705) [1749 bp, 582 aa] {O...    90   1e-17
Skud_10.87 Chr10 complement(153140..155164) [2025 bp, 674 aa] {O...    90   1e-17
YJL128C Chr10 complement(178097..180103) [2007 bp, 668 aa] {ON} ...    90   1e-17
SAKL0D12628g Chr4 (1048973..1051429) [2457 bp, 818 aa] {ON} weak...    90   1e-17
NDAI0D01620 Chr4 (386654..388132) [1479 bp, 492 aa] {ON} Anc_5.274     89   1e-17
Ecym_5252 Chr5 (525687..526976) [1290 bp, 429 aa] {ON} similar t...    89   2e-17
NDAI0F03390 Chr6 (816047..818380) [2334 bp, 777 aa] {ON}               90   2e-17
KLLA0A09713g Chr1 (851952..853625) [1674 bp, 557 aa] {ON} simila...    89   2e-17
CAGL0B04147g Chr2 (402798..404498) [1701 bp, 566 aa] {ON} highly...    89   2e-17
KNAG0K01710 Chr11 (360438..361931) [1494 bp, 497 aa] {ON} Anc_3....    89   2e-17
NDAI0F04520 Chr6 complement(1098426..1099895) [1470 bp, 489 aa] ...    89   2e-17
KLLA0B11902g Chr2 (1041657..1043144) [1488 bp, 495 aa] {ON} unip...    89   2e-17
NDAI0A04040 Chr1 complement(907696..910041) [2346 bp, 781 aa] {O...    90   2e-17
ZYRO0C02772g Chr3 (216325..217464) [1140 bp, 379 aa] {ON} highly...    87   2e-17
Skud_4.39 Chr4 complement(70857..72947) [2091 bp, 696 aa] {ON} Y...    90   2e-17
TPHA0F02870 Chr6 complement(636574..638259) [1686 bp, 561 aa] {O...    89   2e-17
Skud_14.151 Chr14 complement(284115..286490) [2376 bp, 791 aa] {...    90   2e-17
ZYRO0D10252g Chr4 (860458..863109) [2652 bp, 883 aa] {ON} simila...    90   2e-17
NDAI0G01280 Chr7 complement(281834..283573) [1740 bp, 579 aa] {O...    89   2e-17
Kpol_513.17 s513 (49097..50824) [1728 bp, 575 aa] {ON} (49097..5...    89   2e-17
KNAG0D04040 Chr4 (730581..731897) [1317 bp, 438 aa] {ON} Anc_4.1...    88   2e-17
SAKL0E12958g Chr5 (1066434..1068653) [2220 bp, 739 aa] {ON} simi...    89   2e-17
KAFR0H01570 Chr8 complement(290698..291897) [1200 bp, 399 aa] {O...    87   2e-17
Ecym_1508 Chr1 (1045857..1050941) [5085 bp, 1694 aa] {ON} simila...    90   2e-17
Ecym_8004 Chr8 complement(5273..7957) [2685 bp, 894 aa] {ON} sim...    90   2e-17
ZYRO0C09768g Chr3 (740592..742925) [2334 bp, 777 aa] {ON} simila...    89   3e-17
TBLA0D02730 Chr4 complement(674994..676427) [1434 bp, 477 aa] {O...    88   3e-17
KNAG0J01950 Chr10 complement(352815..354317) [1503 bp, 500 aa] {...    88   3e-17
CAGL0M10829g Chr13 complement(1076233..1081236) [5004 bp, 1667 a...    90   3e-17
TBLA0D03740 Chr4 complement(926538..929057) [2520 bp, 839 aa] {O...    89   3e-17
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    90   3e-17
KLLA0E10539g Chr5 (929989..931104) [1116 bp, 371 aa] {ON} highly...    87   3e-17
KLTH0E11110g Chr5 (997486..998847) [1362 bp, 453 aa] {ON} simila...    88   3e-17
SAKL0E06534g Chr5 complement(533369..534267,534334..534358) [924...    86   3e-17
CAGL0M08360g Chr13 complement(833220..835520) [2301 bp, 766 aa] ...    89   3e-17
TBLA0C06820 Chr3 (1645811..1647508) [1698 bp, 565 aa] {ON} Anc_5...    88   3e-17
YDL214C Chr4 complement(74446..76545) [2100 bp, 699 aa] {ON}  PR...    89   3e-17
KNAG0E03200 Chr5 complement(641437..646020) [4584 bp, 1527 aa] {...    89   3e-17
NDAI0A04760 Chr1 complement(1088637..1090103) [1467 bp, 488 aa] ...    88   4e-17
TPHA0G02090 Chr7 complement(429178..430527) [1350 bp, 449 aa] {O...    87   4e-17
KLLA0A02717g Chr1 (245082..246380) [1299 bp, 432 aa] {ON} weakly...    87   4e-17
KLLA0C07535g Chr3 (658746..660620) [1875 bp, 624 aa] {ON} some s...    89   4e-17
Skud_14.32 Chr14 complement(49930..51057) [1128 bp, 375 aa] {ON}...    87   4e-17
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    89   4e-17
ZYRO0F08272g Chr6 (668685..670508) [1824 bp, 607 aa] {ON} simila...    88   4e-17
TDEL0B01590 Chr2 complement(280143..281573) [1431 bp, 476 aa] {O...    87   4e-17
NCAS0A11530 Chr1 (2281835..2283223) [1389 bp, 462 aa] {ON} Anc_3...    87   4e-17
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    89   4e-17
ZYRO0G04488g Chr7 complement(360635..362545) [1911 bp, 636 aa] {...    88   4e-17
YNL307C Chr14 complement(56446..57573) [1128 bp, 375 aa] {ON}  M...    86   5e-17
KLLA0D12100g Chr4 complement(1031728..1033161) [1434 bp, 477 aa]...    87   5e-17
KNAG0A02350 Chr1 complement(223757..225022) [1266 bp, 421 aa] {O...    87   5e-17
Smik_14.24 Chr14 complement(40883..42010) [1128 bp, 375 aa] {ON}...    86   5e-17
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    89   5e-17
Smik_10.106 Chr10 complement(175752..177776) [2025 bp, 674 aa] {...    88   5e-17
CAGL0D02002g Chr4 (207419..209080) [1662 bp, 553 aa] {ON} simila...    88   5e-17
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    89   5e-17
NCAS0A12200 Chr1 (2417539..2419782) [2244 bp, 747 aa] {ON} Anc_1...    88   5e-17
TPHA0L02180 Chr12 (453556..455538) [1983 bp, 660 aa] {ON} Anc_5....    88   6e-17
Skud_16.256 Chr16 complement(465728..467362) [1635 bp, 544 aa] {...    87   6e-17
KNAG0J02660 Chr10 (495011..497425) [2415 bp, 804 aa] {ON} Anc_1....    88   6e-17
Kwal_55.21709 s55 (948619..949641) [1023 bp, 340 aa] {ON} YOR061...    86   6e-17
NDAI0C03610 Chr3 (829317..831476) [2160 bp, 719 aa] {ON} Anc_5.38      88   6e-17
Suva_7.334 Chr7 (568847..569956) [1110 bp, 369 aa] {ON} YGR052W ...    86   6e-17
Suva_6.208 Chr6 (369853..371880) [2028 bp, 675 aa] {ON} YJL128C ...    88   6e-17
TDEL0A06610 Chr1 complement(1151052..1152824) [1773 bp, 590 aa] ...    87   6e-17
NDAI0C03900 Chr3 complement(883841..885310) [1470 bp, 489 aa] {O...    87   7e-17
YPL026C Chr16 complement(500675..502183) [1509 bp, 502 aa] {ON} ...    87   7e-17
SAKL0H05588g Chr8 (502752..504602) [1851 bp, 616 aa] {ON} simila...    87   7e-17
Ecym_6056 Chr6 complement(107449..108888) [1440 bp, 479 aa] {ON}...    87   7e-17
Skud_4.509 Chr4 (910551..911945) [1395 bp, 464 aa] {ON} YDR247W ...    87   7e-17
KNAG0B00260 Chr2 complement(36240..38477) [2238 bp, 745 aa] {ON}...    88   7e-17
TDEL0E02510 Chr5 (486415..489156) [2742 bp, 913 aa] {ON} Anc_5.3...    88   8e-17
Kpol_1041.9 s1041 (27806..29059) [1254 bp, 417 aa] {ON} (27806.....    86   8e-17
TBLA0B09740 Chr2 (2312062..2314815) [2754 bp, 917 aa] {ON} Anc_2...    88   8e-17
NCAS0C02390 Chr3 complement(446642..448468) [1827 bp, 608 aa] {O...    87   9e-17
SAKL0F06094g Chr6 (457709..459442) [1734 bp, 577 aa] {ON} unipro...    87   9e-17
KLTH0E11396g Chr5 (1018348..1020069) [1722 bp, 573 aa] {ON} simi...    87   9e-17
ADR253W Chr4 (1141941..1143083) [1143 bp, 380 aa] {ON} Syntenic ...    86   9e-17
TPHA0G01450 Chr7 (297855..299861) [2007 bp, 668 aa] {ON}               87   1e-16
NDAI0E01690 Chr5 (335849..337051) [1203 bp, 400 aa] {ON} Anc_2.391     86   1e-16
NDAI0E03080 Chr5 complement(653882..655798) [1917 bp, 638 aa] {O...    87   1e-16
TPHA0P00640 Chr16 (132185..133963) [1779 bp, 592 aa] {ON} Anc_3....    87   1e-16
KNAG0M01450 Chr13 (254622..256061) [1440 bp, 479 aa] {ON}              86   1e-16
Kpol_1032.10 s1032 (24479..26854) [2376 bp, 791 aa] {ON} (24479....    87   1e-16
TBLA0A07460 Chr1 (1848207..1849757) [1551 bp, 516 aa] {ON} Anc_1...    87   1e-16
Smik_4.157 Chr4 complement(289446..290605,290830..291250) [1581 ...    87   1e-16
SAKL0E04950g Chr5 (401903..402994) [1092 bp, 363 aa] {ON} highly...    85   1e-16
Smik_16.209 Chr16 complement(377965..379425) [1461 bp, 486 aa] {...    86   1e-16
NCAS0G01820 Chr7 complement(323288..325690) [2403 bp, 800 aa] {O...    87   1e-16
KNAG0K01740 Chr11 (364195..366492) [2298 bp, 765 aa] {ON} Anc_3....    87   1e-16
TPHA0O01080 Chr15 complement(205407..207653) [2247 bp, 748 aa] {...    87   1e-16
Kwal_27.9773 s27 (57252..58472) [1221 bp, 406 aa] {ON} YAR018C (...    86   1e-16
Suva_7.325 Chr7 (550760..551866) [1107 bp, 368 aa] {ON} YGR040W ...    85   1e-16
NDAI0D04050 Chr4 (952438..953538) [1101 bp, 366 aa] {ON} Anc_4.184     85   1e-16
Kwal_55.20189 s55 (288918..291356) [2439 bp, 812 aa] {ON} YHR082...    87   1e-16
Kwal_23.3992 s23 complement(515493..517208) [1716 bp, 571 aa] {O...    86   1e-16
Smik_6.125 Chr6 (201071..202177) [1107 bp, 368 aa] {ON} YGR040W ...    85   1e-16
NCAS0D01230 Chr4 complement(225213..226661) [1449 bp, 482 aa] {O...    86   2e-16
Smik_4.25 Chr4 complement(52454..54547) [2094 bp, 697 aa] {ON} Y...    87   2e-16
YPR111W Chr16 (747306..749000) [1695 bp, 564 aa] {ON}  DBF20Ser/...    86   2e-16
Suva_16.291 Chr16 complement(504006..505433) [1428 bp, 475 aa] {...    86   2e-16
Suva_3.129 Chr3 (193311..194282) [972 bp, 323 aa] {ON} YCR091W (...    84   2e-16
CAGL0K04169g Chr11 (384567..385763) [1197 bp, 398 aa] {ON} simil...    85   2e-16
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    87   2e-16
KAFR0K01540 Chr11 (320997..322706) [1710 bp, 569 aa] {ON} Anc_3....    86   2e-16
KNAG0C01020 Chr3 (200271..202595) [2325 bp, 774 aa] {ON} Anc_1.1...    86   2e-16
Kwal_27.11830 s27 (964584..966311) [1728 bp, 575 aa] {ON} YPL042...    86   2e-16
TBLA0B00770 Chr2 complement(168444..170519) [2076 bp, 691 aa] {O...    86   2e-16
ADR163W Chr4 (989728..991008) [1281 bp, 426 aa] {ON} Syntenic ho...    85   2e-16
KLTH0F12012g Chr6 complement(1013169..1014881) [1713 bp, 570 aa]...    86   2e-16
KLLA0C03828g Chr3 (349187..351568) [2382 bp, 793 aa] {ON} simila...    86   2e-16
KLTH0D12166g Chr4 complement(987310..989061) [1752 bp, 583 aa] {...    86   2e-16
Suva_16.491 Chr16 complement(848824..850794) [1971 bp, 656 aa] {...    86   2e-16
CAGL0J00539g Chr10 (47095..48561) [1467 bp, 488 aa] {ON} highly ...    85   2e-16
TDEL0F00530 Chr6 complement(88187..90517) [2331 bp, 776 aa] {ON}...    86   3e-16
YKL161C Chr11 complement(149386..150687) [1302 bp, 433 aa] {ON} ...    85   3e-16
KNAG0G02780 Chr7 complement(615058..617202) [2145 bp, 714 aa] {O...    86   3e-16
Kpol_161.2 s161 complement(3125..4246) [1122 bp, 373 aa] {ON} co...    84   3e-16
TDEL0D04450 Chr4 complement(811665..812924) [1260 bp, 419 aa] {O...    84   3e-16
ZYRO0A08448g Chr1 complement(677122..678225) [1104 bp, 367 aa] {...    84   3e-16
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    86   3e-16
TBLA0A01580 Chr1 complement(367370..369976) [2607 bp, 868 aa] {O...    86   3e-16
TBLA0C03180 Chr3 complement(770462..775468) [5007 bp, 1668 aa] {...    86   3e-16
KNAG0C01040 Chr3 complement(203429..204976) [1548 bp, 515 aa] {O...    85   4e-16
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    86   4e-16
Kpol_489.20 s489 complement(59150..60178) [1029 bp, 342 aa] {ON}...    83   4e-16
Kwal_23.3471 s23 (305414..306196) [783 bp, 260 aa] {OFF} YDL108W...    81   4e-16
Suva_2.703 Chr2 complement(1238496..1239953) [1458 bp, 485 aa] {...    84   4e-16
TBLA0D02070 Chr4 complement(522456..523958) [1503 bp, 500 aa] {O...    85   4e-16
Smik_15.449 Chr15 complement(772245..774437) [2193 bp, 730 aa] {...    86   4e-16
TDEL0H01070 Chr8 complement(192834..194624) [1791 bp, 596 aa] {O...    85   4e-16
KAFR0B00920 Chr2 (170792..172300) [1509 bp, 502 aa] {ON} Anc_7.3...    84   4e-16
Kpol_2002.24 s2002 (48405..49868) [1464 bp, 487 aa] {ON} (48405....    84   5e-16
NCAS0F02410 Chr6 complement(476683..478071) [1389 bp, 462 aa] {O...    84   5e-16
Kwal_26.8941 s26 complement(1014543..1016528) [1986 bp, 661 aa] ...    85   5e-16
TDEL0B01470 Chr2 complement(257397..259169) [1773 bp, 590 aa] {O...    85   5e-16
NCAS0A02120 Chr1 (401097..402230) [1134 bp, 377 aa] {ON} Anc_4.184     83   5e-16
Skud_4.797 Chr4 complement(1405618..1407075) [1458 bp, 485 aa] {...    84   6e-16
Kpol_1072.1 s1072 (686..2683) [1998 bp, 665 aa] {ON} (686..2683)...    85   6e-16
KNAG0F01240 Chr6 complement(223003..225591) [2589 bp, 862 aa] {O...    85   6e-16
Smik_4.803 Chr4 complement(1408345..1409817) [1473 bp, 490 aa] {...    84   6e-16
Smik_8.156 Chr8 complement(234928..238269) [3342 bp, 1113 aa] {O...    85   6e-16
Suva_8.111 Chr8 (204414..205433) [1020 bp, 339 aa] {ON} YOR061W ...    82   6e-16
KAFR0E00330 Chr5 complement(74619..76574) [1956 bp, 651 aa] {ON}...    85   6e-16
KLLA0E15313g Chr5 (1362851..1365025) [2175 bp, 724 aa] {ON} simi...    85   7e-16
Skud_15.228 Chr15 (403382..404401) [1020 bp, 339 aa] {ON} YOR061...    82   7e-16
YOR061W Chr15 (441534..442553) [1020 bp, 339 aa] {ON}  CKA2Alpha...    82   7e-16
CAGL0C02893g Chr3 complement(286017..287966) [1950 bp, 649 aa] {...    84   7e-16
Skud_7.337 Chr7 (562750..563856) [1107 bp, 368 aa] {ON} YGR040W ...    83   7e-16
Ecym_8164 Chr8 (342672..346076) [3405 bp, 1134 aa] {ON} similar ...    85   7e-16
TPHA0G02800 Chr7 (597211..598722) [1512 bp, 503 aa] {ON} Anc_2.4...    84   7e-16
KLTH0E03652g Chr5 (330227..332671) [2445 bp, 814 aa] {ON} simila...    85   7e-16
YGR040W Chr7 (575398..576504) [1107 bp, 368 aa] {ON}  KSS1Mitoge...    82   8e-16
YOR267C Chr15 complement(822588..824867) [2280 bp, 759 aa] {ON} ...    84   8e-16
Kpol_1031.76 s1031 (193193..194923) [1731 bp, 576 aa] {ON} (1931...    84   8e-16
KLLA0D11814g Chr4 complement(1007240..1009021) [1782 bp, 593 aa]...    84   8e-16
TBLA0A07770 Chr1 complement(1916632..1917939) [1308 bp, 435 aa] ...    83   9e-16
Suva_8.316 Chr8 complement(561812..563914) [2103 bp, 700 aa] {ON...    84   9e-16
Ecym_4448 Chr4 complement(917136..918872) [1737 bp, 578 aa] {ON}...    84   9e-16
Kwal_14.1159 s14 complement(219896..224461) [4566 bp, 1521 aa] {...    85   9e-16
NCAS0C05490 Chr3 (1114733..1115755) [1023 bp, 340 aa] {ON} Anc_5...    82   9e-16
TPHA0D00360 Chr4 complement(55596..60206) [4611 bp, 1536 aa] {ON...    85   1e-15
Skud_15.432 Chr15 complement(761490..763601) [2112 bp, 703 aa] {...    84   1e-15
ADR033W Chr4 (764716..766449) [1734 bp, 577 aa] {ON} Syntenic ho...    84   1e-15
NDAI0J00420 Chr10 (73312..75606) [2295 bp, 764 aa] {ON} Anc_7.515      84   1e-15
Skud_13.300 Chr13 (519521..520633) [1113 bp, 370 aa] {ON} YMR139...    82   1e-15
KLLA0F01408g Chr6 (135424..136302) [879 bp, 292 aa] {ON} conserv...    80   1e-15
NCAS0B00420 Chr2 complement(54562..56718) [2157 bp, 718 aa] {ON}...    84   1e-15
TPHA0A05460 Chr1 (1233608..1235170) [1563 bp, 520 aa] {ON} Anc_5...    83   1e-15
YDR523C Chr4 complement(1485566..1487038) [1473 bp, 490 aa] {ON}...    83   1e-15
Kpol_1033.1 s1033 complement(1..828) [828 bp, 276 aa] {ON} compl...    80   1e-15
KNAG0D03980 Chr4 (721049..722170) [1122 bp, 373 aa] {ON} Anc_4.1...    82   1e-15
Ecym_4056 Chr4 complement(119406..120428) [1023 bp, 340 aa] {ON}...    81   1e-15
KAFR0K01310 Chr11 (270172..271191) [1020 bp, 339 aa] {ON} Anc_5....    81   1e-15
YDL079C Chr4 complement(312951..314044,314337..314748) [1506 bp,...    83   1e-15
TPHA0B01150 Chr2 complement(259998..262070) [2073 bp, 690 aa] {O...    84   1e-15
CAGL0H01837g Chr8 complement(176352..178736) [2385 bp, 794 aa] {...    84   1e-15
KAFR0A04070 Chr1 complement(817388..819325) [1938 bp, 645 aa] {O...    83   1e-15
Ecym_2540 Chr2 (1048071..1049792) [1722 bp, 573 aa] {ON} similar...    83   2e-15
NCAS0G03420 Chr7 (628644..630668) [2025 bp, 674 aa] {ON} Anc_1.507     84   2e-15
KLTH0F17490g Chr6 (1413752..1414774) [1023 bp, 340 aa] {ON} high...    81   2e-15
KAFR0C00920 Chr3 complement(185475..186674) [1200 bp, 399 aa] {O...    82   2e-15
NDAI0E03210 Chr5 complement(686073..687317) [1245 bp, 414 aa] {O...    82   2e-15
Kpol_365.3 s365 complement(2204..4177,4180..4206,4209..4874) [26...    84   2e-15
YMR139W Chr13 (546125..547237) [1113 bp, 370 aa] {ON}  RIM11Prot...    82   2e-15
CAGL0K11275g Chr11 (1094626..1096203) [1578 bp, 525 aa] {ON} sim...    83   2e-15
Kwal_26.8347 s26 complement(748254..750032) [1779 bp, 592 aa] {O...    83   2e-15
TPHA0L01350 Chr12 (282034..283884) [1851 bp, 616 aa] {ON}              83   2e-15
Kpol_1037.7 s1037 (15938..17182) [1245 bp, 414 aa] {ON} (15938.....    82   2e-15
NDAI0D01450 Chr4 (339780..341948) [2169 bp, 722 aa] {ON} Anc_1.507     83   2e-15
TDEL0C06780 Chr3 complement(1236767..1238173) [1407 bp, 468 aa] ...    82   2e-15
Kwal_47.17868 s47 (587449..588546) [1098 bp, 365 aa] {ON} YMR139...    81   2e-15
KNAG0A06140 Chr1 (931737..933437) [1701 bp, 566 aa] {ON} Anc_2.4...    83   2e-15
NCAS0A04010 Chr1 complement(809163..810299) [1137 bp, 378 aa] {O...    81   2e-15
TBLA0H00370 Chr8 (71216..73393) [2178 bp, 725 aa] {ON} Anc_2.425...    83   2e-15
NCAS0A15040 Chr1 complement(2962030..2964036) [2007 bp, 668 aa] ...    83   2e-15
ZYRO0F03014g Chr6 complement(255189..260003) [4815 bp, 1604 aa] ...    84   2e-15
Smik_16.420 Chr16 complement(725685..727658) [1974 bp, 657 aa] {...    83   2e-15
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    84   2e-15
NCAS0B02530 Chr2 complement(422882..424207) [1326 bp, 441 aa] {O...    82   3e-15
AFL217C Chr6 complement(30765..32840) [2076 bp, 691 aa] {ON} Syn...    82   3e-15
Smik_13.338 Chr13 (528578..529690) [1113 bp, 370 aa] {ON} YMR139...    80   3e-15
YPR161C Chr16 complement(864449..866422) [1974 bp, 657 aa] {ON} ...    82   3e-15
CAGL0G03047g Chr7 (282299..283918) [1620 bp, 539 aa] {ON} highly...    82   3e-15
Suva_13.319 Chr13 (525309..526421) [1113 bp, 370 aa] {ON} YMR139...    80   3e-15
KNAG0A04080 Chr1 complement(551409..552635) [1227 bp, 408 aa] {O...    81   3e-15
CAGL0L06820g Chr12 (769035..770135) [1101 bp, 366 aa] {ON} highl...    80   3e-15
KAFR0F02710 Chr6 (528336..529493) [1158 bp, 385 aa] {ON} Anc_2.3...    80   4e-15
CAGL0I03498g Chr9 (297344..298699) [1356 bp, 451 aa] {ON} simila...    81   4e-15
Kpol_1041.29 s1041 (73725..74876) [1152 bp, 383 aa] {ON} (73725....    80   4e-15
Suva_4.168 Chr4 complement(302527..303654) [1128 bp, 375 aa] {ON...    80   4e-15
NDAI0A01970 Chr1 (440268..442184) [1917 bp, 638 aa] {ON} Anc_7.335     82   4e-15
NDAI0E00960 Chr5 (195116..197251) [2136 bp, 711 aa] {ON} Anc_8.716     82   4e-15
CAGL0J04972g Chr10 (475587..476606) [1020 bp, 339 aa] {ON} some ...    80   4e-15
CAGL0F03311g Chr6 complement(327599..330736) [3138 bp, 1045 aa] ...    82   4e-15
KAFR0C03520 Chr3 (715667..720019) [4353 bp, 1450 aa] {ON} Anc_8....    83   4e-15
Ecym_4364 Chr4 (772870..773997) [1128 bp, 375 aa] {ON} similar t...    80   4e-15
Klac_YGOB_Anc_8.34 Chr6 (836287..839007,839010..841004) [4716 bp...    83   4e-15
CAGL0H01639g Chr8 (158967..160532) [1566 bp, 521 aa] {ON} simila...    82   4e-15
Suva_2.413 Chr2 (735541..736923) [1383 bp, 460 aa] {ON} YDR247W ...    81   4e-15
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    82   4e-15
KNAG0A05920 Chr1 complement(883522..884742) [1221 bp, 406 aa] {O...    80   5e-15
Skud_16.460 Chr16 complement(807116..809077) [1962 bp, 653 aa] {...    82   5e-15
KLLA0C16577g Chr3 complement(1451181..1452695) [1515 bp, 504 aa]...    81   5e-15
ADR204W Chr4 (1062593..1063612) [1020 bp, 339 aa] {ON} Syntenic ...    80   5e-15
TPHA0I03100 Chr9 complement(681645..683666) [2022 bp, 673 aa] {O...    82   5e-15
ABL143C Chr2 complement(128215..130392) [2178 bp, 725 aa] {ON} S...    82   6e-15
YIL035C Chr9 complement(287790..288908) [1119 bp, 372 aa] {ON}  ...    80   6e-15
NDAI0H03740 Chr8 (912611..915373) [2763 bp, 920 aa] {ON} Anc_2.71      82   6e-15
TDEL0B06900 Chr2 complement(1220590..1222257) [1668 bp, 555 aa] ...    81   6e-15
Kpol_1064.31 s1064 complement(52651..54350) [1700 bp, 566.666666...    81   6e-15
YNL020C Chr14 complement(595623..597539) [1917 bp, 638 aa] {ON} ...    81   6e-15
Kpol_YGOB_1064.31 s1064 complement(52620..54350) [1731 bp, 577 a...    81   7e-15
Skud_9.134 Chr9 complement(256610..257728) [1119 bp, 372 aa] {ON...    80   7e-15
KAFR0G01200 Chr7 (273238..274761) [1524 bp, 507 aa] {ON} Anc_1.2...    81   7e-15
SAKL0C07744g Chr3 (720519..721799) [1281 bp, 426 aa] {ON} simila...    80   7e-15
KNAG0A02220 Chr1 complement(198240..199979) [1740 bp, 579 aa] {O...    81   7e-15
KNAG0B04500 Chr2 (865766..869089) [3324 bp, 1107 aa] {ON} Anc_5....    82   7e-15
NCAS0H01780 Chr8 complement(341549..344773) [3225 bp, 1074 aa] {...    82   7e-15
KLTH0F05918g Chr6 complement(525566..527254) [1689 bp, 562 aa] {...    81   7e-15
TBLA0B08650 Chr2 (2065061..2066308) [1248 bp, 415 aa] {ON} Anc_3...    80   7e-15
TPHA0G00730 Chr7 (139442..141364) [1923 bp, 640 aa] {ON} Anc_8.7...    81   7e-15
SAKL0C06666g Chr3 complement(628448..630367) [1920 bp, 639 aa] {...    81   7e-15
KAFR0F02190 Chr6 (428623..430095) [1473 bp, 490 aa] {ON} Anc_3.1...    80   8e-15
KNAG0B04460 Chr2 (856495..859461) [2967 bp, 988 aa] {ON} Anc_5.3...    82   8e-15
YJR059W Chr10 (545787..548243) [2457 bp, 818 aa] {ON}  PTK2Putat...    81   8e-15
Suva_14.327 Chr14 complement(578572..580470) [1899 bp, 632 aa] {...    81   8e-15
Smik_15.241 Chr15 (407598..408617) [1020 bp, 339 aa] {ON} YOR061...    79   8e-15
TPHA0E03850 Chr5 complement(810694..812142) [1449 bp, 482 aa] {O...    80   9e-15
TBLA0G00820 Chr7 complement(191559..192833) [1275 bp, 424 aa] {O...    80   9e-15
TPHA0H01300 Chr8 (293254..294282) [1029 bp, 342 aa] {ON} Anc_5.6...    79   9e-15
YHR082C Chr8 complement(268459..271548) [3090 bp, 1029 aa] {ON} ...    81   9e-15
NDAI0C01850 Chr3 (407978..411712) [3735 bp, 1244 aa] {ON}              81   9e-15
SAKL0G00990g Chr7 complement(89700..90824) [1125 bp, 374 aa] {ON...    79   1e-14
TPHA0F02150 Chr6 complement(475516..477768) [2253 bp, 750 aa] {O...    81   1e-14
TDEL0C00590 Chr3 complement(94223..99031) [4809 bp, 1602 aa] {ON...    81   1e-14
Skud_4.176 Chr4 complement(308461..309594) [1134 bp, 377 aa] {ON...    79   1e-14
KLTH0D08712g Chr4 complement(728072..729886) [1815 bp, 604 aa] {...    80   1e-14
KLTH0H01584g Chr8 (143065..144453) [1389 bp, 462 aa] {ON} simila...    80   1e-14
TBLA0C05800 Chr3 complement(1402262..1405207) [2946 bp, 981 aa] ...    81   1e-14
KLLA0F26983g Chr6 (2489326..2490729) [1404 bp, 467 aa] {ON} some...    79   1e-14
TBLA0A09370 Chr1 complement(2310412..2311443) [1032 bp, 343 aa] ...    78   2e-14
SAKL0H11352g Chr8 complement(975064..976857) [1794 bp, 597 aa] {...    80   2e-14
Kwal_56.24584 s56 complement(1063271..1064578) [1308 bp, 435 aa]...    79   2e-14
KLTH0E09658g Chr5 (869857..870957) [1101 bp, 366 aa] {ON} highly...    78   2e-14
KAFR0D04800 Chr4 complement(942369..944690) [2322 bp, 773 aa] {O...    80   2e-14
NDAI0C05160 Chr3 (1199533..1201026) [1494 bp, 497 aa] {ON} Anc_8...    79   2e-14
Smik_8.160 Chr8 complement(245207..248323) [3117 bp, 1038 aa] {O...    80   2e-14
Skud_16.239 Chr16 complement(438063..439727) [1665 bp, 554 aa] {...    79   2e-14
Ecym_7206 Chr7 complement(423402..425576) [2175 bp, 724 aa] {ON}...    80   2e-14
Suva_15.275 Chr15 complement(470782..473862) [3081 bp, 1026 aa] ...    80   2e-14
Suva_12.148 Chr12 (223571..225982) [2412 bp, 804 aa] {ON} YJR059...    80   2e-14
TBLA0J00250 Chr10 (42058..44457) [2400 bp, 799 aa] {ON} Anc_7.51...    80   2e-14
Ecym_5209 Chr5 complement(445530..448133) [2604 bp, 867 aa] {ON}...    80   2e-14
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    80   2e-14
KNAG0J00820 Chr10 complement(137927..141202) [3276 bp, 1091 aa] ...    80   2e-14
TPHA0H00750 Chr8 complement(150811..152043) [1233 bp, 410 aa] {O...    78   2e-14
YAR018C Chr1 complement(170396..171703) [1308 bp, 435 aa] {ON}  ...    79   2e-14
Kwal_55.21900 s55 complement(1027253..1029130) [1878 bp, 625 aa]...    79   2e-14
KLLA0D13266g Chr4 complement(1137750..1141208) [3459 bp, 1152 aa...    80   3e-14
CAGL0F03707g Chr6 complement(359839..361665) [1827 bp, 608 aa] {...    79   3e-14
KNAG0F03730 Chr6 complement(697517..699586) [2070 bp, 689 aa] {O...    79   3e-14
Suva_16.274 Chr16 complement(476249..477916) [1668 bp, 555 aa] {...    79   3e-14
KNAG0L01860 Chr12 (336795..337817) [1023 bp, 340 aa] {ON} Anc_5....    77   3e-14
TBLA0H01820 Chr8 (429920..433417) [3498 bp, 1165 aa] {ON} Anc_5....    80   3e-14
KAFR0B00520 Chr2 (105553..107502) [1950 bp, 649 aa] {ON} Anc_4.1...    79   3e-14
Skud_8.143 Chr8 complement(242422..245535) [3114 bp, 1037 aa] {O...    80   3e-14
ZYRO0F18062g Chr6 complement(1494752..1496167) [1416 bp, 471 aa]...    78   4e-14
TDEL0B02610 Chr2 complement(470263..471282) [1020 bp, 339 aa] {O...    77   4e-14
Skud_14.309 Chr14 complement(566344..568263) [1920 bp, 639 aa] {...    79   4e-14
CAGL0G02035g Chr7 (179911..180930) [1020 bp, 339 aa] {ON} highly...    77   4e-14
Skud_10.283 Chr10 (503324..505765) [2442 bp, 813 aa] {ON} YJR059...    79   4e-14
YPL042C Chr16 complement(473040..474707) [1668 bp, 555 aa] {ON} ...    79   4e-14
CAGL0I04422g Chr9 (394159..395427) [1269 bp, 422 aa] {ON} some s...    78   4e-14
ZYRO0A05192g Chr1 complement(416951..418198) [1248 bp, 415 aa] {...    77   4e-14
KLLA0F17006g Chr6 complement(1561859..1563106) [1248 bp, 415 aa]...    77   5e-14
Smik_16.193 Chr16 complement(350311..351978) [1668 bp, 555 aa] {...    78   5e-14
KAFR0A02560 Chr1 complement(532248..533351) [1104 bp, 367 aa] {O...    77   5e-14
CAGL0L12650g Chr12 (1360085..1361788) [1704 bp, 567 aa] {ON} sim...    78   6e-14
CAGL0M13167g Chr13 complement(1293074..1294906) [1833 bp, 610 aa...    78   6e-14
ADL102C Chr4 complement(503667..504785) [1119 bp, 372 aa] {ON} S...    77   6e-14
Suva_1.84 Chr1 complement(148430..149737) [1308 bp, 435 aa] {ON}...    77   6e-14
SAKL0F15510g Chr6 complement(1251475..1253373) [1899 bp, 632 aa]...    78   7e-14
KNAG0C03830 Chr3 (751393..752877) [1485 bp, 494 aa] {ON} Anc_7.3...    77   7e-14
SAKL0B11308g Chr2 complement(984543..986369) [1827 bp, 608 aa] {...    78   8e-14
Skud_1.73 Chr1 (144821..146128) [1308 bp, 435 aa] {ON} YAR018C (...    77   8e-14
Kpol_1035.40 s1035 (101912..102910,102960..102968,103011..106556...    79   8e-14
KLLA0D10527g Chr4 (892955..894892) [1938 bp, 645 aa] {ON} simila...    78   8e-14
ZYRO0D16170g Chr4 (1348849..1349982) [1134 bp, 377 aa] {ON} high...    76   8e-14
KNAG0G00280 Chr7 complement(43196..45262) [2067 bp, 688 aa] {ON}...    78   9e-14
Kpol_185.2 s185 complement(1614..3704) [2091 bp, 696 aa] {ON} co...    78   1e-13
SAKL0F07854g Chr6 (600324..601442) [1119 bp, 372 aa] {ON} highly...    76   1e-13
Kpol_1056.20 s1056 complement(44529..46724) [2196 bp, 731 aa] {O...    78   1e-13
YHR079C Chr8 complement(258244..261591) [3348 bp, 1115 aa] {ON} ...    78   1e-13
SAKL0B04752g Chr2 (416940..418259) [1320 bp, 439 aa] {ON} weakly...    77   1e-13
Smik_10.349 Chr10 (534756..537209) [2454 bp, 817 aa] {ON} YJR059...    78   1e-13
KAFR0E02850 Chr5 (575512..576786) [1275 bp, 424 aa] {ON} Anc_8.4...    76   2e-13
Smik_14.311 Chr14 complement(558013..559926) [1914 bp, 637 aa] {...    77   2e-13
CAGL0F03245g Chr6 complement(316924..320034) [3111 bp, 1036 aa] ...    77   2e-13
Smik_9.156 Chr9 complement(261998..263116) [1119 bp, 372 aa] {ON...    75   2e-13
ZYRO0B16038g Chr2 (1300484..1301515) [1032 bp, 343 aa] {ON} high...    75   2e-13
AGL249C Chr7 complement(234347..236092) [1746 bp, 581 aa] {ON} S...    77   2e-13
KNAG0H02860 Chr8 (531728..532843) [1116 bp, 371 aa] {ON}               75   2e-13
Suva_15.271 Chr15 complement(460466..463813) [3348 bp, 1115 aa] ...    77   2e-13
Kwal_47.18098 s47 (685497..686621) [1125 bp, 374 aa] {ON} YIL035...    75   2e-13
Skud_8.139 Chr8 complement(232178..235534) [3357 bp, 1118 aa] {O...    77   2e-13
Kpol_1013.52 s1013 (123332..125881) [2550 bp, 849 aa] {ON} (1233...    77   2e-13
NCAS0G03810 Chr7 complement(703842..705827) [1986 bp, 661 aa] {O...    76   2e-13
Smik_1.78 Chr1 complement(147996..149303) [1308 bp, 435 aa] {ON}...    75   2e-13
ABR177C Chr2 complement(735829..738090) [2262 bp, 753 aa] {ON} S...    76   3e-13
KNAG0D02790 Chr4 (507235..508848) [1614 bp, 537 aa] {ON} Anc_5.3...    75   3e-13
KAFR0A00840 Chr1 complement(151896..152894) [999 bp, 332 aa] {ON...    74   3e-13
KAFR0I01570 Chr9 (330982..332574) [1593 bp, 530 aa] {ON} Anc_2.5...    75   3e-13
Skud_11.20 Chr11 complement(51603..53558) [1956 bp, 651 aa] {ON}...    76   4e-13
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    76   4e-13
TBLA0B06940 Chr2 (1639189..1643520) [4332 bp, 1443 aa] {ON} Anc_...    76   4e-13
ABR088C Chr2 complement(546325..547920) [1596 bp, 531 aa] {ON} S...    75   4e-13
ZYRO0D01584g Chr4 (124739..126688) [1950 bp, 649 aa] {ON} some s...    75   4e-13
YKL198C Chr11 complement(68232..70220) [1989 bp, 662 aa] {ON}  P...    75   4e-13
Suva_9.165 Chr9 complement(276469..277587) [1119 bp, 372 aa] {ON...    74   4e-13
TDEL0H00560 Chr8 (94614..96500) [1887 bp, 628 aa] {ON} Anc_7.515...    75   5e-13
Kpol_1060.53 s1060 complement(126120..128330) [2211 bp, 736 aa] ...    75   5e-13
KNAG0H02020 Chr8 complement(357248..359026) [1779 bp, 592 aa] {O...    75   5e-13
KAFR0D04760 Chr4 complement(932849..936205) [3357 bp, 1118 aa] {...    75   5e-13
NCAS0B06260 Chr2 complement(1180650..1182821) [2172 bp, 723 aa] ...    75   6e-13
SAKL0E07722g Chr5 complement(625066..627441) [2376 bp, 791 aa] {...    75   6e-13
TPHA0K02030 Chr11 (432238..434505) [2268 bp, 755 aa] {ON} Anc_4....    75   6e-13
NDAI0A02720 Chr1 complement(612346..613455) [1110 bp, 369 aa] {O...    74   6e-13
Kwal_55.20221 s55 (304482..308006) [3525 bp, 1174 aa] {ON} YHR07...    75   6e-13
KAFR0H01040 Chr8 complement(189604..190860) [1257 bp, 418 aa] {O...    74   6e-13
TPHA0H01470 Chr8 complement(329451..333578) [4128 bp, 1375 aa] {...    75   6e-13
TDEL0H02380 Chr8 complement(399810..400931) [1122 bp, 373 aa] {O...    74   7e-13
TBLA0D00220 Chr4 (52218..54500) [2283 bp, 760 aa] {ON} Anc_2.96 ...    75   7e-13
KLTH0A03542g Chr1 (306667..307803) [1137 bp, 378 aa] {ON} highly...    74   8e-13
Kwal_33.14081 s33 complement(519343..521085) [1743 bp, 580 aa] {...    74   8e-13
Kpol_1035.34 s1035 (79914..80978) [1065 bp, 354 aa] {ON} (79914....    73   8e-13
TBLA0D01200 Chr4 (303528..305198) [1671 bp, 556 aa] {ON} Anc_8.7...    74   8e-13
Kpol_1063.4 s1063 complement(10790..11932) [1143 bp, 380 aa] {ON...    73   9e-13
TPHA0B02780 Chr2 complement(633307..634449) [1143 bp, 380 aa] {O...    73   9e-13
Suva_11.178 Chr11 complement(330253..332184) [1932 bp, 643 aa] {...    74   1e-12
Ecym_3323 Chr3 (618386..620632) [2247 bp, 748 aa] {ON} similar t...    74   1e-12
NDAI0F00560 Chr6 complement(128674..129717) [1044 bp, 347 aa] {O...    72   1e-12
NCAS0A13320 Chr1 (2622149..2623258) [1110 bp, 369 aa] {ON}             73   1e-12
NDAI0G00640 Chr7 (139655..141520) [1866 bp, 621 aa] {ON} Anc_2.284     74   1e-12
TDEL0G03220 Chr7 complement(600259..601350) [1092 bp, 363 aa] {O...    72   1e-12
TDEL0G02150 Chr7 (422718..424703) [1986 bp, 661 aa] {ON} Anc_2.2...    74   1e-12
TPHA0C01810 Chr3 complement(413495..414790) [1296 bp, 431 aa] {O...    73   1e-12
KAFR0C00430 Chr3 complement(88561..91410) [2850 bp, 949 aa] {ON}...    74   2e-12
Suva_11.24 Chr11 complement(52742..52930,52961..54523) [1752 bp,...    73   2e-12
Kpol_1067.14 s1067 (29413..31050) [1638 bp, 545 aa] {ON} (29413....    73   2e-12
TBLA0A03220 Chr1 complement(765108..768590) [3483 bp, 1160 aa] {...    74   2e-12
TPHA0A02630 Chr1 complement(562516..565164) [2649 bp, 882 aa] {O...    74   2e-12
KLLA0F16467g Chr6 (1519800..1520822) [1023 bp, 340 aa] {ON} high...    72   2e-12
Smik_11.24 Chr11 complement(52600..54522) [1923 bp, 640 aa] {ON}...    73   2e-12
KLLA0B11946g Chr2 complement(1048033..1049352) [1320 bp, 439 aa]...    72   2e-12
TBLA0E02590 Chr5 complement(651679..654864) [3186 bp, 1061 aa] {...    74   2e-12
Kwal_33.14554 s33 (717776..719920) [2145 bp, 714 aa] {ON} YNL161...    73   2e-12
KLTH0B06424g Chr2 complement(518184..520328) [2145 bp, 714 aa] {...    73   2e-12
KLTH0F18458g Chr6 complement(1491777..1493663) [1887 bp, 628 aa]...    73   3e-12
NDAI0E01960 Chr5 (397897..399717) [1821 bp, 606 aa] {ON} Anc_2.425     73   3e-12
Kpol_1039.33 s1039 complement(102096..104201) [2106 bp, 701 aa] ...    73   3e-12
ZYRO0F01034g Chr6 (80328..82826) [2499 bp, 832 aa] {ON} similar ...    73   3e-12
Suva_14.178 Chr14 (328862..331195) [2334 bp, 777 aa] {ON} YNL161...    73   3e-12
NDAI0G03150 Chr7 complement(741321..742463) [1143 bp, 380 aa] {O...    72   3e-12
AFR372W Chr6 (1109169..1111493) [2325 bp, 774 aa] {ON} Syntenic ...    73   3e-12
TBLA0B06510 Chr2 (1536156..1538489) [2334 bp, 777 aa] {ON} Anc_1...    73   3e-12
Suva_9.104 Chr9 (178011..180428) [2418 bp, 805 aa] {ON} YIL095W ...    73   3e-12
KLLA0D07810g Chr4 complement(669095..671251) [2157 bp, 718 aa] {...    73   3e-12
KLLA0B06501g Chr2 complement(576636..579089) [2454 bp, 817 aa] {...    73   4e-12
AEL179W Chr5 (302948..303817) [870 bp, 289 aa] {ON} NOHBY510; No...    70   4e-12
KLLA0F08877g Chr6 (825217..826182) [966 bp, 321 aa] {ON} uniprot...    70   4e-12
NDAI0F03200 Chr6 complement(770618..772924) [2307 bp, 768 aa] {O...    72   4e-12
KLLA0E08405g Chr5 complement(756205..758538) [2334 bp, 777 aa] {...    72   4e-12
TBLA0D05770 Chr4 (1424960..1427671) [2712 bp, 903 aa] {ON} Anc_1...    72   4e-12
Ecym_3160 Chr3 complement(304537..306957) [2421 bp, 806 aa] {ON}...    72   4e-12
Suva_6.268 Chr6 (470348..472519) [2172 bp, 723 aa] {ON} YJL187C ...    72   5e-12
AFR035W Chr6 (498529..500688) [2160 bp, 719 aa] {ON} Syntenic ho...    72   5e-12
Ecym_6400 Chr6 complement(779716..781983) [2268 bp, 755 aa] {ON}...    72   5e-12
ZYRO0G05214g Chr7 (420482..422980) [2499 bp, 832 aa] {ON} some s...    72   5e-12
KAFR0H03330 Chr8 complement(635910..637019) [1110 bp, 369 aa] {O...    71   5e-12
NDAI0C01890 Chr3 (419452..423777) [4326 bp, 1441 aa] {ON} Anc_5....    72   5e-12
Kwal_27.12559 s27 (1273349..1274593) [1245 bp, 414 aa] {ON} YPR0...    71   5e-12
Smik_14.167 Chr14 (311655..312284,312591..314228) [2268 bp, 755 ...    72   5e-12
YNL161W Chr14 (332597..334867) [2271 bp, 756 aa] {ON}  CBK1Serin...    72   6e-12
KAFR0F01630 Chr6 complement(323802..326057) [2256 bp, 751 aa] {O...    72   6e-12
NCAS0G00490 Chr7 complement(83953..84996) [1044 bp, 347 aa] {ON}...    70   6e-12
SAKL0E12342g Chr5 complement(1021369..1023795) [2427 bp, 808 aa]...    72   8e-12
TPHA0A04030 Chr1 (901665..904829) [3165 bp, 1054 aa] {ON} Anc_3....    72   8e-12
TPHA0A04570 Chr1 (1038551..1040674) [2124 bp, 707 aa] {ON} Anc_1...    72   8e-12
Skud_14.172 Chr14 (323327..325564) [2238 bp, 745 aa] {ON} YNL161...    72   8e-12
KNAG0F01440 Chr6 (261403..263685) [2283 bp, 760 aa] {ON}               71   9e-12
SAKL0C06248g Chr3 complement(577990..580185) [2196 bp, 731 aa] {...    71   9e-12
KAFR0F02730 Chr6 (537477..539309) [1833 bp, 610 aa] {ON} Anc_4.4...    71   9e-12
KAFR0A07370 Chr1 complement(1487868..1490012) [2145 bp, 714 aa] ...    71   9e-12
NCAS0I02680 Chr9 (498371..500752) [2382 bp, 793 aa] {ON}               71   9e-12
TDEL0F02980 Chr6 (539327..541549) [2223 bp, 740 aa] {ON} Anc_1.1...    71   1e-11
KLLA0B07579g Chr2 (659591..661759) [2169 bp, 722 aa] {ON} simila...    71   1e-11
TBLA0B10030 Chr2 (2399979..2402123) [2145 bp, 714 aa] {ON} Anc_4...    71   1e-11
Kpol_2001.10 s2001 (30724..33018) [2295 bp, 764 aa] {ON} (30724....    71   1e-11
Kpol_209.1 s209 (1823..5734) [3912 bp, 1303 aa] {ON} (1823..5734...    71   1e-11
YIL095W Chr9 (183937..186369) [2433 bp, 810 aa] {ON}  PRK1Protei...    71   1e-11
NCAS0E01560 Chr5 (294095..295345) [1251 bp, 416 aa] {ON}               70   1e-11
NDAI0G06240 Chr7 (1546580..1549282) [2703 bp, 900 aa] {ON} Anc_1...    71   1e-11
CAGL0I05896g Chr9 (560169..562505) [2337 bp, 778 aa] {ON} some s...    71   1e-11
YKL048C Chr11 complement(347214..349136) [1923 bp, 640 aa] {ON} ...    71   1e-11
Skud_10.30 Chr10 complement(51698..54124) [2427 bp, 808 aa] {ON}...    71   1e-11
NCAS0G02070 Chr7 (372747..374960) [2214 bp, 737 aa] {ON} Anc_2.96      71   1e-11
ZYRO0C12078g Chr3 (946320..948647) [2328 bp, 775 aa] {ON} simila...    71   1e-11
Smik_2.191 Chr2 complement(338792..342118) [3327 bp, 1108 aa] {O...    71   1e-11
CAGL0K00693g Chr11 complement(75466..78096) [2631 bp, 876 aa] {O...    71   1e-11
KNAG0C02250 Chr3 complement(444156..446639) [2484 bp, 827 aa] {O...    71   1e-11
YJL187C Chr10 complement(76803..79262) [2460 bp, 819 aa] {ON}  S...    70   2e-11
ADL043C Chr4 complement(612088..614109) [2022 bp, 673 aa] {ON} S...    70   2e-11
YBR059C Chr2 complement(356861..360187) [3327 bp, 1108 aa] {ON} ...    71   2e-11
TPHA0N01450 Chr14 complement(318088..320340) [2253 bp, 750 aa] {...    70   2e-11
Smik_9.84 Chr9 (162983..165409) [2427 bp, 808 aa] {ON} YIL095W (...    70   2e-11
Kwal_27.11542 s27 complement(841389..843764) [2376 bp, 791 aa] {...    70   2e-11
NCAS0H01740 Chr8 complement(331436..335284) [3849 bp, 1282 aa] {...    70   2e-11
TBLA0E02460 Chr5 (620609..621745) [1137 bp, 378 aa] {ON} Anc_7.2...    69   2e-11
NCAS0I03020 Chr9 (555481..557853) [2373 bp, 790 aa] {ON} Anc_1.149     70   2e-11
TPHA0C03380 Chr3 (740939..743032) [2094 bp, 697 aa] {ON} Anc_2.2...    70   2e-11
ZYRO0D10472g Chr4 (876899..880357) [3459 bp, 1152 aa] {ON} simil...    70   3e-11
CAGL0I05192g Chr9 complement(493635..494756) [1122 bp, 373 aa] {...    69   3e-11
YJL141C Chr10 complement(147967..150390) [2424 bp, 807 aa] {ON} ...    70   3e-11
AEL149C Chr5 complement(348350..350533) [2184 bp, 727 aa] {ON} S...    70   3e-11
CAGL0K11990g Chr11 complement(1156224..1159199) [2976 bp, 991 aa...    70   3e-11
NDAI0B00400 Chr2 (74403..76643) [2241 bp, 746 aa] {ON} Anc_1.149       69   4e-11
Ecym_2650 Chr2 complement(1257641..1260325) [2685 bp, 894 aa] {O...    69   4e-11
TBLA0J01200 Chr10 (271800..275420) [3621 bp, 1206 aa] {ON} Anc_1...    69   5e-11
TPHA0M01120 Chr13 complement(223548..225914) [2367 bp, 788 aa] {...    69   5e-11
TPHA0B03130 Chr2 complement(719624..721372) [1749 bp, 582 aa] {O...    69   5e-11
TBLA0I01930 Chr9 complement(436511..440596) [4086 bp, 1361 aa] {...    69   6e-11
KLLA0E04247g Chr5 (382874..383995) [1122 bp, 373 aa] {ON} simila...    67   6e-11
Ecym_2302 Chr2 (587299..588951) [1653 bp, 550 aa] {ON} similar t...    68   6e-11
CAGL0H10208g Chr8 complement(996853..999936) [3084 bp, 1027 aa] ...    69   6e-11
CAGL0G02607g Chr7 complement(240244..242310) [2067 bp, 688 aa] {...    69   6e-11
Kwal_33.13681 s33 complement(350547..352694) [2148 bp, 715 aa] {...    69   6e-11
ACR249C Chr3 complement(797020..798951) [1932 bp, 643 aa] {ON} S...    69   6e-11
KLTH0E03828g Chr5 (345775..349131) [3357 bp, 1118 aa] {ON} simil...    69   7e-11
SAKL0G08448g Chr7 (718250..721717) [3468 bp, 1155 aa] {ON} simil...    69   7e-11
TDEL0H00890 Chr8 complement(146908..149088) [2181 bp, 726 aa] {O...    68   7e-11
Smik_10.91 Chr10 complement(145745..148153) [2409 bp, 802 aa] {O...    68   8e-11
NDAI0H02930 Chr8 (715278..716846) [1569 bp, 522 aa] {ON} Anc_2.391     68   8e-11
KLTH0F05522g Chr6 complement(477035..478975) [1941 bp, 646 aa] {...    68   9e-11
NCAS0C03560 Chr3 complement(710551..712476) [1926 bp, 641 aa] {O...    68   1e-10
Skud_10.73 Chr10 complement(123049..125436) [2388 bp, 795 aa] {O...    68   1e-10
Kpol_1052.22 s1052 (72364..75669) [3306 bp, 1101 aa] {ON} (72364...    68   1e-10
KLLA0A05819g Chr1 (541545..543659) [2115 bp, 704 aa] {ON} simila...    68   1e-10
NDAI0A05700 Chr1 (1288604..1292077) [3474 bp, 1157 aa] {ON} Anc_...    68   1e-10
CAGL0K12496g Chr11 (1219220..1220302) [1083 bp, 360 aa] {ON} sim...    66   1e-10
Skud_11.181 Chr11 complement(326935..328845) [1911 bp, 636 aa] {...    67   1e-10
Suva_6.221 Chr6 (399862..400920,400924..402096) [2232 bp, 743 aa...    67   1e-10
AGR027C Chr7 complement(763303..766188) [2886 bp, 961 aa] {ON} S...    67   1e-10
Kwal_33.13984 s33 complement(471429..473378) [1950 bp, 649 aa] {...    67   2e-10
KAFR0A01040 Chr1 complement(197612..200350) [2739 bp, 912 aa] {O...    67   2e-10
KLTH0F03916g Chr6 complement(348177..350282) [2106 bp, 701 aa] {...    67   2e-10
Suva_4.297 Chr4 complement(523650..526973) [3324 bp, 1107 aa] {O...    67   2e-10
Smik_15.25 Chr15 complement(46541..47668) [1128 bp, 375 aa] {ON}...    66   2e-10
TPHA0M01500 Chr13 (317999..319291) [1293 bp, 430 aa] {ON} Anc_3....    66   2e-10
Skud_2.179 Chr2 complement(325193..328465) [3273 bp, 1090 aa] {O...    67   2e-10
YOL128C Chr15 complement(78352..79479) [1128 bp, 375 aa] {ON}  Y...    66   2e-10
KNAG0C02600 Chr3 complement(504486..507134) [2649 bp, 882 aa] {O...    67   2e-10
Kpol_2001.46 s2001 (127016..129376) [2361 bp, 786 aa] {ON} (1270...    67   3e-10
KNAG0I03000 Chr9 (596789..598840) [2052 bp, 683 aa] {ON} Anc_4.4...    67   3e-10
KAFR0J01370 Chr10 complement(250424..252766) [2343 bp, 780 aa] {...    67   3e-10
Kpol_376.5 s376 (6334..7767) [1434 bp, 477 aa] {ON} (6334..7767)...    66   3e-10
TPHA0D01540 Chr4 complement(316471..318594) [2124 bp, 707 aa] {O...    67   3e-10
ZYRO0C15862g Chr3 (1239992..1241305) [1314 bp, 437 aa] {ON} simi...    65   3e-10
TPHA0E02270 Chr5 (471696..472916) [1221 bp, 406 aa] {ON} Anc_5.2...    65   4e-10
KLTH0G10318g Chr7 (872129..874501) [2373 bp, 790 aa] {ON} simila...    66   4e-10
Suva_15.32 Chr15 complement(56314..57447) [1134 bp, 377 aa] {ON}...    65   4e-10
Kpol_251.4 s251 (5802..8318) [2517 bp, 838 aa] {ON} (5802..8318)...    66   4e-10
Smik_11.200 Chr11 complement(333676..335592) [1917 bp, 638 aa] {...    66   4e-10
Smik_10.45 Chr10 complement(74813..77278) [2466 bp, 821 aa] {ON}...    66   4e-10
NDAI0A05280 Chr1 complement(1191032..1192342) [1311 bp, 436 aa] ...    65   5e-10
TBLA0B09215 Chr2 complement(2180179..2181375) [1197 bp, 398 aa] ...    65   5e-10
ZYRO0G18590g Chr7 complement(1533974..1536202) [2229 bp, 742 aa]...    65   5e-10
ADL217W Chr4 (321491..323743) [2253 bp, 750 aa] {ON} Syntenic ho...    65   6e-10
Skud_9.78 Chr9 (160531..162960) [2430 bp, 809 aa] {ON} YIL095W (...    65   6e-10
SAKL0B07304g Chr2 (625541..627007) [1467 bp, 488 aa] {ON} simila...    65   6e-10
Ecym_8129 Chr8 (269437..271626) [2190 bp, 729 aa] {ON} similar t...    65   7e-10
NDAI0G01760 Chr7 (384420..385700) [1281 bp, 426 aa] {ON}               64   9e-10
NCAS0H03070 Chr8 complement(590494..592440) [1947 bp, 648 aa] {O...    65   9e-10
NCAS0A06000 Chr1 (1184842..1187133) [2292 bp, 763 aa] {ON} Anc_4...    65   1e-09
KAFR0F01940 Chr6 complement(379908..382283) [2376 bp, 791 aa] {O...    64   1e-09
SAKL0H24288g Chr8 (2099353..2101317) [1965 bp, 654 aa] {ON} simi...    64   1e-09
Kpol_1066.19 s1066 (31013..32806) [1794 bp, 597 aa] {OFF} (31013...    64   1e-09
Kpol_YGOB_1066.19 s1066 (30983..32806) [1824 bp, 607 aa] {ON} AN...    64   1e-09
ZYRO0D02970g Chr4 complement(231363..233669) [2307 bp, 768 aa] {...    64   1e-09
Kwal_47.17345 s47 complement(364905..367004) [2100 bp, 699 aa] {...    64   1e-09
KLLA0F01507g Chr6 (144356..145774) [1419 bp, 472 aa] {ON} some s...    64   1e-09
Kwal_26.7276 s26 (293129..295069) [1941 bp, 646 aa] {ON} YJL106W...    64   2e-09
KLTH0E15004g Chr5 (1328930..1330165) [1236 bp, 411 aa] {ON} simi...    63   2e-09
Suva_16.382 Chr16 (673009..674205) [1197 bp, 398 aa] {ON} YPR054...    63   2e-09
TBLA0D02510 Chr4 complement(626101..627234) [1134 bp, 377 aa] {O...    63   2e-09
NCAS0A11020 Chr1 (2193556..2194869) [1314 bp, 437 aa] {ON} Anc_3...    63   2e-09
NDAI0B03560 Chr2 complement(892839..895109) [2271 bp, 756 aa] {O...    64   2e-09
TBLA0A06670 Chr1 complement(1630701..1632023) [1323 bp, 440 aa] ...    63   2e-09
NCAS0A10590 Chr1 complement(2108142..2111429) [3288 bp, 1095 aa]...    64   2e-09
CAGL0D06600g Chr4 (626571..628748) [2178 bp, 725 aa] {ON} simila...    64   2e-09
Suva_10.55 Chr10 complement(110943..113177) [2235 bp, 744 aa] {O...    64   2e-09
Kwal_27.10945 s27 (565717..568524) [2808 bp, 935 aa] {ON} YBR059...    63   3e-09
Skud_15.25 Chr15 complement(43728..44864) [1137 bp, 378 aa] {ON}...    62   3e-09
NCAS0C03810 Chr3 complement(772530..773660) [1131 bp, 376 aa] {O...    62   3e-09
KLTH0E07128g Chr5 complement(657986..660064) [2079 bp, 692 aa] {...    63   3e-09
ADL315C Chr4 complement(146096..147400) [1305 bp, 434 aa] {ON} S...    62   3e-09
CAGL0D01694g Chr4 complement(176981..178279) [1299 bp, 432 aa] {...    62   3e-09
KLLA0F02838g Chr6 (264329..266596) [2268 bp, 755 aa] {ON} simila...    63   3e-09
KLTH0C07260g Chr3 (626334..629039) [2706 bp, 901 aa] {ON} simila...    63   4e-09
NDAI0G05790 Chr7 complement(1433294..1435252) [1959 bp, 652 aa] ...    63   4e-09
Skud_12.48 Chr12 complement(97218..99422) [2205 bp, 734 aa] {ON}...    63   4e-09
Smik_12.44 Chr12 complement(92046..94262) [2217 bp, 738 aa] {ON}...    62   5e-09
Kpol_2001.31 s2001 complement(90402..93110) [2709 bp, 902 aa] {O...    63   5e-09
SAKL0C04576g Chr3 complement(444365..446611) [2247 bp, 748 aa] {...    62   5e-09
NDAI0D02970 Chr4 (701299..704058) [2760 bp, 919 aa] {ON} Anc_4.4...    62   6e-09
Suva_11.52 Chr11 (112355..115156) [2802 bp, 933 aa] {ON} YKL171W...    62   6e-09
ZYRO0B00638g Chr2 (42738..44930) [2193 bp, 730 aa] {ON} similar ...    62   7e-09
KLTH0D03080g Chr4 (295808..297730) [1923 bp, 640 aa] {ON} simila...    62   7e-09
Smik_16.296 Chr16 (542962..544128) [1167 bp, 388 aa] {ON} YPR054...    61   8e-09
TBLA0G01910 Chr7 complement(500551..502596) [2046 bp, 681 aa] {O...    62   8e-09
Ecym_3488 Chr3 complement(915087..916400) [1314 bp, 437 aa] {ON}...    61   8e-09
TBLA0B05930 Chr2 (1400163..1402316) [2154 bp, 717 aa] {ON} Anc_2...    62   8e-09
TPHA0D00430 Chr4 complement(73651..74730) [1080 bp, 359 aa] {ON}...    61   8e-09
CAGL0J03432g Chr10 (330031..331899) [1869 bp, 622 aa] {ON} simil...    62   9e-09
KLLA0F18612g Chr6 (1711131..1713575) [2445 bp, 814 aa] {ON} some...    62   9e-09
YLL019C Chr12 complement(105686..107899) [2214 bp, 737 aa] {ON} ...    62   9e-09
Kpol_1027.1 s1027 (1..2088) [2088 bp, 695 aa] {ON} (1..2088) [20...    61   1e-08
Kwal_33.13825 s33 (409772..412477) [2706 bp, 901 aa] {ON} YKL171...    61   1e-08
TDEL0D03520 Chr4 (647828..650977) [3150 bp, 1049 aa] {ON} Anc_3....    61   1e-08
YPR054W Chr16 (666280..667446) [1167 bp, 388 aa] {ON}  SMK1Middl...    60   1e-08
KNAG0E03260 Chr5 complement(654134..655246) [1113 bp, 370 aa] {O...    60   1e-08
AFR150C Chr6 complement(707303..708352) [1050 bp, 349 aa] {ON} S...    60   1e-08
TDEL0F01550 Chr6 (282677..284839) [2163 bp, 720 aa] {ON} Anc_4.4...    61   1e-08
Suva_6.222 Chr6 (400975..402096) [1122 bp, 373 aa] {ON} YJL141C ...    60   1e-08
ZYRO0E06864g Chr5 complement(516731..520078) [3348 bp, 1115 aa] ...    61   2e-08
Skud_16.340 Chr16 (631100..632266) [1167 bp, 388 aa] {ON} YPR054...    60   2e-08
TBLA0B08810 Chr2 (2094401..2095375) [975 bp, 324 aa] {ON} Anc_2....    59   2e-08
TBLA0H02950 Chr8 complement(721123..723906) [2784 bp, 927 aa] {O...    61   2e-08
Skud_13.385 Chr13 complement(672612..674966) [2355 bp, 784 aa] {...    61   2e-08
AEL173W Chr5 (313261..314856) [1596 bp, 531 aa] {ON} Syntenic ho...    60   2e-08
Skud_11.54 Chr11 (113775..116570) [2796 bp, 931 aa] {ON} YKL171W...    61   2e-08
SAKL0D03234g Chr4 (262365..264941) [2577 bp, 858 aa] {ON} some s...    60   2e-08
TDEL0C04800 Chr3 (866157..867467) [1311 bp, 436 aa] {ON} Anc_3.3...    60   2e-08
KNAG0H01220 Chr8 (209884..212625) [2742 bp, 913 aa] {ON} Anc_3.2...    60   2e-08
Ecym_8380 Chr8 (772519..774573) [2055 bp, 684 aa] {ON} similar t...    60   2e-08
TDEL0E02600 Chr5 (501545..504934) [3390 bp, 1129 aa] {ON} Anc_5....    60   2e-08
Ecym_1502 Chr1 (1030765..1031838) [1074 bp, 357 aa] {ON} similar...    59   2e-08
ZYRO0F03190g Chr6 complement(270262..271371) [1110 bp, 369 aa] {...    59   2e-08
Ecym_8100 Chr8 complement(214001..216547) [2547 bp, 848 aa] {ON}...    60   3e-08
ZYRO0G20570g Chr7 (1695518..1697305) [1788 bp, 595 aa] {ON} simi...    60   3e-08
YJL057C Chr10 complement(328118..330121) [2004 bp, 667 aa] {ON} ...    60   4e-08
TDEL0D01930 Chr4 complement(373906..375753) [1848 bp, 615 aa] {O...    59   4e-08
YKL171W Chr11 (127475..130261) [2787 bp, 928 aa] {ON}  NNK1Prote...    60   4e-08
Smik_10.183 Chr10 complement(319743..321746) [2004 bp, 667 aa] {...    59   5e-08
KLTH0H10582g Chr8 (914695..916440) [1746 bp, 581 aa] {ON} weakly...    59   5e-08
TBLA0D05210 Chr4 (1279846..1282323) [2478 bp, 825 aa] {ON} Anc_1...    59   5e-08
Suva_6.133 Chr6 (221952..223955) [2004 bp, 667 aa] {ON} YJL057C ...    59   6e-08
SAKL0D05104g Chr4 (402641..404692) [2052 bp, 683 aa] {ON} simila...    59   6e-08
CAGL0M08316g Chr13 (829069..831963) [2895 bp, 964 aa] {ON} weakl...    59   6e-08
YFL029C Chr6 complement(78055..79161) [1107 bp, 368 aa] {ON}  CA...    58   7e-08
Kwal_14.2554 s14 (811455..813233) [1779 bp, 592 aa] {ON} YJL057C...    59   7e-08
KLLA0F22297g Chr6 complement(2083448..2085547) [2100 bp, 699 aa]...    59   8e-08
Suva_13.399 Chr13 complement(679223..681388) [2166 bp, 721 aa] {...    59   8e-08
TDEL0C00660 Chr3 complement(107849..108952) [1104 bp, 367 aa] {O...    58   8e-08
KNAG0H00560 Chr8 (89502..91268) [1767 bp, 588 aa] {ON} Anc_2.597...    58   9e-08
Ecym_6294 Chr6 complement(551351..552982) [1632 bp, 543 aa] {ON}...    58   9e-08
KNAG0H00790 Chr8 complement(124926..126131) [1206 bp, 401 aa] {O...    57   1e-07
YMR216C Chr13 complement(698811..701039) [2229 bp, 742 aa] {ON} ...    58   1e-07
SAKL0D06820g Chr4 (566145..567938) [1794 bp, 597 aa] {ON} simila...    58   1e-07
Skud_10.153 Chr10 (288733..290742) [2010 bp, 669 aa] {ON} YJL057...    58   1e-07
SAKL0B01474g Chr2 complement(145734..146777) [1044 bp, 347 aa] {...    57   1e-07
Kpol_413.7 s413 complement(18363..20267) [1905 bp, 634 aa] {ON} ...    58   1e-07
CAGL0J05082g Chr10 (483782..485743) [1962 bp, 653 aa] {ON} simil...    58   1e-07
Kpol_1051.42 s1051 (98030..99379,99382..100212) [2181 bp, 726 aa...    57   2e-07
Skud_6.41 Chr6 complement(81310..82416) [1107 bp, 368 aa] {ON} Y...    57   2e-07
Smik_11.58 Chr11 (112932..115715) [2784 bp, 927 aa] {ON} YKL171W...    57   2e-07
Kpol_1003.35 s1003 (89266..91407) [2142 bp, 713 aa] {ON} (89266....    57   2e-07
ZYRO0A01848g Chr1 (152134..154248) [2115 bp, 704 aa] {ON} simila...    57   2e-07
Smik_13.424 Chr13 complement(682907..685177) [2271 bp, 756 aa] {...    57   2e-07
AEL120W Chr5 (396394..398715) [2322 bp, 773 aa] {ON} Syntenic ho...    57   2e-07
KAFR0C03480 Chr3 (708186..709277) [1092 bp, 363 aa] {ON} Anc_8.4...    56   2e-07
Smik_6.49 Chr6 complement(93305..94408) [1104 bp, 367 aa] {ON} Y...    56   3e-07
NCAS0A09170 Chr1 (1813960..1815846) [1887 bp, 628 aa] {ON} Anc_1...    57   3e-07
KAFR0F01150 Chr6 complement(218711..219811) [1101 bp, 366 aa] {O...    55   4e-07
CAGL0F03905g Chr6 complement(377962..380088) [2127 bp, 708 aa] {...    56   4e-07
NCAS0A09570 Chr1 complement(1907017..1909200) [2184 bp, 727 aa] ...    56   5e-07
TPHA0I02660 Chr9 (582108..584219) [2112 bp, 703 aa] {ON} Anc_1.3...    56   5e-07
TBLA0A02240 Chr1 (539297..540538) [1242 bp, 413 aa] {ON} Anc_6.2...    55   6e-07
TDEL0D01220 Chr4 complement(228529..230451) [1923 bp, 640 aa] {O...    55   6e-07
NCAS0B08320 Chr2 complement(1585766..1588471) [2706 bp, 901 aa] ...    55   7e-07
Suva_6.29 Chr6 complement(51588..52691) [1104 bp, 367 aa] {ON} Y...    55   7e-07
KNAG0B01670 Chr2 (307587..309860) [2274 bp, 757 aa] {ON} Anc_1.2...    55   7e-07
CAGL0G04455g Chr7 (426386..428641) [2256 bp, 751 aa] {ON} simila...    55   9e-07
NDAI0K01030 Chr11 (239418..241712) [2295 bp, 764 aa] {ON} Anc_8....    55   1e-06
YJL106W Chr10 (221390..223327) [1938 bp, 645 aa] {ON}  IME2Serin...    55   1e-06
Suva_6.182 Chr6 complement(328699..330642) [1944 bp, 647 aa] {ON...    55   1e-06
Smik_10.132 Chr10 (212933..214873) [1941 bp, 646 aa] {ON} YJL106...    55   1e-06
KLLA0A06776g Chr1 (612115..614517) [2403 bp, 800 aa] {ON} simila...    55   1e-06
Ecym_6359 Chr6 complement(699564..702176) [2613 bp, 870 aa] {ON}...    54   1e-06
Skud_10.107 Chr10 (189314..191254) [1941 bp, 646 aa] {ON} YJL106...    54   1e-06
KLTH0F04686g Chr6 (413669..416209) [2541 bp, 846 aa] {ON} weakly...    54   2e-06
Kpol_1002.21 s1002 complement(62702..63895) [1194 bp, 397 aa] {O...    54   2e-06
TBLA0J01000 Chr10 complement(227869..231072) [3204 bp, 1067 aa] ...    54   2e-06
AFR076W Chr6 (564252..566714) [2463 bp, 820 aa] {ON} Syntenic ho...    54   2e-06
TPHA0A02760 Chr1 (594482..597502) [3021 bp, 1006 aa] {ON} Anc_1....    54   3e-06
KLTH0B02178g Chr2 (171582..174551) [2970 bp, 989 aa] {ON} simila...    54   3e-06
AFL143C Chr6 complement(164241..165326) [1086 bp, 361 aa] {ON} S...    53   3e-06
Skud_16.42 Chr16 complement(75193..76287) [1095 bp, 364 aa] {ON}...    53   3e-06
TPHA0I00820 Chr9 (177222..179651) [2430 bp, 809 aa] {ON} Anc_1.2...    53   4e-06
TDEL0B03770 Chr2 (676581..678575) [1995 bp, 664 aa] {ON} Anc_8.7...    53   4e-06
ZYRO0A06182g Chr1 (493846..496062) [2217 bp, 738 aa] {ON} simila...    53   4e-06
Kpol_1064.42 s1064 complement(78573..80207) [1635 bp, 544 aa] {O...    53   4e-06
SAKL0C05236g Chr3 (498347..501385) [3039 bp, 1012 aa] {ON} simil...    53   5e-06
TBLA0B06620 Chr2 complement(1556378..1559671) [3294 bp, 1097 aa]...    53   5e-06
ZYRO0E07876g Chr5 (616134..617243) [1110 bp, 369 aa] {ON} simila...    52   6e-06
KNAG0A07560 Chr1 (1186540..1187550) [1011 bp, 336 aa] {ON} Anc_3...    52   7e-06
KAFR0A01340 Chr1 (259300..261171) [1872 bp, 623 aa] {ON} Anc_1.2...    52   7e-06
TBLA0D01110 Chr4 (283160..285640) [2481 bp, 826 aa] {ON} Anc_8.7...    52   7e-06
Kwal_33.15381 s33 complement(1080902..1083868) [2967 bp, 988 aa]...    52   7e-06
KNAG0B05340 Chr2 complement(1031600..1033588) [1989 bp, 662 aa] ...    52   7e-06
Suva_16.70 Chr16 complement(110631..111725) [1095 bp, 364 aa] {O...    51   8e-06
Smik_6.441 Chr6 (721619..722713) [1095 bp, 364 aa] {ON} YPL236C ...    51   1e-05
NDAI0C00570 Chr3 (108274..110547) [2274 bp, 757 aa] {ON}               52   1e-05
TDEL0C03760 Chr3 complement(661391..663895) [2505 bp, 834 aa] {O...    51   1e-05
Kwal_14.1249 s14 (252877..253911) [1035 bp, 344 aa] {ON} YFL029C...    50   2e-05
CAGL0H08437g Chr8 complement(825191..829423) [4233 bp, 1410 aa] ...    51   2e-05
Kpol_463.19 s463 complement(53246..55561) [2316 bp, 771 aa] {ON}...    51   2e-05
NDAI0G05370 Chr7 (1313015..1315555) [2541 bp, 846 aa] {ON} Anc_1...    51   2e-05
NDAI0F01340 Chr6 complement(327928..329148) [1221 bp, 406 aa] {O...    50   2e-05
AER348C Chr5 complement(1275897..1277774) [1878 bp, 625 aa] {ON}...    50   2e-05
KNAG0A05430 Chr1 complement(800787..803153) [2367 bp, 788 aa] {O...    50   4e-05
Kwal_56.24274 s56 (932404..933444) [1041 bp, 346 aa] {ON} YPL236...    49   4e-05
KAFR0A01740 Chr1 complement(356086..358035) [1950 bp, 649 aa] {O...    50   4e-05
TPHA0G01380 Chr7 (279600..281579) [1980 bp, 659 aa] {ON} Anc_8.7...    50   4e-05
TPHA0A03700 Chr1 complement(808996..813273) [4278 bp, 1425 aa] {...    50   4e-05
KLTH0G18282g Chr7 complement(1576512..1577558) [1047 bp, 348 aa]...    49   5e-05
ZYRO0G17094g Chr7 complement(1404552..1406804) [2253 bp, 750 aa]...    49   5e-05
SAKL0H05214g Chr8 (468419..470185) [1767 bp, 588 aa] {ON} simila...    49   5e-05
YPL236C Chr16 complement(101608..102702) [1095 bp, 364 aa] {ON} ...    49   6e-05
NCAS0C01030 Chr3 (192001..194043) [2043 bp, 680 aa] {ON} Anc_8.732     49   6e-05
NCAS0I01210 Chr9 complement(218242..222582) [4341 bp, 1446 aa] {...    49   6e-05
NDAI0A00920 Chr1 (189693..192521) [2829 bp, 942 aa] {ON} Anc_1.1...    49   7e-05
TDEL0A06750 Chr1 (1179818..1180936) [1119 bp, 372 aa] {ON} Anc_6...    48   1e-04
KLTH0D02970g Chr4 complement(284533..285945) [1413 bp, 470 aa] {...    48   1e-04
Kwal_26.6921 s26 (123345..123875) [531 bp, 176 aa] {OFF} YOR351C...    46   1e-04
NDAI0A07790 Chr1 (1790683..1795206) [4524 bp, 1507 aa] {ON} Anc_...    48   1e-04
Ecym_6239 Chr6 complement(445704..447791) [2088 bp, 695 aa] {ON}...    48   1e-04
KLTH0D12518g Chr4 complement(1023214..1024992) [1779 bp, 592 aa]...    48   2e-04
KLTH0E15026g Chr5 (1331171..1335730) [4560 bp, 1519 aa] {ON} sim...    48   2e-04
TPHA0H01880 Chr8 (441140..442402) [1263 bp, 420 aa] {ON} Anc_6.2...    47   2e-04
CAGL0G01716g Chr7 complement(155248..156390) [1143 bp, 380 aa] {...    47   2e-04
Kwal_26.9032 s26 complement(1047382..1049157) [1776 bp, 591 aa] ...    47   2e-04
AEL330C Chr5 complement(27521..28105) [585 bp, 194 aa] {ON} Synt...    45   2e-04
SAKL0H10340g Chr8 complement(883790..886009) [2220 bp, 739 aa] {...    47   3e-04
CAGL0H00979g Chr8 complement(94328..95527) [1200 bp, 399 aa] {ON...    47   3e-04
KNAG0J02030 Chr10 complement(368141..370327) [2187 bp, 728 aa] {...    47   3e-04
NCAS0G01210 Chr7 complement(215860..216963) [1104 bp, 367 aa] {O...    46   3e-04
KAFR0F02310 Chr6 (452380..453912) [1533 bp, 510 aa] {ON} Anc_3.1...    46   4e-04
Kpol_538.20 s538 (39404..42382) [2979 bp, 992 aa] {ON} (39404..4...    46   5e-04
SAKL0A03344g Chr1 complement(305149..306243) [1095 bp, 364 aa] {...    45   5e-04
NDAI0D02140 Chr4 complement(496708..499785) [3078 bp, 1025 aa] {...    46   6e-04
Ecym_2153 Chr2 complement(287697..288788) [1092 bp, 363 aa] {ON}...    45   6e-04
SAKL0B07326g Chr2 (627224..631477) [4254 bp, 1417 aa] {ON} simil...    46   8e-04
KLLA0B11924g Chr2 complement(1043344..1047582) [4239 bp, 1412 aa...    46   8e-04
ZYRO0F09174g Chr6 complement(744109..745638) [1530 bp, 509 aa] {...    45   0.001
KLTH0E15972g Chr5 complement(1414595..1416016) [1422 bp, 473 aa]...    45   0.001
KLLA0C07216g Chr3 (626227..628278) [2052 bp, 683 aa] {ON} simila...    45   0.001
CAGL0I08899g Chr9 complement(863906..866701) [2796 bp, 931 aa] {...    45   0.001
KNAG0D00830 Chr4 complement(130823..131986) [1164 bp, 387 aa] {O...    44   0.001
NCAS0A07080 Chr1 complement(1400590..1403607) [3018 bp, 1005 aa]...    45   0.001
TDEL0D04390 Chr4 complement(799835..801340) [1506 bp, 501 aa] {O...    44   0.002
KAFR0B03270 Chr2 complement(677477..679231) [1755 bp, 584 aa] {O...    44   0.002
KLTH0H03080g Chr8 complement(274038..275078) [1041 bp, 346 aa] {...    44   0.002
TBLA0A02040 Chr1 complement(493305..495056) [1752 bp, 583 aa] {O...    44   0.003
ZYRO0G12232g Chr7 (964508..967591) [3084 bp, 1027 aa] {ON} simil...    44   0.003
Ecym_3487 Chr3 complement(910575..914810) [4236 bp, 1411 aa] {ON...    44   0.003
TBLA0F01730 Chr6 complement(431961..433004) [1044 bp, 347 aa] {O...    43   0.004
Suva_7.258 Chr7 (445704..447911) [2208 bp, 735 aa] {ON} YGL021W ...    43   0.004
KNAG0J02520 Chr10 (472464..476795) [4332 bp, 1443 aa] {ON} Anc_3...    43   0.004
Kpol_1010.68 s1010 complement(168093..169595) [1503 bp, 500 aa] ...    43   0.005
TPHA0G00610 Chr7 (114519..116138) [1620 bp, 539 aa] {ON} Anc_8.7...    42   0.006
KNAG0K01660 Chr11 complement(345808..347331) [1524 bp, 507 aa] {...    42   0.006
TBLA0A06660 Chr1 complement(1626147..1630400) [4254 bp, 1417 aa]...    43   0.006
CAGL0K01815g Chr11 (162973..164487) [1515 bp, 504 aa] {ON} simil...    42   0.007
Kpol_1002.61 s1002 complement(167383..169851) [2469 bp, 822 aa] ...    42   0.007
YPR106W Chr16 (740061..741392) [1332 bp, 443 aa] {ON}  ISR1Predi...    42   0.007
Skud_7.266 Chr7 (458004..460217) [2214 bp, 737 aa] {ON} YGL021W ...    42   0.007
TDEL0E04680 Chr5 complement(875878..878862) [2985 bp, 994 aa] {O...    42   0.008
SAKL0C07876g Chr3 (732534..733970) [1437 bp, 478 aa] {ON} simila...    42   0.009
Skud_2.225 Chr2 (405095..409459) [4365 bp, 1454 aa] {ON} YBR097W...    42   0.010
ZYRO0A05060g Chr1 complement(405402..406886) [1485 bp, 494 aa] {...    42   0.010
Ecym_8210 Chr8 (431406..434297) [2892 bp, 963 aa] {ON} similar t...    42   0.010
YBR097W Chr2 (436951..441315) [4365 bp, 1454 aa] {ON}  VPS15Myri...    42   0.011
Smik_2.239 Chr2 (421843..426207) [4365 bp, 1454 aa] {ON} YBR097W...    42   0.011
NCAS0A01090 Chr1 (216576..218042) [1467 bp, 488 aa] {ON} Anc_6.215     42   0.011
AGR315C Chr7 complement(1319993..1322872) [2880 bp, 959 aa] {ON}...    42   0.011
TPHA0A04330 Chr1 (974713..976218) [1506 bp, 501 aa] {ON} Anc_3.1...    42   0.012
Smik_4.218 Chr4 (406174..407697) [1524 bp, 507 aa] {ON} YDL017W ...    42   0.012
TBLA0B01650 Chr2 (370837..372306) [1470 bp, 489 aa] {ON} Anc_3.1...    41   0.013
Suva_4.232 Chr4 (417104..418627) [1524 bp, 507 aa] {ON} YDL017W ...    41   0.015
Kwal_27.9804 s27 (69307..70728) [1422 bp, 473 aa] {ON} YDL017W (...    41   0.017
Kpol_1065.32 s1065 complement(65735..70255) [4521 bp, 1506 aa] {...    41   0.018
SAKL0G13882g Chr7 complement(1191656..1194604) [2949 bp, 982 aa]...    41   0.019
YGL021W Chr7 (454785..457067) [2283 bp, 760 aa] {ON}  ALK1Protei...    41   0.019
KLLA0C04345g Chr3 (397899..399326) [1428 bp, 475 aa] {ON} simila...    41   0.021
YDL017W Chr4 (424209..425732) [1524 bp, 507 aa] {ON}  CDC7DDK (D...    40   0.026
NCAS0I01870 Chr9 (345214..346866) [1653 bp, 550 aa] {ON} Anc_3.1...    40   0.028
KAFR0G01670 Chr7 (363200..367459) [4260 bp, 1419 aa] {ON} Anc_3....    40   0.028
Suva_4.344 Chr4 (606007..610371) [4365 bp, 1454 aa] {ON} YBR097W...    40   0.029
TPHA0E02830 Chr5 (591805..593364) [1560 bp, 519 aa] {ON} Anc_6.2...    40   0.029
Kwal_27.12562 s27 (1274883..1279139) [4257 bp, 1418 aa] {ON} YBR...    40   0.031
AER216C Chr5 complement(1032840..1034348) [1509 bp, 502 aa] {ON}...    40   0.032
Ecym_5258 Chr5 (536868..538376) [1509 bp, 502 aa] {ON} similar t...    40   0.034
KLLA0F22605g Chr6 complement(2109034..2111913) [2880 bp, 959 aa]...    40   0.035
NDAI0F01640 Chr6 (401323..403086) [1764 bp, 587 aa] {ON} Anc_6.215     40   0.038
Kwal_26.7237 s26 complement(276089..277318) [1230 bp, 409 aa] {O...    40   0.039
CAGL0H03245g Chr8 (303335..305686) [2352 bp, 783 aa] {ON} simila...    40   0.045
Smik_7.269 Chr7 (446854..449094) [2241 bp, 746 aa] {ON} YGL021W ...    40   0.048
Skud_4.237 Chr4 (418979..420502) [1524 bp, 507 aa] {ON} YDL017W ...    39   0.050
TPHA0I01240 Chr9 (283537..285210) [1674 bp, 557 aa] {ON} Anc_2.1...    40   0.051
TPHA0J02370 Chr10 complement(523628..525016) [1389 bp, 462 aa] {...    39   0.051
ZYRO0G08866g Chr7 complement(713156..714661) [1506 bp, 501 aa] {...    39   0.053
TDEL0G01540 Chr7 complement(303940..306300) [2361 bp, 786 aa] {O...    39   0.060
NDAI0A06470 Chr1 (1470263..1472083) [1821 bp, 606 aa] {ON} Anc_3...    39   0.068
Kpol_1033.51 s1033 complement(127843..129165) [1323 bp, 440 aa] ...    39   0.072
Ecym_2202 Chr2 (399184..400629) [1446 bp, 481 aa] {ON} similar t...    39   0.075
TPHA0J02290 Chr10 (508389..510779) [2391 bp, 796 aa] {ON} Anc_6....    39   0.10 
KAFR0C02290 Chr3 complement(449963..451204) [1242 bp, 413 aa] {O...    38   0.11 
Suva_15.332 Chr15 complement(575263..575547,575959..576084,57614...    38   0.12 
Kwal_56.23723 s56 complement(676986..677432) [447 bp, 149 aa] {O...    37   0.12 
KNAG0E03740 Chr5 complement(738877..741528) [2652 bp, 883 aa] {O...    39   0.13 
YGR188C Chr7 complement(872044..875109) [3066 bp, 1021 aa] {ON} ...    38   0.14 
AFL091W Chr6 (272431..273867) [1437 bp, 478 aa] {ON} Syntenic ho...    38   0.16 
NCAS0D03820 Chr4 complement(708820..710241) [1422 bp, 473 aa] {O...    38   0.18 
Ecym_2618 Chr2 (1196140..1197453) [1314 bp, 437 aa] {ON} similar...    38   0.18 
KAFR0K00320 Chr11 (72569..73942) [1374 bp, 457 aa] {ON} Anc_6.21...    37   0.19 
YHR135C Chr8 complement(372694..374310) [1617 bp, 538 aa] {ON}  ...    38   0.19 
KAFR0K00880 Chr11 (188439..191069) [2631 bp, 876 aa] {ON} Anc_5....    38   0.20 
CAGL0J05940g Chr10 (562687..564147) [1461 bp, 486 aa] {ON} simil...    37   0.22 
Skud_7.199 Chr7 (356300..358714) [2415 bp, 804 aa] {ON} YGL083W ...    37   0.23 
CAGL0H03553g Chr8 complement(328668..330155) [1488 bp, 495 aa] {...    37   0.24 
Skud_8.196 Chr8 complement(346056..346463,346494..347684) [1599 ...    37   0.26 
Suva_7.481 Chr7 complement(829537..832644) [3108 bp, 1035 aa] {O...    37   0.26 
KLTH0H04158g Chr8 (378344..379798) [1455 bp, 484 aa] {ON} simila...    37   0.27 
Suva_16.102 Chr16 (173734..175209) [1476 bp, 491 aa] {ON} YPL204...    37   0.28 
Smik_6.409 Chr6 complement(658629..660119) [1491 bp, 496 aa] {ON...    37   0.28 
SAKL0A04444g Chr1 (412103..413527) [1425 bp, 474 aa] {ON} highly...    37   0.29 
ZYRO0C15884g Chr3 (1241605..1245873) [4269 bp, 1422 aa] {ON} sim...    37   0.30 
Kwal_56.24064 s56 complement(831165..832592) [1428 bp, 475 aa] {...    37   0.32 
AFR040W Chr6 (505602..507245) [1644 bp, 547 aa] {ON} Syntenic ho...    37   0.32 
CAGL0G06138g Chr7 complement(585585..587204) [1620 bp, 539 aa] {...    37   0.32 
TDEL0E05230 Chr5 complement(958851..960323) [1473 bp, 490 aa] {O...    37   0.32 
KAFR0D04250 Chr4 (837888..839207) [1320 bp, 439 aa] {ON} Anc_3.4...    37   0.34 
Skud_7.518 Chr7 complement(847291..850359) [3069 bp, 1022 aa] {O...    37   0.37 
Suva_16.433 Chr16 (747883..749205) [1323 bp, 440 aa] {ON} YPR106...    37   0.39 
KNAG0F01490 Chr6 (270931..272604) [1674 bp, 557 aa] {ON} Anc_2.1...    37   0.40 
YPL204W Chr16 (164276..165760) [1485 bp, 494 aa] {ON}  HRR25Prot...    37   0.41 
Skud_16.75 Chr16 (137624..139108) [1485 bp, 494 aa] {ON} YPL204W...    36   0.45 
KAFR0A07320 Chr1 complement(1478564..1480033) [1470 bp, 489 aa] ...    36   0.48 
NDAI0B04530 Chr2 complement(1128472..1130094) [1623 bp, 540 aa] ...    36   0.50 
NDAI0I01070 Chr9 (259836..261278) [1443 bp, 480 aa] {ON} Anc_6.215     36   0.50 
Smik_6.306 Chr6 complement(480942..484031) [3090 bp, 1029 aa] {O...    37   0.51 
NCAS0B07200 Chr2 complement(1363351..1364940) [1590 bp, 529 aa] ...    36   0.52 
Smik_16.346 Chr16 (617471..618802) [1332 bp, 443 aa] {ON} YPR106...    36   0.60 
KNAG0D01130 Chr4 (190658..191947) [1290 bp, 429 aa] {ON} Anc_6.2...    36   0.62 
Smik_8.216 Chr8 complement(349478..351145) [1668 bp, 555 aa] {ON...    36   0.65 
KLLA0D03168g Chr4 (265761..267278) [1518 bp, 505 aa] {ON} simila...    36   0.65 
Smik_14.174 Chr14 complement(323054..324709) [1656 bp, 551 aa] {...    36   0.74 
Skud_14.179 Chr14 complement(334239..335924) [1686 bp, 561 aa] {...    35   0.84 
YNL154C Chr14 complement(343636..345276) [1641 bp, 546 aa] {ON} ...    35   0.85 
NCAS0G02120 Chr7 (381894..383465) [1572 bp, 523 aa] {ON} Anc_2.105     35   0.89 
KNAG0H03710 Chr8 complement(687550..689184) [1635 bp, 544 aa] {O...    35   0.89 
NDAI0F03150 Chr6 complement(757283..758923) [1641 bp, 546 aa] {O...    35   0.94 
Kpol_1027.20 s1027 complement(43412..44974) [1563 bp, 520 aa] {O...    35   0.95 
Skud_16.391 Chr16 (704392..705723) [1332 bp, 443 aa] {ON} YPR106...    35   0.96 
KNAG0F01980 Chr6 (379013..380368) [1356 bp, 451 aa] {ON} Anc_6.2...    35   1.2  
Suva_14.185 Chr14 complement(340104..341789) [1686 bp, 561 aa] {...    35   1.2  
SAKL0B09350g Chr2 (793524..794798) [1275 bp, 424 aa] {ON} weakly...    35   1.2  
Ecym_6176 Chr6 complement(323400..326809,326910..326979) [3480 b...    35   1.3  
KLLA0D11044g Chr4 complement(942458..944068) [1611 bp, 536 aa] {...    35   1.4  
TPHA0J03180 Chr10 complement(691886..694882) [2997 bp, 998 aa] {...    35   1.4  
Kpol_1002.53 s1002 (150289..151668) [1380 bp, 459 aa] {ON} (1502...    35   1.5  
ZYRO0G05412g Chr7 (435657..437408) [1752 bp, 583 aa] {ON} simila...    35   1.6  
SAKL0E12100g Chr5 complement(1004036..1005622) [1587 bp, 528 aa]...    35   1.7  
TBLA0D00250 Chr4 (61918..63618) [1701 bp, 566 aa] {ON} Anc_2.105...    34   2.3  
ZYRO0G08316g Chr7 (677123..679465) [2343 bp, 780 aa] {ON} simila...    34   2.3  
TBLA0B05310 Chr2 complement(1251914..1253494) [1581 bp, 526 aa] ...    34   2.3  
KNAG0F02100 Chr6 complement(399443..401944) [2502 bp, 833 aa] {O...    34   2.4  
CAGL0H00891g Chr8 complement(85886..90313) [4428 bp, 1475 aa] {O...    34   2.4  
KAFR0F00520 Chr6 (111106..112659) [1554 bp, 517 aa] {ON} Anc_2.1...    33   3.0  
NCAS0D03690 Chr4 (688360..690804) [2445 bp, 814 aa] {ON} Anc_6.1...    34   3.2  
KLLA0E19207g Chr5 (1709335..1711638) [2304 bp, 767 aa] {ON} simi...    33   3.9  
TDEL0F00910 Chr6 (157379..159070) [1692 bp, 563 aa] {ON} Anc_2.1...    33   4.6  
NCAS0D02050 Chr4 complement(377577..379115) [1539 bp, 512 aa] {O...    33   5.0  
KLTH0B06204g Chr2 complement(502282..503778) [1497 bp, 498 aa] {...    33   5.9  
NCAS0F02230 Chr6 complement(444624..447479) [2856 bp, 951 aa] {O...    33   6.3  
Kwal_33.14596 s33 (735962..737464) [1503 bp, 500 aa] {ON} YNL154...    33   6.4  
Smik_7.200 Chr7 (347450..349864) [2415 bp, 804 aa] {ON} YGL083W ...    32   9.9  

>Kpol_2002.46 s2002 (95107..98478) [3372 bp, 1123 aa] {ON}
            (95107..98478) [3372 nt, 1124 aa]
          Length = 1123

 Score = 2029 bits (5257), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1015/1123 (90%), Positives = 1015/1123 (90%)

Query: 1    MISSNKGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXX 60
            MISSNKGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVI          
Sbjct: 1    MISSNKGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVISKSVFSSMGN 60

Query: 61   XXXXXXXTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLL 120
                   TPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLL
Sbjct: 61   NSSMVSSTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLL 120

Query: 121  VEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALET 180
            VEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALET
Sbjct: 121  VEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALET 180

Query: 181  EDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLL 240
            EDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLL
Sbjct: 181  EDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLL 240

Query: 241  LKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIR 300
            LKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIR
Sbjct: 241  LKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIR 300

Query: 301  NLPREDTYLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYAL 360
            NLPREDTYLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYAL
Sbjct: 301  NLPREDTYLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYAL 360

Query: 361  LYRFKVDSEQEALKNSQIKKRQSIISNNNLKSGNINTTTPQKKKNRNSVISVSSSHKRPV 420
            LYRFKVDSEQEALKNSQIKKRQSIISNNNLKSGNINTTTPQKKKNRNSVISVSSSHKRPV
Sbjct: 361  LYRFKVDSEQEALKNSQIKKRQSIISNNNLKSGNINTTTPQKKKNRNSVISVSSSHKRPV 420

Query: 421  SLNRLSTIQNGKDVISVPSSSNTTPGSSKRISMSLSSNKGSKILPQSNSGSPTPAPRNKR 480
            SLNRLSTIQNGKDVISVPSSSNTTPGSSKRISMSLSSNKGSKILPQSNSGSPTPAPRNKR
Sbjct: 421  SLNRLSTIQNGKDVISVPSSSNTTPGSSKRISMSLSSNKGSKILPQSNSGSPTPAPRNKR 480

Query: 481  MSVQNLETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSITTKIIS 540
            MSVQNLETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSITTKIIS
Sbjct: 481  MSVQNLETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSITTKIIS 540

Query: 541  TYAKLSEDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXX 600
            TYAKLSEDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQI                   
Sbjct: 541  TYAKLSEDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQIRKEKEELERKVRENKEREE 600

Query: 601  XXXXXXXXXXXXXXXXXXXXXXXXXXXXTQITKELQQDTKNFQEDEVVHKNVRSISSPVE 660
                                        TQITKELQQDTKNFQEDEVVHKNVRSISSPVE
Sbjct: 601  RQKRQKEVELAAIAREREELQRRLEEEETQITKELQQDTKNFQEDEVVHKNVRSISSPVE 660

Query: 661  NGNEAKSEEDASGQRSFSLQTRPVSKLDPGIKCGSNKPVQMEEIVEDELDKTIDSQKVIL 720
            NGNEAKSEEDASGQRSFSLQTRPVSKLDPGIKCGSNKPVQMEEIVEDELDKTIDSQKVIL
Sbjct: 661  NGNEAKSEEDASGQRSFSLQTRPVSKLDPGIKCGSNKPVQMEEIVEDELDKTIDSQKVIL 720

Query: 721  ETIRRSKFLGSSFNIDKELKQVKKDAEVKRMRKSQKEDRDVSGRIVSETNEQYETQVLPK 780
            ETIRRSKFLGSSFNIDKELKQVKKDAEVKRMRKSQKEDRDVSGRIVSETNEQYETQVLPK
Sbjct: 721  ETIRRSKFLGSSFNIDKELKQVKKDAEVKRMRKSQKEDRDVSGRIVSETNEQYETQVLPK 780

Query: 781  NATAFGALKDDSEEVEPRKISDIQVPQFTRKSKLFTDSNKRLSVLSIYSSTQSYTNLANV 840
            NATAFGALKDDSEEVEPRKISDIQVPQFTRKSKLFTDSNKRLSVLSIYSSTQSYTNLANV
Sbjct: 781  NATAFGALKDDSEEVEPRKISDIQVPQFTRKSKLFTDSNKRLSVLSIYSSTQSYTNLANV 840

Query: 841  LKEGGVDIXXXXXXXXXXXXXXPEFQFETVGTXXXXXXXXXXXXXXXXXXLSQGANIKLN 900
            LKEGGVDI              PEFQFETVGT                  LSQGANIKLN
Sbjct: 841  LKEGGVDIGVNEGSNNVEVSEEPEFQFETVGTEIENNKYEEEKEIENENNLSQGANIKLN 900

Query: 901  YADRFDTAGNVNEVKLPTLPPLGDDKVSDGLGIYXXXXXXXXXXXXPVPSIKENKSEETL 960
            YADRFDTAGNVNEVKLPTLPPLGDDKVSDGLGIY            PVPSIKENKSEETL
Sbjct: 901  YADRFDTAGNVNEVKLPTLPPLGDDKVSDGLGIYSSKSGSEGNESKPVPSIKENKSEETL 960

Query: 961  KEKNVEPKPPLNDVVPKTRDTKKTNVVQNNNAKHSSDKPRSTSFFRKISKGLTVQNDTTG 1020
            KEKNVEPKPPLNDVVPKTRDTKKTNVVQNNNAKHSSDKPRSTSFFRKISKGLTVQNDTTG
Sbjct: 961  KEKNVEPKPPLNDVVPKTRDTKKTNVVQNNNAKHSSDKPRSTSFFRKISKGLTVQNDTTG 1020

Query: 1021 YDVKLFSNVSVTQLYNGLFNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVD 1080
            YDVKLFSNVSVTQLYNGLFNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVD
Sbjct: 1021 YDVKLFSNVSVTQLYNGLFNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVD 1080

Query: 1081 MVVFSEGKHSVIGFRKKSGSSKTLKRLTSEVEKVLRKEGVLAK 1123
            MVVFSEGKHSVIGFRKKSGSSKTLKRLTSEVEKVLRKEGVLAK
Sbjct: 1081 MVVFSEGKHSVIGFRKKSGSSKTLKRLTSEVEKVLRKEGVLAK 1123

>TDEL0C06490 Chr3 complement(1191461..1194922) [3462 bp, 1153 aa] {ON}
            Anc_1.52 YDR507C
          Length = 1153

 Score = 1160 bits (3000), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 653/1174 (55%), Positives = 793/1174 (67%), Gaps = 82/1174 (6%)

Query: 4    SNKGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXX--XXXXXXXX 61
            SN+   +VKG+ IGPWKLGETLGLGSTGKVQLAY+ESTNQQAAIKVI             
Sbjct: 5    SNRSVPTVKGNKIGPWKLGETLGLGSTGKVQLAYDESTNQQAAIKVISKAIFNVKGSVKD 64

Query: 62   XXXXXXTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLV 121
                  TPDSL YGIEREIIIMKLLNHPNVLRLYDVWETN+NLYMVLEYA+KGELFNLLV
Sbjct: 65   SSVAASTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAQKGELFNLLV 124

Query: 122  EKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETE 181
            E+GPLPE EAIRFFRQI+IG+SYCHALGIVHRDLKPEN+LLDHK NIKIADFGMAALETE
Sbjct: 125  ERGPLPEKEAIRFFRQIVIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALETE 184

Query: 182  DKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241
            DKLLETSCGSPHYAAPEIVSG+PYHG  +DVWSCGVILFALLTGRLPFD+EDGNIRNLLL
Sbjct: 185  DKLLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDDEDGNIRNLLL 244

Query: 242  KVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRN 301
            +VQ G +EMPGDDEIS +AQDL+ +IL VDPE+RIK+R+ILKHPLLQKYPSI DSK+IRN
Sbjct: 245  QVQSGRYEMPGDDEISPDAQDLIARILTVDPEQRIKARDILKHPLLQKYPSINDSKSIRN 304

Query: 302  LPREDTYLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALL 361
            LPREDTYL+PL  ++G  A ID+ ILQNLVVLWHGR + +I  KLREPGANAEKTLYALL
Sbjct: 305  LPREDTYLHPL--SEGESAEIDENILQNLVVLWHGREQLEIINKLREPGANAEKTLYALL 362

Query: 362  YRFKVDSEQEALKNSQIKKRQSIISNNNLKSGNINTTTPQ-----KKKNRNSVISVSSSH 416
             RFK D+E +++K+ Q KKR S I+     +     + PQ     K++NR S+ISVSSSH
Sbjct: 363  DRFKSDTENDSVKHPQSKKRVSQINPVRQPTTKKAPSKPQTNASPKRRNRTSMISVSSSH 422

Query: 417  KRPVSLNRLSTIQNGKDVISVPSSSNTTPGSSKRISMSLSSNKGSKILPQSNSGSPTPAP 476
            KRPVS N+LS + +     SVPSS++ TP  SKR+S++LSSNK    +  +NSGSPTPA 
Sbjct: 423  KRPVSFNKLSNVVSPG---SVPSSNSNTP--SKRVSVNLSSNKRLSAV-YTNSGSPTPAS 476

Query: 477  RNKRMSVQNL--ETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSI 534
            R+KR+S+ +L  E  ++ PP+P++MLKDY    SS A  KR SR + RLS  P+ KRGSI
Sbjct: 477  RHKRVSIVDLERERENDTPPVPIEMLKDY----SSTAKQKRLSRNNMRLSFKPSNKRGSI 532

Query: 535  TTKIISTYAKLSEDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQIXXXXXXXXXXXXX 594
            TTK+ISTYAKLSEDDDWE+IEKETKR SSDFATL D+IFEHEK+EQI             
Sbjct: 533  TTKLISTYAKLSEDDDWEYIEKETKRTSSDFATLCDQIFEHEKFEQIRREKEELERKVRE 592

Query: 595  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTQITKELQQDTKNFQ----------- 643
                                               Q+ +E+    K  Q           
Sbjct: 593  TKEREERERREKEIEEKRKIQEKQDLERRQLEIQRQMDEEVANLGKELQGGMNADQDADE 652

Query: 644  EDEVVHKNVRSISSPVEN------GNEAKSEEDASGQRSFSLQTRPVSKLDPGIKCGSNK 697
             DE    N RS+S P++        +   + +D   QR+FSLQTRPVS+LDPG+   S+ 
Sbjct: 653  GDEHGAVNGRSVSEPLQKKSADPMADLQANIDDLLRQRTFSLQTRPVSRLDPGV--FSSD 710

Query: 698  PVQMEEIVEDELDKTIDSQKVILETIRRSKFLGSSFNIDKELKQVKKDAEVKRMRKSQKE 757
              + ++    E    +++ K+ILETIRRSKFLGSSF+I+KELK+   D E K+ R+S+  
Sbjct: 711  SSEKDQYTGSEDRAKLNNDKIILETIRRSKFLGSSFDINKELKRA-ADNEAKKQRQSKA- 768

Query: 758  DRDVSGRIVSETNEQYETQVLPKNATAFGALKDDSEEVEPRKISDIQVPQFTRKSKLFTD 817
                S RI+S TN++YETQ+LPKNATA   LKD + + EPRKISDI+VPQFTRKS+ F D
Sbjct: 769  ---TSDRIISTTNDEYETQILPKNATASAPLKDHNHQAEPRKISDIKVPQFTRKSRQFGD 825

Query: 818  SNKRLSVLSIYSSTQSYTNLANVLKEGGVDIXXXXXXXXXXXXXXPEFQFETV---GTXX 874
            SNKRLSVLS+YSS QSYTNLA++L E   +               PEF FE V   G   
Sbjct: 826  SNKRLSVLSMYSSKQSYTNLADLLNEEASNAKGNRDSPNDQSGHEPEFLFENVQEDGEVT 885

Query: 875  XXXXXXXXXXXXXXXXLSQGANIKLNYADRFDTAGNVNE------VKLPTLPPLGDDKVS 928
                                  +KLN+ADRF T+   +       V+LPTLPPL D K +
Sbjct: 886  GDSSHDGRLYEVPEDSNMTKEKLKLNFADRFKTSNGEDRTAEDKNVRLPTLPPL-DGKEA 944

Query: 929  DGLGIYXXXXXXXXXXXXPVPSIK---------ENKSEET-----LKEKNV----EPKPP 970
             GLGIY            P P+           EN+  ET     +KE N     + + P
Sbjct: 945  KGLGIY-----QSSSESLPEPAQHNVKSMIQNDENQPSETAEVLSIKEDNAQVERQQEAP 999

Query: 971  LNDVVPKTRDTKKTNVVQNNNAKHSSDKPRSTSFFRKISKGLTVQNDTTG-YDVKLFSNV 1029
            LN  +PK R T      +   +K  S+K R+TSFFRK SK  +    T G +D +L+++V
Sbjct: 1000 LNASIPKHR-TDGAQKSERMPSKEGSEKKRNTSFFRKFSK--SSNEKTNGEFDAELYASV 1056

Query: 1030 SVTQLYNGLFNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVFSEGKH 1089
            +  QL+NGL NLL+GWK YGLK +KS  +  +++ +LSS+NILSLRST  +MVV+S GK 
Sbjct: 1057 AAKQLFNGLQNLLQGWKKYGLKGVKSMPDKLTLTGKLSSENILSLRSTLFEMVVWSRGKG 1116

Query: 1090 SVIGFRKKSGSSKTLKRLTSEVEKVLRKEGVLAK 1123
            S++GFRKKSGS+KTLKRL SE+EKVL KE VL K
Sbjct: 1117 SIVGFRKKSGSTKTLKRLVSEIEKVLLKERVLTK 1150

>TPHA0E03640 Chr5 complement(769962..773375) [3414 bp, 1137 aa] {ON}
            Anc_1.52 YDR507C
          Length = 1137

 Score = 1146 bits (2965), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 651/1173 (55%), Positives = 791/1173 (67%), Gaps = 86/1173 (7%)

Query: 1    MISSNKGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXX------- 53
            M+ +N  +++V G+ IGPWKLGETLG GSTGKVQLA NE TNQQAAIK+I          
Sbjct: 1    MLKANISDVTVTGNNIGPWKLGETLGFGSTGKVQLATNEQTNQQAAIKIISKSVFDHLVN 60

Query: 54   -------XXXXXXXXXXXXXXTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYM 106
                                   ++L YGIEREIIIMKLLNH NVLRLYDVWETNNNLYM
Sbjct: 61   SNNNNNSALAASDVNNGSVQHNQEALPYGIEREIIIMKLLNHTNVLRLYDVWETNNNLYM 120

Query: 107  VLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKL 166
            VLEYAEKGELFNLLVEKGPL ENEA+RFFRQIIIGMSYCHALGIVHRDLKPENILLDHK 
Sbjct: 121  VLEYAEKGELFNLLVEKGPLAENEAVRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKS 180

Query: 167  NIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGR 226
            NIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGLPY+GLETD+WSCGVILFALLTGR
Sbjct: 181  NIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGLPYNGLETDIWSCGVILFALLTGR 240

Query: 227  LPFDEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPL 286
            LPFDEEDGNIRNLLLKVQKGEFEMPG DE+S EAQDL+ KIL V+P++RIK+REILKHPL
Sbjct: 241  LPFDEEDGNIRNLLLKVQKGEFEMPGSDELSLEAQDLIGKILTVNPKQRIKTREILKHPL 300

Query: 287  LQKYPSIKDSKTIRNLPREDTYLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKL 346
            LQKYP+IKDSKTIR+LPREDTYLNPL  N+G D  ID++ILQNL VLWHG+++++I KKL
Sbjct: 301  LQKYPNIKDSKTIRDLPREDTYLNPLADNNGVDTEIDESILQNLTVLWHGKDKNEIIKKL 360

Query: 347  REPGANAEKTLYALLYRFKVDSEQEALKNSQIKKRQSIISNNNLKSGNINTTTPQKKKNR 406
            +EPGANAEKTLY LL+RFK D+E+E  KNSQ++KRQS++  ++  S N     P+++KNR
Sbjct: 361  KEPGANAEKTLYVLLHRFKEDTERENHKNSQLRKRQSLMKASSSSSSN-QGNVPRRRKNR 419

Query: 407  NSVISVSSSHKRPVSLNRLSTI-QNGKDVISVPSSSNTTPGSSKRISMSLSSN--KGSKI 463
            NS+ISV+SSHK+PVS N+++ +  + KDVIS+PSSSNTTP SSKRIS+SLSS+  + S++
Sbjct: 420  NSMISVTSSHKKPVSYNKIAMVGGSSKDVISLPSSSNTTPASSKRISLSLSSSNKRNSRL 479

Query: 464  LPQSNSGSPTPAPRNKRMSVQNL-ETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKR 522
              QSNS SPTPAPR++R S QNL    S  PPIPVD+LKDY   ++ +   KR SR+SKR
Sbjct: 480  YTQSNSSSPTPAPRSRRSSNQNLINKESEAPPIPVDVLKDYNKISNQN---KRGSRLSKR 536

Query: 523  LSVLPNAKRGSITTKIISTYAKLSEDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQIX 582
             S L N KRGS+TTKI+STYAKL+EDDDWEFIEKETKRVSSDFATLIDEIFEHEK+E+I 
Sbjct: 537  YSFLLNNKRGSVTTKIMSTYAKLAEDDDWEFIEKETKRVSSDFATLIDEIFEHEKFEKIR 596

Query: 583  XXXXXXXXXX-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTQITKELQQDTK- 640
                                                            Q+  ++ ++ + 
Sbjct: 597  KEKEELERKVIEAKQKEERERKEAEAAAKEEARVRREKELARMNKEEEQLQNDIDEEARL 656

Query: 641  -----NFQEDEVVHK--NVRSISSPVENGNEAKSEEDASGQRSFSLQTRPVSKLDPGIKC 693
                 NF  DE      N RS+S PV+NG       D  GQR+FSLQTRP+S+LDPG+  
Sbjct: 657  LKDEFNFVNDETQENPINSRSVSEPVKNGG-----TDEKGQRNFSLQTRPISRLDPGLMF 711

Query: 694  GSNKPVQMEEIVEDELDKTIDSQKVILETIRRSKFLGSSFNIDKELKQVKKDAEVKRMRK 753
                 V     V++ L  T+++QK ILETIRRSKFLGSSF+I+KEL     + E KR+R+
Sbjct: 712  SKLGDVDNNSSVDENL--TMNNQKTILETIRRSKFLGSSFDINKELNNA--NEERKRLRQ 767

Query: 754  SQ---KEDRDVSGRIVSETNEQYETQVLPKNATAFGALKDDSEEVEPRKISDIQVPQFTR 810
             Q   +++ +   RI S +    E QVL KNA     LKD S +VEPRKIS++QVPQFTR
Sbjct: 768  LQLQKQKELEEKERIASTSYVSNENQVLSKNAIGVVDLKDFSSDVEPRKISEVQVPQFTR 827

Query: 811  KSKLFTDSNKRLSVLSIYSSTQSYTNLANVLKEGGVDIXXXXXXXXXXXXXXPEFQFE-- 868
            KSK F++SNKRLSVLS YSS QSYTNL +++KE  V+               P F FE  
Sbjct: 828  KSKYFSESNKRLSVLSFYSSKQSYTNLVDMIKENPVE--------DEDVTEDPGFNFEDS 879

Query: 869  --------TVGTXXXXXXXXXXXXXXXXXXLSQGANIKLNYADRFDTAGNVN-------- 912
                                               ++KLN+ADRF    NVN        
Sbjct: 880  QYDYLEEKNEAPLEVSDEVPKEVDDKVQEEEKNSVSMKLNFADRF---SNVNSNTKQESS 936

Query: 913  -EVKLPTLPPLGDDKVSDGLGIYXXXXXXXXXXXXPVPSIKENKSEETLKEKNVEPKPPL 971
             E K P +        ++GLG+Y            P P +K    EE     +   + PL
Sbjct: 937  FEDKFPNILSKSG---TEGLGLY-----SKNEKTEPKP-VKSMIPEEDKVNSSPVVEAPL 987

Query: 972  NDVVPKTRDTKKTNVVQNNNAKHSSDKPRSTSFFRKISKGLTVQNDTTG-YDVKLFSNVS 1030
            N VV KTR   K+     + ++  S+   ++SF RKIS   +      G ++V L+S+V+
Sbjct: 988  NKVVNKTRAENKSTSKGPSGSQKVSN---TSSFLRKISGKSSNSTVAKGAFEVNLYSSVT 1044

Query: 1031 VTQLYNGLFNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVFSEGKHS 1090
             TQL+NGL NLLKGW +YGLK++K +K+   I  +LS+DNILSLRST V++ VF+E K S
Sbjct: 1045 ETQLFNGLQNLLKGWTNYGLKDVKVDKQKKMIVGKLSNDNILSLRSTIVELCVFTESKFS 1104

Query: 1091 VIGFRKKSGSSKTLKRLTSEVEKVLRKEGVLAK 1123
            VIG RKKSGSSKT++RL SE+EKVL KEGVL K
Sbjct: 1105 VIGIRKKSGSSKTMRRLASEIEKVLSKEGVLQK 1137

>ZYRO0F17402g Chr6 complement(1445685..1449254) [3570 bp, 1189 aa]
            {ON} similar to uniprot|Q12263 Saccharomyces cerevisiae
            YDR507C
          Length = 1189

 Score = 1100 bits (2844), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 636/1215 (52%), Positives = 760/1215 (62%), Gaps = 137/1215 (11%)

Query: 10   SVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXX--XXXXXXXXXXXXXX 67
            +V+GD +GPWKLGETLG GSTGKVQLA NE T Q AA+K I                   
Sbjct: 11   TVRGDKVGPWKLGETLGFGSTGKVQLACNEITQQSAAVKEISKAIFSAKTAPGNSSIAAS 70

Query: 68   TPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLP 127
            TPD L YGIEREIIIMKLLNHPNVLRLYDVWETN +LYMVLEYAEKGELFNLLVE GPLP
Sbjct: 71   TPDPLPYGIEREIIIMKLLNHPNVLRLYDVWETNPSLYMVLEYAEKGELFNLLVENGPLP 130

Query: 128  ENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLET 187
            ENEA+ FFRQIIIG+SYCHALGIVHRDLKPEN+LLDH LNIKIADFGMAALETEDKLLET
Sbjct: 131  ENEAVCFFRQIIIGVSYCHALGIVHRDLKPENLLLDHDLNIKIADFGMAALETEDKLLET 190

Query: 188  SCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE 247
            SCGSPHYAAPEIVSG+PYHG  +D+WSCGVI FALLTGRLPFDEEDGNIRNLLLKVQ G+
Sbjct: 191  SCGSPHYAAPEIVSGIPYHGFASDIWSCGVIFFALLTGRLPFDEEDGNIRNLLLKVQSGK 250

Query: 248  FEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDT 307
            FEMP DDEIS EAQDLL KIL VDPE RIK REILKHPLLQKYP++ D+K+IRNLPREDT
Sbjct: 251  FEMPDDDEISPEAQDLLAKILTVDPECRIKPREILKHPLLQKYPNVSDNKSIRNLPREDT 310

Query: 308  YLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKVD 367
            YL+PL  +D G + +D+ ILQNLVVLWHGR   +IA KL++PGANAEKTLYALL RFK D
Sbjct: 311  YLHPL--SDSGSSEVDQNILQNLVVLWHGRPAGEIAAKLKDPGANAEKTLYALLARFKND 368

Query: 368  SEQEALKNSQIKKRQSIISNNNLKSGNINTTTPQKKKNRNSVISVSSSHKRPVSLNRLST 427
            +E+EA +  QIKKR S+   N   +G  N     KK+NR S I+ SSSHKRPVSL +LS 
Sbjct: 369  TEREAARQKQIKKRSSL---NGTGAGVNNNHVSPKKRNRASTINASSSHKRPVSLIKLSG 425

Query: 428  IQNGKDVISVPSSSNTTPGSSKRISMSLSSNKG-SKILPQSNSGSPTPAPRNKRMSVQNL 486
              N     +  S+S T     KR+S++LSSNK  S +  Q N GSPTPA R+KR+S+   
Sbjct: 426  SSNSNSNSNPSSTSTTP---PKRMSVNLSSNKRLSTVKTQGNGGSPTPASRSKRVSIIES 482

Query: 487  ETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSITTKIISTYAKLS 546
            + +   PP+P+DMLKDY  +     N+KR SR S RLS  P  KRGS+TTK+ISTYAKLS
Sbjct: 483  DKNGGAPPVPIDMLKDYNKT----PNSKRLSRASVRLSFKPTNKRGSVTTKLISTYAKLS 538

Query: 547  EDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXXXXXXXX 606
            E+DDWE+IEKETKR SSDFATLIDEIFEHEK+EQI                         
Sbjct: 539  EEDDWEYIEKETKRTSSDFATLIDEIFEHEKFEQIRKEKAELERRVKETKEREERERKER 598

Query: 607  XXXXXXXXXXXXXXXXXXXXXXTQITKELQQDTKNFQEDEVVHKN-----VRSISSPVEN 661
                                      +E Q D     E +V   N     VRS+S+P+E 
Sbjct: 599  EEKELNEKLENDARQKREME-----AQEAQGDDGTDTESDVHSNNQAPNGVRSVSAPLER 653

Query: 662  G------NEAKSEEDASGQRSFSLQTRPVSKLDPGIKCG--SNKPVQMEEIVEDELDKTI 713
                   N     E+  GQR+ SLQTRPVS+LDPG+     SN+P    E  + E +K +
Sbjct: 654  KKRDSMVNVQSDIEEIFGQRTMSLQTRPVSRLDPGLFYAEESNEP----EAGDTEEEKKL 709

Query: 714  DSQKVILETIRRSKFLGSSFNIDKELKQVKKDAEVKRMRKSQKEDRDVSGRIVSETNEQY 773
             +QK ILETIRRSKFLGSSF+I KEL    ++ E+K  +K+ +  RD   R VS+TNE Y
Sbjct: 710  RTQKNILETIRRSKFLGSSFDIGKEL----QNEELK--KKASQPHRD---RTVSQTNEPY 760

Query: 774  ETQVLPKNATAFGALKDDSEEVEPRKISDIQVPQFTRKSKLFTDSNKRLSVLSIYSSTQS 833
            +T+VLP  A A   L+D     EPRKIS+I VPQFTRKS+ F+DSNKRLSVLS+YS+  S
Sbjct: 761  DTRVLPTQAVATAPLRDQ----EPRKISEISVPQFTRKSRFFSDSNKRLSVLSMYSTKHS 816

Query: 834  YTNLANVLKEGGVD---IXXXXXXXXXXXXXXPEFQFETVGTXX---------------- 874
            Y NL+N+L +       +              PEFQFE V                    
Sbjct: 817  YNNLSNLLNDSDASDGRLNSAAEYSDVKGKKEPEFQFEAVREASDEDNGISRLSNNDERL 876

Query: 875  XXXXXXXXXXXXXXXXLSQGANIKLNYADRFD----TAG------NVNEVKLPTLPPLGD 924
                            LS   N+KLN+ADRF     TAG          VKLPTLPPL  
Sbjct: 877  RNVSGTSGGSGVPHDNLSSKHNMKLNFADRFSADEPTAGSSNSSSASKNVKLPTLPPLDG 936

Query: 925  DKVSDGLGIYXXXXXXXXXXXXPVP--SIKENKS-------------------------- 956
               ++GLGIY            P P   +++N S                          
Sbjct: 937  TSEANGLGIYQSSSESFRDIVEPTPKSKLQDNSSNPEQEVEEEVAGREGSVKHSAIDTAS 996

Query: 957  ------------------EETLKEKNVEPKPPLNDVVPKTRDTKKTN---VVQNNNAKH- 994
                              +E L        PPLND +PK R+    N     +  N +  
Sbjct: 997  KERSKRTDRIDAKKPSSFQENLASAGASKGPPLNDSMPKRRNEDPRNGSTAAKGENGRAP 1056

Query: 995  ------SSDKPRSTSFFRKISKGLTVQNDTTGYDVKLFSNVSVTQLYNGLFNLLKGWKDY 1048
                  +SDK R+ SFFRK SK  + + DTTG+D ++ + VS  QL+ GL NLL GW  Y
Sbjct: 1057 LKDITTNSDKKRNVSFFRKFSK--SNEKDTTGFDGEINTTVSAKQLFLGLQNLLHGWTQY 1114

Query: 1049 GLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVFSEGKHSVIGFRKKSGSSKTLKRLT 1108
            GLK+++S+ E  +++ +L+S+NILSLRST  +MVV+S GK SV+GFRKKSGSSK ++RL 
Sbjct: 1115 GLKDVRSHPEKMTLTGKLTSENILSLRSTLFEMVVWSRGKVSVVGFRKKSGSSKAMRRLV 1174

Query: 1109 SEVEKVLRKEGVLAK 1123
            SEVEKVL KEGV++K
Sbjct: 1175 SEVEKVLLKEGVISK 1189

>NCAS0B08600 Chr2 (1649375..1652728) [3354 bp, 1117 aa] {ON} Anc_5.591
            YDR466W
          Length = 1117

 Score = 1097 bits (2838), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 628/1163 (53%), Positives = 769/1163 (66%), Gaps = 92/1163 (7%)

Query: 2    ISSNKGNI-SVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXX--XXXXX 58
            ++ NK  I ++KGDTIGPWKLGETLGLGSTGKVQLA+NE+TNQQAAIK+I          
Sbjct: 4    LAENKKAIPTIKGDTIGPWKLGETLGLGSTGKVQLAFNETTNQQAAIKIISKSIFNTKPN 63

Query: 59   XXXXXXXXXTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFN 118
                     TPDSL YGIEREIIIMKLL H NVL LYDVWETN+NLYM+LEYAEKGELFN
Sbjct: 64   SNETSMVANTPDSLPYGIEREIIIMKLLRHANVLSLYDVWETNSNLYMILEYAEKGELFN 123

Query: 119  LLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL 178
            LLVEKGPLPE EA+RFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIKIADFGMAAL
Sbjct: 124  LLVEKGPLPEKEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAAL 183

Query: 179  ETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRN 238
            ETEDKLLETSCGSPHYAAPEIVSG+PYHG E+DVWSCGVILFALLTGRLPFDEEDGNIRN
Sbjct: 184  ETEDKLLETSCGSPHYAAPEIVSGIPYHGFESDVWSCGVILFALLTGRLPFDEEDGNIRN 243

Query: 239  LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKT 298
            LLLKVQ G+FEMP DDE+S++AQDL+ +IL VDP KRIK+REILKHPLLQKYPSIKDSK+
Sbjct: 244  LLLKVQSGQFEMPDDDEMSRDAQDLISRILTVDPTKRIKTREILKHPLLQKYPSIKDSKS 303

Query: 299  IRNLPREDTYLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLY 358
            I+NLPREDTYL PL  N   ++ ID +ILQNLVVLWHGR+++ IA KL+E GANAEKT+Y
Sbjct: 304  IKNLPREDTYLFPLSDN---NSVIDPSILQNLVVLWHGRDKEQIAAKLKESGANAEKTIY 360

Query: 359  ALLYRFKVDSEQEALKNSQIKKRQSIISNNNLKSGNINTTTPQKKKNRNSVISVSSSHKR 418
            ALLYRFK+++E  + K  Q+K++QSII     K    N +TP +KKNR S +SVSSS KR
Sbjct: 361  ALLYRFKIEAENLSAKQEQVKRKQSII-----KKSTANVSTPPRKKNRISTMSVSSSRKR 415

Query: 419  PVSLNRLSTIQNGKDVISVPS-----SSNTTPGSSKRISMSLSSNKG-SKILPQ----SN 468
            PVS NRL TI NGK    +P+     S+NTTP S+KR+S++LSSNK  S +L Q     N
Sbjct: 416  PVSFNRLPTISNGKTNNIIPNGRNGDSNNTTPKSNKRLSINLSSNKRLSNLLVQGHSNGN 475

Query: 469  SGSPTPAPRNKRMSVQNLETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPN 528
            S SPTP+ R+KR+S+ NL+ S+  PPIPV++LKDY N +SS  N + +     RL+ L N
Sbjct: 476  SNSPTPS-RSKRISLINLDNST-APPIPVNVLKDYKNKSSSSKNKRASK----RLTFLGN 529

Query: 529  AKRGSITTKIISTYAKLSEDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQIXXXXXXX 588
             KRGSITTK++STYAKLSEDD+WE+IEKETKR SSDFATLIDEIFEHEKYEQI       
Sbjct: 530  GKRGSITTKLLSTYAKLSEDDNWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEEL 589

Query: 589  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTQITKE---LQQDTKNFQED 645
                                                      I +E   L+ D  N  + 
Sbjct: 590  ARKVREAKEGEARERREQESEKQRKQREREELERQQLELQNHIDQEISNLKADLANETKG 649

Query: 646  EVVHKNVRSISSPVENGNEAKSEEDAS---GQRSFSLQTRPVSKLDPGIKCGSNKPVQME 702
               ++N RS+S+P+E  N    E D +    +R+ SLQTRP S+LDPGI   +       
Sbjct: 650  AEPYENPRSVSAPLERENPEAIERDINDLFARRNVSLQTRPKSRLDPGILYSAPAETVSN 709

Query: 703  EIVEDELDKTIDSQKVILETIRRSKFLGSSFNIDKELKQVKKDAEVKRMRKSQKEDRDVS 762
             ++ D +D+ ID +K ILETIRRS+FLGSS+NI+KEL+  KK A +    K +K  +  S
Sbjct: 710  PLLSD-IDQEIDREKKILETIRRSRFLGSSYNINKELEFAKKTA-LAETSKKEKRSKVTS 767

Query: 763  GRIVSETNEQYETQVLPKNATAFGALKDDSEEVEPRKISDIQVPQFTRKSKLFTDSNKRL 822
              IV+   ++    V+P N T  G           RKIS+I+VPQFTRKS+ F++SN+RL
Sbjct: 768  QNIVA---DKAAIGVIPLNDTEAGL----------RKISEIKVPQFTRKSRHFSNSNRRL 814

Query: 823  SVLSIYSSTQSYTNLANVLKEGGVDIXXXX-XXXXXXXXXXPEFQFETVGTXXXXXXXXX 881
            SVLS+YS+ QSYTNL ++LKEGGV++               PEFQFE+V           
Sbjct: 815  SVLSMYSTKQSYTNLGDILKEGGVNLASEANNTTTSKASTEPEFQFESV----------- 863

Query: 882  XXXXXXXXXLSQGANIKLNYADRFDTAGNVNE--------VKLPTLPPLGDD-KVSDGLG 932
                      ++G   KL          +VN+        VKLPTLPPL +    ++GL 
Sbjct: 864  ----------NEGTANKLYELQEEPEYTDVNKEDGKPKKNVKLPTLPPLHEKTNQANGLA 913

Query: 933  IYXXXXXXXXXXXXPVPSIKE---------NKSEETLKEKNVEPKPPLNDVV--PKTRDT 981
            IY            P P  +          N S    K   VEP+      +  PK R  
Sbjct: 914  IYQSSSDDDKKPTEPQPKSQSMIPERQDSINNSASVKKTPVVEPESQATKKINKPKQRQP 973

Query: 982  KKTNVVQN-NNAKHSSDKPRSTSFFRKISKGLTVQNDT-TGYDVKLFSNVSVTQLYNGLF 1039
            KK    +  N    + +K R+ SFFRK SK   V   T  G+D +++ NVS  QLY GL 
Sbjct: 974  KKEEERKPLNEMPPNVEKKRNVSFFRKFSKSSAVSTLTKNGFDYEVYVNVSAPQLYKGLL 1033

Query: 1040 NLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVFSEGKHSVIGFRKKSG 1099
             LL+GW  YGLK++KS      ++ +LS+DNILSLRST  +M+V S+GK SV+GF K SG
Sbjct: 1034 RLLQGWSKYGLKDVKSQSNYMKLTGKLSNDNILSLRSTVFEMIVESKGKQSVVGFNKISG 1093

Query: 1100 SSKTLKRLTSEVEKVLRKEGVLA 1122
            SSKT++RL  E+EKVLR+EGVL+
Sbjct: 1094 SSKTVRRLFVEIEKVLRQEGVLS 1116

>Suva_2.687 Chr2 complement(1215095..1218481) [3387 bp, 1128 aa] {ON}
            YCL024W (REAL)
          Length = 1128

 Score = 1058 bits (2735), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/1162 (52%), Positives = 760/1162 (65%), Gaps = 91/1162 (7%)

Query: 10   SVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXX--XX 67
            ++K +TIGPWKLGETLGLGSTGKVQLA N+ST Q+AA+KVI                   
Sbjct: 10   AIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNSGNVSGTSIVGSN 69

Query: 68   TPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLP 127
            TPD+L YGIEREIIIMKLLNHPNVLRLYDVWETN +LY+VLEYAEKGELFNLLVE+GPLP
Sbjct: 70   TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLP 129

Query: 128  ENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLET 187
            ENEAIRFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIKIADFGMAALETE KLLET
Sbjct: 130  ENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLET 189

Query: 188  SCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE 247
            SCGSPHYAAPEIVSG+PY G  +DVWSCGVILFALLTGRLPFDEEDGNIR LLLKVQKGE
Sbjct: 190  SCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRALLLKVQKGE 249

Query: 248  FEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDT 307
            FE+P DDEIS+EAQDL+ KIL VDPE+RIK+R+ILKHPLLQKYPSI+DSK+IR+LPREDT
Sbjct: 250  FELPSDDEISREAQDLISKILTVDPERRIKARDILKHPLLQKYPSIRDSKSIRDLPREDT 309

Query: 308  YLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKVD 367
            YL PL      +++ID TILQNLV+LWHGR+ D I  KL+EPGANAEKTLYALLYRFK D
Sbjct: 310  YLTPL---SESNSSIDATILQNLVILWHGRDPDGIRAKLQEPGANAEKTLYALLYRFKCD 366

Query: 368  SEQEALKNSQIKKRQSIISNNNLKSGNINTTTPQKKKNRNSVISVSSSHKRPVSLNRLST 427
            +++E +K  QI+KRQSI S  ++      +TTPQ+++NR S+ISVSSS K+P+S N+ + 
Sbjct: 367  TQKELIKQQQIRKRQSIGS-VSISPPKRTSTTPQRRRNRESIISVSSSRKKPISFNKFTA 425

Query: 428  IQNGKDVISVPSSSN-TTPGSSKRISMSLSSNKGSKILPQSNSGSPTPAPRNKRMSVQNL 486
                    S  SSSN TTPGSSKR+S + SS K  K+    N  SPTP+ RNKR S+ N 
Sbjct: 426  --------SSASSSNLTTPGSSKRLSKNFSSKK--KLSTIVNQSSPTPSSRNKRTSIAN- 474

Query: 487  ETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSITTKIISTYAKLS 546
                      VD  +   +  S+    KRAS+ ++R+S++P+ KR S+TTK++STYAKL+
Sbjct: 475  ----------VDKNQKRASIFSTTKKNKRASKSTRRMSLIPSMKRESVTTKLMSTYAKLA 524

Query: 547  EDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXXXXXXXX 606
            EDDDWE+IEKETKR SS+FATLIDEIFE+EKY+QI                         
Sbjct: 525  EDDDWEYIEKETKRTSSNFATLIDEIFEYEKYDQIRKEKEELERKVKEAKALEELERRKR 584

Query: 607  XXXXXXXXXXXXXXXXXXXXXXTQITKELQQDTKNFQEDEVVHK------NVRSISSPVE 660
                                   ++ K++  D  + + + + H+      N+RSIS+P+E
Sbjct: 585  KQEEKERARKLLEKEELKRKQE-ELKKQIDIDISDLEHELINHREEKFEGNIRSISAPME 643

Query: 661  N--GNEAKSEEDASG---QRSFSLQTRPVSKLDPGIKCGSNKPVQMEEIVEDEL--DKTI 713
            N   N    E D      +R+FSLQTRPVS+LDPGI   S  P++ E+ VE +   ++ +
Sbjct: 644  NEENNINHLEADIDNILRRRNFSLQTRPVSRLDPGIIFSS--PIETEDPVEPKKAENERL 701

Query: 714  DSQKVILETIRRSKFLGSSFNIDKELKQVKKDAEVKRMRKSQKEDRDVSGRIVSETNEQY 773
             ++K ILETIRRSKFLGSSFNIDKELK  +   E   M   Q+   +   RIVS++N +Y
Sbjct: 702  TTEKKILETIRRSKFLGSSFNIDKELKLSQ--MEYPGMAAPQRLSEE---RIVSDSNGKY 756

Query: 774  ETQVLPKNATAFGALKDDSEEV--------EPRKISDIQVPQFTRKSKLFTDSNKRLSVL 825
            E+ VLPK+A     LKD++           E RKISDI+VPQFTRKS+ F++SNKRLSVL
Sbjct: 757  ESLVLPKDAKGVAHLKDNTAPTTTELLSNGELRKISDIRVPQFTRKSRHFSESNKRLSVL 816

Query: 826  SIYSSTQSYTNLANVLKEGGVDIXXXXXXX--XXXXXXXPEFQFETVGTXXXXXXXXXXX 883
            S+YS+ +S+TNL ++LK G +DI                 EF FETV             
Sbjct: 817  SMYSTKESFTNLVDILKNGNLDINPQQNQRVPTPRSADDSEFLFETVNEEAEYTGNSSND 876

Query: 884  XXXX---XXXLSQGANIKLNYADRFDTAGNVNEVK---LPTLPPL---------GDDKVS 928
                      +     +KLN+ADRF+ + N  E K   LPTLPPL         G+++  
Sbjct: 877  ERLYDVGDSCIKDKNTLKLNFADRFNGSTNEKETKNLHLPTLPPLNGKDEAGKQGEEQEK 936

Query: 929  DGLGIYXXXXXXXXXXXXPVPSIKENKSEETLKEKNVEPKPPLNDVVPKTRDTKKTNVVQ 988
            + L                  + KE K  E  +    + +PPLN  V KTR+  K N  Q
Sbjct: 937  EDLHEQPKVKSMIPESDSLSHAEKEQKEREDQQRGGKDLEPPLNKSVQKTRE--KNNDTQ 994

Query: 989  NNNAKHSSDKPR-------STSFFRKISKGLTVQNDTTGYDVKLFSNVSVTQLYNGLFNL 1041
               AK+ S  P+       + SFFRK SK  T +  T      L++ VS  QL+NGL  L
Sbjct: 995  ---AKNQSTDPKPNKNVSGNGSFFRKFSKSSTSEKSTE-----LYAKVSAKQLFNGLEKL 1046

Query: 1042 LKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVFSEGKHSVIGFRKKSGSS 1101
            L+GW  YGLK +KSN    +++ +LSS+N+ SLRST  ++ ++ +GK SV+ F+K SGS 
Sbjct: 1047 LRGWNQYGLKNVKSNPNNLTLTGKLSSENMFSLRSTLFEVSIYQKGKVSVVEFKKISGSF 1106

Query: 1102 KTLKRLTSEVEKVLRKEGVLAK 1123
            KT+K+L  EVE VL KEGVL K
Sbjct: 1107 KTVKKLVKEVENVLNKEGVLQK 1128

>Skud_4.783 Chr4 complement(1382552..1385959) [3408 bp, 1135 aa] {ON}
            YDR507C (REAL)
          Length = 1135

 Score = 1044 bits (2699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 600/1166 (51%), Positives = 759/1166 (65%), Gaps = 92/1166 (7%)

Query: 10   SVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXX--XXXXXXXXXX 67
            ++K +TIGPWKLGETLGLGSTGKVQLA N+ST Q+AA+KVI                   
Sbjct: 10   AIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKAVFNAGNMSGTSIVGSI 69

Query: 68   TPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLP 127
            TPD+L YGIEREIIIMKLLNHPNVLRLYDVWETN +LY+VLEYAEKGELFNLLVE+GPLP
Sbjct: 70   TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLP 129

Query: 128  ENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLET 187
            ENEAIRFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIKIADFGMAALETE KLLET
Sbjct: 130  ENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLET 189

Query: 188  SCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE 247
            SCGSPHYAAPEIVSG+PY G  +DVWSCGVILFALLTGRLPFDEEDGNIR LLLKVQKG+
Sbjct: 190  SCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGQ 249

Query: 248  FEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDT 307
            FE+P DDE+S+EAQDL+ KIL VDP++RIK+R+ILKHPLLQKYPSI+DSK+IR LPREDT
Sbjct: 250  FELPSDDEVSREAQDLICKILTVDPKRRIKARDILKHPLLQKYPSIRDSKSIRGLPREDT 309

Query: 308  YLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKVD 367
            YL PL      +++ID TILQNLV+LWHGR+ D I +KL+EPGANAEKTLYALLYRFK D
Sbjct: 310  YLTPL---SESNSSIDATILQNLVILWHGRDPDGIKEKLKEPGANAEKTLYALLYRFKCD 366

Query: 368  SEQEALKNSQIKKRQSIISNNNLKSGNINTTTPQKKKNRNSVISVSSSHKRPVSLNRLST 427
            +++E ++  QIKKRQSI S +      I +TTPQ++KNR S+ISV+SS K+P+S N+ + 
Sbjct: 367  TQKELIRQQQIKKRQSISSVSTSSPNKI-STTPQRRKNRESIISVTSSRKKPISFNKFTA 425

Query: 428  IQNGKDVISVPSSSN-TTPGSSKRISMSLSSNKGSKILPQSNSGSPTPAPRNKRMSVQNL 486
                    S  SSSN TTPGSSKR+S + SS K  ++    N  SPTPA RNKR S+ N 
Sbjct: 426  --------SSASSSNLTTPGSSKRLSKNFSSKK--RLSTIVNQASPTPASRNKRTSIIN- 474

Query: 487  ETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSITTKIISTYAKLS 546
                      VD  +   +  S+    K+ SR +K+LS++P+ KR S+TTK++STYAKL+
Sbjct: 475  ----------VDKNQRRASVFSTAKRNKKTSRSTKKLSLIPSMKRESVTTKLMSTYAKLA 524

Query: 547  EDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXXXXXXXX 606
             DDDWE+IEKETKR SS+FATLIDEIFE+EKYE+I                         
Sbjct: 525  ADDDWEYIEKETKRTSSNFATLIDEIFEYEKYEKIRKEKKELELKVREAKAREELERRKR 584

Query: 607  XXXXXXXXXXXXXXXXXXXXXXTQITKELQQDTKNFQEDEVVHK------NVRSISSPVE 660
                                   ++ K+++ D  + + +   HK      N+RSIS+P+E
Sbjct: 585  KQEEKEHSRKVLEKEELKRKQQ-ELKKQIEIDISDLEHELSKHKEEKPDGNIRSISAPME 643

Query: 661  ----NGNEAKSEED-ASGQRSFSLQTRPVSKLDPGIKCGSNKPVQMEEIVEDEL--DKTI 713
                N N  + + D    +R+FSLQTRPVS+LDPGI   S  PV+ E  VE +   ++ +
Sbjct: 644  SEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSS--PVEKESAVEPKRTENERL 701

Query: 714  DSQKVILETIRRSKFLGSSFNIDKELKQVKKDAEVKRMRKSQKEDRDVSGRIVSETNEQY 773
             ++K ILETIRRSKFLGSSFNI+KELK  K   E   M   Q+   +   RIVS+ ++ Y
Sbjct: 702  TTEKKILETIRRSKFLGSSFNIEKELKLSK--MEYPSMVPPQRLSEE---RIVSDPSDDY 756

Query: 774  ETQVLPKNATAFGALKDDSEEV--------EPRKISDIQVPQFTRKSKLFTDSNKRLSVL 825
             + VLPK+A  +  L+D             E RKIS+++VPQFTRKS+ F++SNKRLSVL
Sbjct: 757  GSLVLPKDARGYSQLEDHIAPTTGDLLSNGELRKISEVRVPQFTRKSRHFSESNKRLSVL 816

Query: 826  SIYSSTQSYTNLANVLKEGGVDIXXXXXXX--XXXXXXXPEFQFETVGTXXXXXXXXXXX 883
            S+YSS +S+TNL ++LK G +D+                 EF FETV             
Sbjct: 817  SMYSSKESFTNLVDILKNGNIDVHKQQSQRIPTPKSADDSEFLFETVNEEAEYTGNSSND 876

Query: 884  XXXX---XXXLSQGANIKLNYADRFDTAGNVNE---VKLPTLPPL-GDDKVS-----DGL 931
                      +   + +KLN+ADRF+ + N  E   + LPTLPPL G D+V+     D L
Sbjct: 877  ERLYDVGDSTIKDKSALKLNFADRFNASTNEKETENLHLPTLPPLNGGDEVNKQKDEDVL 936

Query: 932  GIY------------XXXXXXXXXXXXPVPSIKENKSEETLKEKNVEPKPPLNDVVPKTR 979
            GI                              +E++ ++    K++E  PPLN  V KTR
Sbjct: 937  GIQPKVKSMIPQSDSSSHTGKEEEKEEKGEEGREDQEKDAKGAKDIE--PPLNKSVQKTR 994

Query: 980  DTKKTNVVQNNNAKHSSDKPRS--TSFFRKISKGLTVQNDTTGYDVKLFSNVSVTQLYNG 1037
                   V+++  +   D+  S   SFFRK SK     + T+   V+L++ VS  QL+NG
Sbjct: 995  ANDSGPQVKSHPREPKKDRNISGNGSFFRKFSK-----SSTSDKSVELYAKVSAKQLFNG 1049

Query: 1038 LFNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVFSEGKHSVIGFRKK 1097
            L  LL+GW  YGLK IKS+    +++ +LSS+NI SLRST  ++ ++  GK SV+ F+K 
Sbjct: 1050 LEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEISIYPRGKMSVVQFKKV 1109

Query: 1098 SGSSKTLKRLTSEVEKVLRKEGVLAK 1123
            SG+ K +K+L +EVE VL KEGVL K
Sbjct: 1110 SGAFKAVKKLVNEVENVLSKEGVLEK 1135

>KAFR0D04100 Chr4 complement(809681..813034) [3354 bp, 1117 aa] {ON}
            Anc_1.52 YDR507C
          Length = 1117

 Score = 1041 bits (2692), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 609/1159 (52%), Positives = 738/1159 (63%), Gaps = 99/1159 (8%)

Query: 10   SVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTP 69
            S+KGD +GPWKLGETLGLGSTGKVQLA+N++T +QAAIKVI                 TP
Sbjct: 9    SIKGDQLGPWKLGETLGLGSTGKVQLAHNKTTGKQAAIKVISKSVFNNNSAQSSSLT-TP 67

Query: 70   DSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPEN 129
            D+L YGIEREIIIMKLLNHPNVLRLYDVWETN+NLYMVLEYAEKGELFNLLVEKGPL E 
Sbjct: 68   DALPYGIEREIIIMKLLNHPNVLRLYDVWETNSNLYMVLEYAEKGELFNLLVEKGPLQEQ 127

Query: 130  EAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSC 189
            EAIRFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIKIADFGMAALETEDKLLETSC
Sbjct: 128  EAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEDKLLETSC 187

Query: 190  GSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFE 249
            GSPHYAAPEIVSG+PYHG  +DVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQ GEFE
Sbjct: 188  GSPHYAAPEIVSGIPYHGFASDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQSGEFE 247

Query: 250  MPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDTYL 309
            MP DDEIS EAQDLL KIL VDPEKRI++R+ILKHPLLQKYPSIKDSK+IRNLPREDTYL
Sbjct: 248  MPSDDEISHEAQDLLAKILTVDPEKRIRARDILKHPLLQKYPSIKDSKSIRNLPREDTYL 307

Query: 310  NPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKVDSE 369
            NPL  N   ++TIDKTILQNLVVLWHGR+ ++I  KL+EPGANAEKTLYALL RFK+DSE
Sbjct: 308  NPLSDN---NSTIDKTILQNLVVLWHGRDVNEIISKLKEPGANAEKTLYALLDRFKIDSE 364

Query: 370  QEALKNSQIKKRQSIISNNNLKSGNINTTTPQKKKNRNSVISVSSSHKRPVSLNRLST-I 428
            +E  KN QI+KRQSI S+ + +S     +TPQ++KNR S+ISVSSSHK+P S NRLS+ +
Sbjct: 365  KENFKNEQIRKRQSITSSVS-RSPAKKASTPQRRKNRISMISVSSSHKKPASFNRLSSVV 423

Query: 429  QNGKDVISVPSSSNTTPGSSKRISMSLSSNKGSKILPQSNSGSPTPAPRNKRMSVQNLET 488
             N     S  +++  +   S    +S+ ++K +     SN+ SPTPA RNKR S+ N + 
Sbjct: 424  HNNLSASSSTTTTPASKKFSMNKKLSMIADKSN-----SNNSSPTPAHRNKRTSMINTDR 478

Query: 489  SSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSITTKIISTYAKLSED 548
             S        +L          +  KRASR SKRLSV+ N KRGSITTK+I+TYAKLSED
Sbjct: 479  QS--------IL----------SKNKRASRSSKRLSVMANMKRGSITTKLIATYAKLSED 520

Query: 549  DDWEFIEKETKRVSSDFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXXXXXXXXXX 608
            DDWE+IEKETKR SSDFATLIDEIFEHEKYEQI                           
Sbjct: 521  DDWEYIEKETKRTSSDFATLIDEIFEHEKYEQIRKEKEELARKVRLAKEREEEERRRREE 580

Query: 609  XXXXXXXXXXXXXXXXXXXXTQITKELQQDTKNFQED-----EVVHKNVRSISSPVENGN 663
                                 Q+ +E++    + + D     E    N RS+S P+   +
Sbjct: 581  EELHKLNEEKKFEAQQLQLQRQMDEEIENLRADLKGDVEPNQEKNEDNYRSVSVPL---S 637

Query: 664  EAKSEEDASGQRSFSLQTRPVSKLDPGIKCGSNKPVQMEEIVEDE--LDKTIDSQKVILE 721
            +    ++   QR+FSLQTRP+S+LDPG+      P + + I  DE   +K +D++K+ILE
Sbjct: 638  KETVNDNLLRQRNFSLQTRPISRLDPGLFFSEQSPTEEKPISPDEPVPNKKLDTEKMILE 697

Query: 722  TIRRSKFLGSSFNIDKELKQVKKDAEVKRMRKSQKEDRDVSGRIVSETNEQYETQVLPKN 781
            TIRRSKFLGSSF+I++ELK     AE + M+            +   T E   +  LPK+
Sbjct: 698  TIRRSKFLGSSFDINRELKA----AEKRVMQPPT---------VQKLTTENKSSDELPKH 744

Query: 782  ATAFGALKDDSEEVEPRKISDIQVPQFTRKSKLFTDSNKRLSVLSIYSSTQSYTNLANVL 841
            A    AL   + EV   KISDI+VPQFTRKS+ FT SN+RLSVLS+YS+ QS++NL ++L
Sbjct: 745  AVGTAALNSSTAEVS--KISDIRVPQFTRKSRHFTTSNRRLSVLSMYSTRQSFSNLVDIL 802

Query: 842  KEGGVDIXXXXXXXXXXXXXXPEFQFETVGTXXXXXXXXXX----XXXXXXXXLSQGANI 897
            K                     EF FETV                          + + +
Sbjct: 803  KNTEAGTELGQRTPTPHSAGDSEFIFETVNEEAEYTGNSSNDDKLYEVADLDAAEKPSGM 862

Query: 898  KLNYADRF-----DTAGNVNEV--KLPTLPPLGDDKVSDGLGIYXXXX-XXXXXXXXPVP 949
            KLN+ADRF     D+     ++  KLP LPPL D K   GLGIY             PV 
Sbjct: 863  KLNFADRFNKKEEDSTEPSRDIQNKLPVLPPL-DGKA--GLGIYQTSSPIEPQLLERPV- 918

Query: 950  SIKENKSEETLKEKNVEPKPPLNDVVP----------------KTRD----------TKK 983
              K +K  ET+   N +P+  +  ++P                KTR            KK
Sbjct: 919  --KGDKFMETISSDNEKPEKEIKSMIPEAVIEEPKNVSPIEVQKTRKDQEHDKRPVMEKK 976

Query: 984  TNVVQNNNAKHSSDKPRSTSFFRKISKGLTVQNDTTGYDVK-LFSNVSVTQLYNGLFNLL 1042
              VV     +   +K RS SFFRK S      N +     K L +N++  Q+++GL  LL
Sbjct: 977  PEVVAPKQRESDQEKKRSVSFFRKFSGSSISSNKSKAETEKVLVTNIAARQVFDGLRRLL 1036

Query: 1043 KGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVFSEGKHSVIGFRKKSGSSK 1102
             GW  YGLK ++S     +IS +LSSDNILSLRST  ++ V S G+ S +  RKKSGSSK
Sbjct: 1037 NGWSKYGLKNVRSVSSTMTISGKLSSDNILSLRSTNFEIKVTSNGESSSVLIRKKSGSSK 1096

Query: 1103 TLKRLTSEVEKVLRKEGVL 1121
             + RLT+E+E +  KEGVL
Sbjct: 1097 AVLRLTTEIENIFSKEGVL 1115

>YDR507C Chr4 complement(1462358..1465786) [3429 bp, 1142 aa] {ON}
            GIN4Protein kinase involved in bud growth and assembly of
            the septin ring, proposed to have kinase-dependent and
            kinase-independent activities; undergoes
            autophosphorylation; similar to Kcc4p and Hsl1p
          Length = 1142

 Score = 1036 bits (2678), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 602/1177 (51%), Positives = 758/1177 (64%), Gaps = 107/1177 (9%)

Query: 10   SVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXX--XX 67
            ++K +TIGPWKLGETLGLGSTGKVQLA N ST Q+AA+KVI                   
Sbjct: 10   AIKDNTIGPWKLGETLGLGSTGKVQLARNGSTGQEAAVKVISKAVFNTGNVSGTSIVGST 69

Query: 68   TPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLP 127
            TPD+L YGIEREIIIMKLLNHPNVLRLYDVWETN +LY+VLEYAEKGELFNLLVE+GPLP
Sbjct: 70   TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNTDLYLVLEYAEKGELFNLLVERGPLP 129

Query: 128  ENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLET 187
            E+EAIRFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIKIADFGMAALETE KLLET
Sbjct: 130  EHEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLET 189

Query: 188  SCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE 247
            SCGSPHYAAPEIVSG+PY G  +DVWSCGVILFALLTGRLPFDEEDGNIR LLLKVQKGE
Sbjct: 190  SCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGE 249

Query: 248  FEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDT 307
            FEMP DDEIS+EAQDL+ KIL VDPE+RIK+R+ILKHPLLQKYPSI+DSK+IR LPREDT
Sbjct: 250  FEMPSDDEISREAQDLIRKILTVDPERRIKTRDILKHPLLQKYPSIRDSKSIRGLPREDT 309

Query: 308  YLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKVD 367
            YL PL      +++ID TILQNLV+LWHGR+ + I +KLREPGANAEKTLYALLYRFK D
Sbjct: 310  YLTPL---SESNSSIDATILQNLVILWHGRDPEGIKEKLREPGANAEKTLYALLYRFKCD 366

Query: 368  SEQEALKNSQIKKRQSIISNNNLKSGNINTTTPQKKKNRNSVISVSSSHKRPVSLNRLST 427
            +++E +K  Q+KKRQSI S +   S    +TTPQ+++NR S+ISV+SS K+P+S N+ + 
Sbjct: 367  TQKELIKQQQVKKRQSISSVSVSPS-KKVSTTPQRRRNRESLISVTSSRKKPISFNKFTA 425

Query: 428  IQNGKDVISVPSSSN-TTPGSSKRISMSLSSNKGSKILPQSNSGSPTPAPRNKRMSVQNL 486
                    S  SSSN TTPGSSKR+S + SS K  K+    N  SPTPA RNKR SV N+
Sbjct: 426  --------SSASSSNLTTPGSSKRLSKNFSSKK--KLSTIVNQSSPTPASRNKRASVINV 475

Query: 487  ETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSITTKIISTYAKLS 546
            E +     I            S+    KR+SR  KR+S++P+ KR S+TTK++STYAKL+
Sbjct: 476  EKNQKRASI-----------FSTTKKNKRSSRSIKRMSLIPSMKRESVTTKLMSTYAKLA 524

Query: 547  EDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXXXXXXXX 606
            EDDDWE+IEKETKR SS+FATLIDEIFE+EKYEQI                         
Sbjct: 525  EDDDWEYIEKETKRTSSNFATLIDEIFEYEKYEQIRKEKEELERKVREAKAREELERRRR 584

Query: 607  XXXXXXXXXXXXXXXXXXXXXXTQITKELQQDTKNFQEDEVVHK------NVRSISSPVE 660
                                   ++ K+++ D  + +++   HK      N+RSIS+P+E
Sbjct: 585  KQEEKERARKLLEKEDLKRKQE-ELKKQIEIDISDLEQELSKHKEEKLDGNIRSISAPME 643

Query: 661  N--GNEAKSEEDASG---QRSFSLQTRPVSKLDPGIKCGSNKPVQMEEIVEDELDKT--- 712
            N   N    E D      +R+FSLQTRPVS+LDPGI   S      EE+   E  +T   
Sbjct: 644  NEEKNINHLEVDIDNILRRRNFSLQTRPVSRLDPGIMFSS----PTEEVSPVEPKRTENE 699

Query: 713  -IDSQKVILETIRRSKFLGSSFNIDKELKQVKKD--AEVKRMRKSQKEDRDVSGRIVSET 769
             + ++K ILETIRRSKFLGSSFNIDKELK  K +  + +   R S++       R+VS++
Sbjct: 700  RLTTEKKILETIRRSKFLGSSFNIDKELKLSKMEYPSIIAPQRLSEE-------RVVSDS 752

Query: 770  NEQYETQVLPKNATAFGALKDDSEEVEP------RKISDIQVPQFTRKSKLFTDSNKRLS 823
            N+ YE+ +LPK+      LKD +    P      RKIS+I+VPQFTRKS+ F++SNKRLS
Sbjct: 753  NDGYESLILPKDGNGVSQLKDSTATTAPVSDGRLRKISEIRVPQFTRKSRHFSESNKRLS 812

Query: 824  VLSIYSSTQSYTNLANVLKEGGVDIXXXXXXX--XXXXXXXPEFQFETVGTXXXXXXXXX 881
            VLS+YS+ +S+TNL ++LK G +D+                 EF FETV           
Sbjct: 813  VLSMYSTKESFTNLVDILKNGNLDVNNQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSS 872

Query: 882  XXXXXX---XXXLSQGANIKLNYADRF---DTAGNVNEVKLPTLPPL-GDDKV------- 927
                        +   + +KLN+ADRF   + A   + + LP LPPL GD+++       
Sbjct: 873  NDERLYDVGDSTIKDKSALKLNFADRFNGSNEAKQTDNLHLPILPPLNGDNELRKQNSQE 932

Query: 928  -------------SDGLGIYXXXXXXXXXXXXPVPSIKENKSEETLKEKNVEP-KPPLND 973
                           G   +              P   + + ++  +EK V+  +PPLN 
Sbjct: 933  GDQAHPKIKSMIPESGSSSHTEKEEENEEKEEKKPEQHKQEEDQEKREKVVDDMEPPLNK 992

Query: 974  VVPKTRDTKKTNVVQNNN----AKHSSDKPRST---SFFRKISKGLTVQNDTTGYDVKLF 1026
             V K R+    +  ++++     +H  DK  +    SFFRK SK     +D T   ++L+
Sbjct: 993  SVQKIREKNAGSQAKDHSKDHLKEHKQDKNTAIGNGSFFRKFSKS----SDKT---MELY 1045

Query: 1027 SNVSVTQLYNGLFNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVFSE 1086
            + +S  QL+NGL  LL+GW  YGLK IKS+    +++ +LSSDNI SLRST  ++ ++  
Sbjct: 1046 AKISAKQLFNGLEKLLRGWTQYGLKNIKSHPNNLTLTGKLSSDNIFSLRSTLFEVNIYPR 1105

Query: 1087 GKHSVIGFRKKSGSSKTLKRLTSEVEKVLRKEGVLAK 1123
            GK SV+ F+K SGS K +K+L +EVE VL KEGVL K
Sbjct: 1106 GKMSVVQFKKVSGSFKAVKKLVNEVENVLNKEGVLQK 1142

>KLTH0F01672g Chr6 (127277..130771) [3495 bp, 1164 aa] {ON} similar to
            uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1164

 Score = 1028 bits (2658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 601/1176 (51%), Positives = 749/1176 (63%), Gaps = 96/1176 (8%)

Query: 10   SVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXT- 68
            ++KGD IGPWKLG TLG GSTGKV +A +EST QQAA+K++                   
Sbjct: 17   TLKGDKIGPWKLGSTLGAGSTGKVVMAQHESTGQQAAVKIVSKSIFGNQSNSSTIVGSND 76

Query: 69   PDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPE 128
            PD L YGIEREIIIMKLLNHPNVLRLYDVWETN++LYMVLEY EKGELFNLLV++GPLPE
Sbjct: 77   PDVLPYGIEREIIIMKLLNHPNVLRLYDVWETNSSLYMVLEYVEKGELFNLLVDRGPLPE 136

Query: 129  NEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETS 188
            NEA+RFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIKIADFGMAALE++DKLLETS
Sbjct: 137  NEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLETS 196

Query: 189  CGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEF 248
            CGSPHYAAPEIVSGLPYHG E+DVWSCG+ILFALLTGRLPFDEEDGNIRNLLLKVQ G+F
Sbjct: 197  CGSPHYAAPEIVSGLPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGKF 256

Query: 249  EMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDTY 308
            EMP  +EIS EAQDL+ KIL VDP  RIKSR ILKHPLLQKYPSIKDSK+IRNLPREDTY
Sbjct: 257  EMPDTNEISGEAQDLIAKILTVDPAARIKSRGILKHPLLQKYPSIKDSKSIRNLPREDTY 316

Query: 309  LNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKVDS 368
            LNPL   D  D TID TI+ NLVVLWHGR+ ++I  KL+EPGAN EKT YALL+RFK DS
Sbjct: 317  LNPL---DSVDGTIDDTIIGNLVVLWHGRDRNEITNKLKEPGANLEKTFYALLFRFKHDS 373

Query: 369  EQEALKNS------QIKKRQSIISNNNLKSGNINTTTPQKKKNRNSVISVSSSHKRPVSL 422
            +QE LK        Q+  +++ +  +N +  +IN+TTP KKK R  VIS SSSHKRPVS 
Sbjct: 374  QQEQLKQQRRSQAMQVSPKKTGLRKSNSRR-SINSTTP-KKKTRAPVISASSSHKRPVSF 431

Query: 423  NRLSTIQNGKDVISVPSSSNTTPGSSKRISMSLSSNKGSKILPQSNSGSPTPAPRNKRMS 482
            +RLS   NG +     +  NT   S KR S++LSSNK    L   NS SPTPA  +KR S
Sbjct: 432  SRLS-YSNGSN-----TDHNTPNSSGKRSSVNLSSNKRISALINPNS-SPTPA--SKRAS 482

Query: 483  VQNLETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSITTKIISTY 542
            ++ L+ S+  PPIPVDMLKDY N  +  AN +++SRISKRLS LP  KRGSITTK+I+TY
Sbjct: 483  LRELDPSA--PPIPVDMLKDY-NKAAPKAN-RKSSRISKRLSFLPGNKRGSITTKLIATY 538

Query: 543  AKLSEDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXXXX 602
            AK+SED+DWE+IEKETKR S+DFATL DEIFEHEKYEQI                     
Sbjct: 539  AKISEDNDWEYIEKETKRTSADFATLCDEIFEHEKYEQIRREKEELERRVREAKEQEERE 598

Query: 603  XXXXXXXXXXXXXXXXXXXXXXXXXXTQITKELQQDT--------KNFQEDEVVHKNV-R 653
                                          +E+Q++         + ++    V  N  R
Sbjct: 599  RRQREEEERRQREEELARQREFEEERYHRQREVQENIDREMALLKEGYETSSGVDPNKNR 658

Query: 654  SISSPVEN--GNEAKSEEDA--------SGQRSFSLQTRPVSKLDPGIKCGSNKPVQMEE 703
            S+S+PVE+    + +S  DA          +R+FSL+TRP S+LDPGI         +EE
Sbjct: 659  SVSAPVESVLKVDKRSSMDALDGDIMDLLNRRTFSLETRPKSRLDPGI-------YTLEE 711

Query: 704  IVEDELD---KTIDSQKVILETIRRSKFLGSSFNIDKELKQVK--KDAEVKRMRKSQKED 758
            +   ++    + + ++K ILETIRRSKFLGSSF+I+KEL + +  K+     +++ +KED
Sbjct: 712  VPNSDIKDGGRDLKTEKTILETIRRSKFLGSSFDINKELARERRLKEERAAALKQRKKED 771

Query: 759  RDVSGRIVSETNEQYETQVLPKNATAFGALKDDSEEVEPRKISDIQVPQFTRKSKLFTDS 818
            R VS    + +   YE Q LPKNA A     D     +PRKIS++QVPQFTR+S+ FT S
Sbjct: 772  RVVSNATGNYSENGYEPQTLPKNAAATKISNDAGS--DPRKISEVQVPQFTRRSRHFTAS 829

Query: 819  NKRLSVLSIYSSTQSYTNLANVLKEGGVDIXXXXXXXXXXXXXXP--EFQFETV---GTX 873
            NKRLSVLS+YS+  S+TNLA+ L+ G  D+              P  EF FE+V   G  
Sbjct: 830  NKRLSVLSMYSTKASFTNLADHLR-GKTDLQSINGSPPSTSRMEPETEFMFESVDGEGKE 888

Query: 874  XXXXXXXXXXXXXXXXXLSQGA---NIKLNYADRFD--------TAGNVNEVKLPTLPPL 922
                               +GA    ++LN+ADRF+        +  + N +KLP+LPPL
Sbjct: 889  TADTSADSRLYEVAEGNDPKGAARSAVRLNFADRFNKPTSPPPQSVEDPNGIKLPSLPPL 948

Query: 923  GDDKVSD---GLGIYXXXXXXXXXXXXPVP-----------SIKENKSEE--TLKEKNVE 966
             D   SD   GLG+Y              P              E K EE   +  K+VE
Sbjct: 949  -DKAKSDGVNGLGLYQPASDSSETEIHHQPKSMIPVDAEQKEAAEAKPEEQKQVPPKDVE 1007

Query: 967  PKP-PLNDVVPKTRDTKKTNVVQNNNAKHSSDKPRSTSFFRKISKGLTVQNDTTGYDVKL 1025
              P PLN V+ K  + +K    Q N    ++ K  + SFFR+ S     +     YD K 
Sbjct: 1008 SAPAPLNKVMKKNTEAEKN---QPNQPAPNAVKKNNKSFFRRFSGKSDDEKRPGEYDFKF 1064

Query: 1026 FSNVSVTQLYNGLFNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVFS 1085
             + +  TQ++N L  LL  WKDYGLK++ ++     I  ++SSDN+LSLRST  ++ + S
Sbjct: 1065 DTVIEGTQMFNALSKLLAAWKDYGLKDVVASPSQKKIKGKMSSDNMLSLRSTLFEISIVS 1124

Query: 1086 EGKHSVIGFRKKSGSSKTLKRLTSEVEKVLRKEGVL 1121
            +G+ S++GF KKSGS+KT K+L  E+EK+L  +  L
Sbjct: 1125 KGEGSIVGFTKKSGSTKTFKKLVKEIEKILESKKAL 1160

>Smik_4.789 Chr4 complement(1385209..1388619) [3411 bp, 1136 aa] {ON}
            YDR507C (REAL)
          Length = 1136

 Score = 1028 bits (2658), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 596/1168 (51%), Positives = 761/1168 (65%), Gaps = 95/1168 (8%)

Query: 10   SVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXX--XXXXXXXXXX 67
            ++K +TIGPWKLGETLGLGSTGKVQLA N+ST Q+AA+KVI                   
Sbjct: 10   AIKDNTIGPWKLGETLGLGSTGKVQLARNKSTGQEAAVKVISKTVFNTGNVSGTSIVGST 69

Query: 68   TPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLP 127
            TPD+L YGIEREIIIMKLLNHPNVLRLYDVWETN +LY+VLEYAEKGELFNLLVE+GPLP
Sbjct: 70   TPDALPYGIEREIIIMKLLNHPNVLRLYDVWETNADLYLVLEYAEKGELFNLLVERGPLP 129

Query: 128  ENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLET 187
            ENEAIRFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIKIADFGMAALETE KLLET
Sbjct: 130  ENEAIRFFRQIIIGVSYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETEGKLLET 189

Query: 188  SCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE 247
            SCGSPHYAAPEIVSG+PY G  +DVWSCGVILFALLTGRLPFDEEDGNIR LLLKVQKGE
Sbjct: 190  SCGSPHYAAPEIVSGIPYQGFASDVWSCGVILFALLTGRLPFDEEDGNIRTLLLKVQKGE 249

Query: 248  FEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDT 307
            FE+P DDEIS+EAQDL+ +IL VDPE+RIK+R+ILKHPLLQKYPSIKDSK+IR LPREDT
Sbjct: 250  FELPSDDEISREAQDLISRILTVDPERRIKTRDILKHPLLQKYPSIKDSKSIRGLPREDT 309

Query: 308  YLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKVD 367
            YL PL      +++ID TILQNLV+LWHGR+ D I +KLRE GANAEKTLYALLYRFK D
Sbjct: 310  YLTPL---SESNSSIDATILQNLVILWHGRDPDGIKEKLRETGANAEKTLYALLYRFKCD 366

Query: 368  SEQEALKNSQIKKRQSIISNNNLKSGNINTTTPQKKKNRNSVISVSSSHKRPVSLNRLST 427
            +++E +K  QIKKRQSI S +   S  + +TTPQ++KNR S+ISVSSS K+P+S N+ + 
Sbjct: 367  TQKELVKQQQIKKRQSISSLSISPSKKL-STTPQRRKNRESMISVSSSRKKPISFNKFTA 425

Query: 428  IQNGKDVISVPSSSN-TTPGSSKRISMSLSSNKGSKILPQSNSGSPTPAPRNKRMSVQNL 486
                    S  SSSN TTPGSSKR+S + SS K  K+    N  SPTPA RNKR SV N+
Sbjct: 426  --------SSASSSNLTTPGSSKRLSKNFSSKK--KLSTIVNQSSPTPASRNKRASVINI 475

Query: 487  ETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSITTKIISTYAKLS 546
            E +     +            S+    KR S+  KR+S++P+ KR S+TTK++STYAKL+
Sbjct: 476  EKNQKRASV-----------FSTAKKNKRTSKSIKRMSLIPSMKRESVTTKLMSTYAKLA 524

Query: 547  EDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXXXXXXXX 606
            EDDDWE+IEKETKR SS+FATLIDEIFE+EKYEQI                         
Sbjct: 525  EDDDWEYIEKETKRTSSNFATLIDEIFEYEKYEQIRKEKEELERKVREAKAREELERRRR 584

Query: 607  XXXXXXXXXXXXXXXXXXXXXXTQITKELQQDTKNFQEDEVVHK------NVRSISSPVE 660
                                   ++ K+++ D  + +++   HK      N+RSIS+P+E
Sbjct: 585  RQEEKERTRKLLEKEELKMKQE-ELKKQIEMDISDLEQELSRHKEEKPDGNIRSISAPME 643

Query: 661  NGNE-----AKSEEDASGQRSFSLQTRPVSKLDPGIKCGSNKPVQMEEIVEDEL--DKTI 713
            N  +         ++   +R+FSLQTRPVS+LDPGI   SN P++    VE +   ++ +
Sbjct: 644  NEEKNIDHLGTDIDNILRRRNFSLQTRPVSRLDPGI-VFSN-PIETVYPVEPKRSENERL 701

Query: 714  DSQKVILETIRRSKFLGSSFNIDKELKQVKKDAEVKRMRKSQKEDRDVSG-RIVSETNEQ 772
             ++K ILETIRRSKFLGSSFNI+KELK  K   E   +   +K    +SG R+VS+ N +
Sbjct: 702  TTEKKILETIRRSKFLGSSFNIEKELKLSK--MEYPSVLAPEK----LSGERVVSDLNGK 755

Query: 773  YETQVLPKNATAFGALKDD-----SEEVEP---RKISDIQVPQFTRKSKLFTDSNKRLSV 824
            YE+ +LPK+A     LKDD     +E +     RKIS+++VPQFTRKS+ F++SNKRLS+
Sbjct: 756  YESLILPKDAKGVSQLKDDITSTTTEHLSDGKLRKISEVRVPQFTRKSRHFSESNKRLSL 815

Query: 825  LSIYSSTQSYTNLANVLKEGGVDIXXXXXXX--XXXXXXXPEFQFETVGTXXXXXXXXXX 882
            LS+YS+ +S+TNL ++LK   +D+                 EF FETV            
Sbjct: 816  LSMYSTKESFTNLVDILKNSNLDVNNQQSQRIPTPRSADDSEFLFETVNEEAEYTGNSSN 875

Query: 883  XXXXX---XXXLSQGANIKLNYADRFDTAGNVNE---VKLPTLPPL-GDDKVSDGLGIYX 935
                       +     +KLN+ADRF+ +    E   + LP+LPPL GDD++        
Sbjct: 876  DERLYDVGDSTIKDKTALKLNFADRFNESTEYKETDNLHLPSLPPLSGDDEMRKQNS--E 933

Query: 936  XXXXXXXXXXXPVPSIKENKSEETLKEKN--------------VEPKPPLNDVVPKTRDT 981
                        +P    +   E ++EK                + +PPLN  V K R+ 
Sbjct: 934  EDSLVQPKVKSMIPQSDSSSHTEKVEEKEGESQEVQEESEKEAKDIEPPLNKSVQKLREK 993

Query: 982  ----KKTNVVQNNNAKHSSDKPRS--TSFFRKISKGLTVQNDTTGYDVKLFSNVSVTQLY 1035
                ++ +  +++  +H  D+  +  +SFFRK SK     +  +   V+L++ VS  QL+
Sbjct: 994  NPGPQEKDHQRDHLKEHKQDRNTTGNSSFFRKFSK-----SSASDKLVELYAKVSARQLF 1048

Query: 1036 NGLFNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVFSEGKHSVIGFR 1095
            NGL  LL+GW  +GLK IKS+    +++ +LSS+NI SLRST  ++ ++ +G+ SV+ F+
Sbjct: 1049 NGLEKLLRGWTQFGLKNIKSHPNNLTLTGKLSSENIFSLRSTLFEINIYPKGRMSVVQFK 1108

Query: 1096 KKSGSSKTLKRLTSEVEKVLRKEGVLAK 1123
            K SGS K +K+L +EVE VL KEGVL K
Sbjct: 1109 KISGSFKAVKKLVNEVENVLNKEGVLQK 1136

>KLLA0C01650g Chr3 (128119..131457) [3339 bp, 1112 aa] {ON} similar to
            uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1112

 Score = 1022 bits (2643), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 591/1161 (50%), Positives = 728/1161 (62%), Gaps = 101/1161 (8%)

Query: 7    GNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXX 66
            G  ++KGDTIGPWKLG TLG+GSTGKV +AYNE+  QQAA+K+I                
Sbjct: 5    GITTLKGDTIGPWKLGSTLGVGSTGKVVMAYNETKGQQAAVKIISKSIFNAQGSTMIGGN 64

Query: 67   XTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPL 126
              PD L YGIEREIIIMKLLNHPNVLRLYDVWET+ +LYMVLEY EKGELFNLLVE+GPL
Sbjct: 65   D-PDVLPYGIEREIIIMKLLNHPNVLRLYDVWETSKDLYMVLEYVEKGELFNLLVERGPL 123

Query: 127  PENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLE 186
            PENEA+RFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK N+K+ADFGMAALE++DKLLE
Sbjct: 124  PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNVKLADFGMAALESKDKLLE 183

Query: 187  TSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKG 246
            TSCGSPHYAAPEIVSGLPYHG E+DVWSCGVIL+ALLTGRLPFDEEDGNIRNLLLKVQ G
Sbjct: 184  TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKVQSG 243

Query: 247  EFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPRED 306
            +FEMPGDDEIS EAQDL+ +IL VDPE+RIK+REILKHPLL+KYPSIKDSK+IRNLPRED
Sbjct: 244  KFEMPGDDEISSEAQDLIARILTVDPEQRIKTREILKHPLLRKYPSIKDSKSIRNLPRED 303

Query: 307  TYLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKV 366
            TYLNPL   +GG+  +D+TILQNLVVLWHGRN++DI  KL EPGAN EKT YALL+RFK 
Sbjct: 304  TYLNPL-SLEGGNQCVDETILQNLVVLWHGRNKEDIITKLMEPGANLEKTFYALLHRFKH 362

Query: 367  DSEQEALKNSQIKKRQSIISNNNLKSGNINT--------TTPQKKKNRNSVISVSSSHKR 418
            D+ Q+ LK  +++K+QS+ SN+ +  G++ +        TTP+KK  R S+I  SSSHKR
Sbjct: 363  DNYQDQLKQQELQKKQSVSSNSLMYVGSLPSPNKSDSPVTTPKKK--RTSIIVASSSHKR 420

Query: 419  PVSLNRLSTIQNGKDVISVPSSSNTTPGS-SKRISMSLSSNKGSKILPQSNSGSPTPAPR 477
            PVS+ +LS+            SS    GS  KR+S +  SNK    L  SNS SPTPA  
Sbjct: 421  PVSMQKLSSQH----------SSPVKNGSIGKRLSKTFPSNKRISQL-VSNSSSPTPAA- 468

Query: 478  NKRMSVQNLETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSITTK 537
            +KR+S  N    S  PP+P +ML+DY          +++ R SKR S+LPN KRGSITTK
Sbjct: 469  HKRVSRIN---DSAAPPVPKEMLRDY---------KRQSKRQSKRFSLLPNMKRGSITTK 516

Query: 538  IISTYAKLSEDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXX 597
            +I+TYAKLSED +WE+IEKETKR S DFATL+D+IFEHEKYEQI                
Sbjct: 517  LIATYAKLSEDSEWEYIEKETKRTSQDFATLMDQIFEHEKYEQIRKEKEELERKVNEARE 576

Query: 598  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTQITKELQQDTKNFQ---------EDEVV 648
                                            ++  +++ +    +          DE  
Sbjct: 577  KEEAERKERERIEREEQERLEREERKRAERQKELQDQMEDEIAKLKAEYEAVQGSSDERN 636

Query: 649  HKNVRSISSPVENGNEAKSEEDASG----------QRSFSLQTRPVSKLDPGIKCGSNKP 698
              N RS+S+P+E    A   +   G           R+FSLQTRPVS+LDPGI    ++ 
Sbjct: 637  TANGRSVSAPIETDRTANKRDSTFGIKNDINELINTRNFSLQTRPVSRLDPGIIAAESR- 695

Query: 699  VQMEEIVEDELDKTIDSQKVILETIRRSKFLGSSFNIDKELKQVKKDAEVKRMRKSQKED 758
              +   +ED+       +K ILETIRRSKFLGS FN++ EL++ +KD  V + R+ Q   
Sbjct: 696  --LSANLEDD---QASKEKTILETIRRSKFLGSQFNLNVELEKAQKDL-VSKERQEQL-- 747

Query: 759  RDVSGRIVSETNEQYETQVLPKNATAFGALKDDSEEVEPRKISDIQVPQFTRKSKLFTDS 818
                 R  SE   +YE Q LPKNA A   L+DD  EVEPRK+S+++VPQFTR+SK F+ S
Sbjct: 748  -----RKYSEQTAKYEVQKLPKNAKAVATLRDD--EVEPRKLSEVKVPQFTRRSKHFSSS 800

Query: 819  NKRLSVLSIYSSTQSYTNLANVLKEGGV--DIXXXXXXXXXXXXXXPEFQFETVGTXXXX 876
            NKR SVLS+YS+  S+TNL + LK       +              PEF FETV      
Sbjct: 801  NKRFSVLSLYSTKTSFTNLVDHLKNDNYLEPLPGQPEYSSSKVAQEPEFMFETVEELDEN 860

Query: 877  XXXXXXXXXXXXXXLSQGANIKLNYADRFDTAGNVNEVKLPTLPPL------GDDKVSDG 930
                           S     +    D    + N  ++ LP+LPPL       D+  + G
Sbjct: 861  SKLFEVPETEEGKLASAA---RKESTDARKQSTNDKDINLPSLPPLQVSHDVADENGALG 917

Query: 931  LGIYXXXXXXXXXXXXPV--PSIKENKSEET-LKEKNVEPKPPLNDVVPKTRDTKK---- 983
            LGIY             +   SI EN S  + +    V  KPPLNDVV K  + +K    
Sbjct: 918  LGIYQPNDQTQKPHKTMLIDESIDENISSTSDVSRTEVVKKPPLNDVVRKNNNERKPLEE 977

Query: 984  -TNVVQNNNAKHSSDKPRSTSFFRKISKGLTVQNDTTGYDVKLFSNVSVTQLYNGLFNLL 1042
             T  V+N          R  SFFRK S+G   +     +D +L + VS  ++Y  L  LL
Sbjct: 978  ITPKVENK---------RKISFFRKFSQGSEKKLGPESFDSQLKAGVSAPKMYKALDRLL 1028

Query: 1043 KGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRST-FVDMVVFSEGKHSVIGFRKKSGSS 1101
              W +YGLK ++S+   F IS +L+SDNILSLRST F   V+  EG  S+I F KKSGS+
Sbjct: 1029 NEWTNYGLKHVESSPNDFVISGKLTSDNILSLRSTGFKITVLPGEGNGSIIQFTKKSGST 1088

Query: 1102 KTLKRLTSEVEKVLRKEGVLA 1122
            KT  RL  E+EK+L KE VL 
Sbjct: 1089 KTFNRLVKEIEKILEKEKVLV 1109

>KNAG0F00290 Chr6 (31750..35127) [3378 bp, 1125 aa] {ON} Anc_1.52
            YDR507C
          Length = 1125

 Score =  998 bits (2579), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 586/1176 (49%), Positives = 738/1176 (62%), Gaps = 115/1176 (9%)

Query: 4    SNKGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXX 63
            +NK   ++KGD IG WK+GETLGLGSTGKVQLAYN++T  QAAIKVI             
Sbjct: 3    TNKTTPTIKGDQIGSWKMGETLGLGSTGKVQLAYNKTTGNQAAIKVISKTIFQDSNVTSM 62

Query: 64   XXXXTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEK 123
                TPD+L YGIEREI+IMKLLNH NVLRLYDVWETN+NLYMVLEYAEKGELFNLLVE+
Sbjct: 63   VDNTTPDALPYGIEREIVIMKLLNHANVLRLYDVWETNSNLYMVLEYAEKGELFNLLVER 122

Query: 124  GPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDK 183
            GPLPENEAIRFFRQIIIG+SYCHALGIVHRDLKPEN+LLD K NIKIADFGMAALETEDK
Sbjct: 123  GPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDTKYNIKIADFGMAALETEDK 182

Query: 184  LLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKV 243
            LLETSCGSPHYAAPEIVSG+PYHG  +DVWSCGVIL+ALLTGRLPFDEEDGNIRNLLLKV
Sbjct: 183  LLETSCGSPHYAAPEIVSGIPYHGFASDVWSCGVILYALLTGRLPFDEEDGNIRNLLLKV 242

Query: 244  QKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLP 303
            Q G+FEMP DDEISKEAQ+L+ KILVV+P +RI +R+ILKHPLLQKYPSIKDSK+IRNLP
Sbjct: 243  QAGQFEMPEDDEISKEAQNLISKILVVNPAERITARDILKHPLLQKYPSIKDSKSIRNLP 302

Query: 304  REDTYLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYR 363
            REDTYL+PL      ++ ID+ ILQNLVVLWHGR+  +I  KL+E GANAEKTLYA+L R
Sbjct: 303  REDTYLHPLAET---NSAIDENILQNLVVLWHGRDPAEIRVKLKEHGANAEKTLYAMLNR 359

Query: 364  FKVDSEQEALKNSQIKKRQSIISNN------------NLKSGNINTTTPQKKKNRNSVIS 411
            FK+D EQE LKN  +K RQS   +             N  SGN NTT   +KKNR SVIS
Sbjct: 360  FKLDVEQENLKNEHLKNRQSGGQSTSMAPATNQSTAVNRSSGNKNTTP--RKKNRASVIS 417

Query: 412  VSSSHKRPVSLNRLSTIQNGKDVISVPSSSNTTPGSSKRISMSLSSNKGSKILPQSN-SG 470
            V+SSHKRP+S  +L T+ +   + ++      TP +S R    LS   G    P SN +G
Sbjct: 418  VTSSHKRPISFQKLPTLNSTSSLAAI------TPSTSAR-RKRLSKISG---YPVSNVNG 467

Query: 471  SPTPAPRNKRMSVQNLETSSNPPPIPVDMLKDYGNSTSSHANA-KRASRISKRLSVLPNA 529
            SPTPA R KR S+ N++ +               +ST    N  K+ +R SKR+S+LPN 
Sbjct: 468  SPTPASRKKRNSMANIQAAR--------------SSTIKKTNTFKKNNRASKRVSILPNN 513

Query: 530  KRGSITTKIISTYAKLSEDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQIXXXXXXXX 589
            K G+I +K+ISTYAKLSEDD+WE++E+ETKR SS+FATLIDEIFEHEKYEQI        
Sbjct: 514  KNGTIASKLISTYAKLSEDDEWEYLEQETKRTSSNFATLIDEIFEHEKYEQIRKEKEELA 573

Query: 590  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTQITKELQQDTKNFQEDEVVH 649
                                                     + +E++   K    D + H
Sbjct: 574  RKVREAKEREEAERKQKELQEREKQRERERKENETNDRQRIMEEEIENLKKEL--DMMSH 631

Query: 650  KN---VRSISSPV---ENGNEAKSEEDASGQRSFSLQTRPVSKLDPGIKCGS------NK 697
            +     RS+S P+   + G E + +E    QR+ +LQTRP S+LDPG+   S      N 
Sbjct: 632  EGKTESRSVSEPLNKKQGGVEIEVKELLR-QRNAALQTRPKSRLDPGLFFDSAESDTRNP 690

Query: 698  PVQMEEIVEDELDKTIDSQKVILETIRRSKFLGSSFNIDKELKQVKKDAEVKRMRKSQKE 757
             +Q   + E E+D  + ++K ILETIRRSKFLGSSF+I KELK     ++  R       
Sbjct: 691  SLQ---VFEGEVDNKLKTEKAILETIRRSKFLGSSFDISKELKSASARSDYSR------- 740

Query: 758  DRDVSGRIVSETNEQYETQVLPKNATAFGALKDDSEEVEPRKISDIQVPQFTRKSKLFTD 817
                 GR+++  +    + VLPKNA A   L+  S++ E RKISDI+VPQFTRKS+ F++
Sbjct: 741  ---APGRVITAPSNLERSDVLPKNAIATAPLRIHSDQPEVRKISDIKVPQFTRKSRNFSE 797

Query: 818  SNKRLSVLSIYSSTQSYTNLANVL---KEGGVDIXXXXXXXXXXXXXXPEFQFETVGTXX 874
            S+KRLSVLS+YS+ QS+ NL++++    E                    EF FE+V    
Sbjct: 798  SSKRLSVLSMYSTRQSFKNLSDMMNFESENTDAAENRGQIATPNSAGQSEFLFESVNEEA 857

Query: 875  XXXXXXXX----XXXXXXXXLSQGANIKLNYADRFDTAGNVNEV--KLPTLPPLGDDKVS 928
                                 S    +++N +DR++ A +  ++  KLP LPPL D +++
Sbjct: 858  ENTNNTSTDGKLYEVSESPESSSKKGLRVNLSDRYNKANSEADMENKLPILPPL-DPEIA 916

Query: 929  DGLGIYXXXXXXXXXXXXPVPSIKENKSEET------------LKEKNVE--PKPPLNDV 974
             GLGIY            P     ++KS ET            LK +N+   P+PP+ + 
Sbjct: 917  -GLGIY--QDQPEEVNAKPQEKKSKSKSAETGDISEGEPEVSDLKAENIRKAPQPPITE- 972

Query: 975  VPKTRDTKKTNVVQNNNAKHSSDKPRSTSFFRKISKGLTVQNDTTGYDVK---------L 1025
              K  D KK     +   K S +   S +F RK+S     Q++TT   VK         +
Sbjct: 973  -KKKLDAKKQR--NDERTKASKENTFSNNFLRKLSG----QSNTTTQSVKKTKLGAEDGI 1025

Query: 1026 FSNVSVTQLYNGLFNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVFS 1085
             + VS TQ+Y GL+NLL+GW  YGLK IK N E  +I+ +L+S+NILSLRST  ++++  
Sbjct: 1026 HTTVSATQMYQGLYNLLRGWGSYGLKSIKGNSENMTITGKLASENILSLRSTIFEIIIIR 1085

Query: 1086 EGKHSVIGFRKKSGSSKTLKRLTSEVEKVLRKEGVL 1121
            EGK S +  +KKSGS+K + RL  EV+ VL KEGV+
Sbjct: 1086 EGKGSKVDIKKKSGSTKAVNRLAGEVKNVLVKEGVM 1121

>NDAI0A00660 Chr1 (121773..124841) [3069 bp, 1022 aa] {ON} Anc_1.52
          Length = 1022

 Score =  970 bits (2508), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 567/1163 (48%), Positives = 728/1163 (62%), Gaps = 184/1163 (15%)

Query: 2    ISSNKGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXX--XXXXXX 59
            ++S  G   +KGDTIGPWKLG+TLGLGSTGKV+LAYNE+T+QQAAIK+I           
Sbjct: 1    MTSVVGETKMKGDTIGPWKLGKTLGLGSTGKVELAYNETTSQQAAIKIISKSIFSQGTVG 60

Query: 60   XXXXXXXXTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNL 119
                    +PD+L YGIEREIIIMKLL HPNVL LYDVWETN+ LYM+LEYAEKGELFNL
Sbjct: 61   ESSMVSNSSPDALPYGIEREIIIMKLLRHPNVLSLYDVWETNSKLYMILEYAEKGELFNL 120

Query: 120  LVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALE 179
            LVE+GPLPE EAIRFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHKLNIKIADFGMAALE
Sbjct: 121  LVERGPLPEKEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKLNIKIADFGMAALE 180

Query: 180  TEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNL 239
            T+DK+LETSCGSPHYAAPEIVSG+PYHG ++DVWSCGVILFALLTGRLPFDEEDGNIRNL
Sbjct: 181  TKDKMLETSCGSPHYAAPEIVSGVPYHGFQSDVWSCGVILFALLTGRLPFDEEDGNIRNL 240

Query: 240  LLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTI 299
            LLKVQ GE+EMP DDEISKEAQDL+ +IL VDPE+RIK+R+ILKHPLLQKYPSIKDS++I
Sbjct: 241  LLKVQSGEYEMPDDDEISKEAQDLIGRILTVDPEQRIKTRDILKHPLLQKYPSIKDSRSI 300

Query: 300  RNLPREDTYLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYA 359
            +NLPREDTYL PL  N   ++ ID +ILQNLV LWHGR++DDIA KLRE GA+AEKT+YA
Sbjct: 301  KNLPREDTYLYPLSEN---NSIIDDSILQNLVALWHGRDKDDIAGKLRESGADAEKTVYA 357

Query: 360  LLYRFKVDSEQEALKNSQIKKRQSIISNNNLKSGNINTTTPQKKKNRNSVISVSSSHKRP 419
            LLYRFKV++E+                        +NT +  ++KNR S+ISVSSSHKRP
Sbjct: 358  LLYRFKVEAEK------------------------MNTCSSPRRKNRISMISVSSSHKRP 393

Query: 420  VSLNRLSTIQNGKDVISVPSSSNTTPGSSKRISMSLSSN---KGSKILPQSNSGSPTPAP 476
            VS+ ++ST+QN             TP S++R+S+SLSS    + S IL  +NS SPTP+ 
Sbjct: 394  VSMKKISTVQNN------------TPPSNRRLSISLSSTQRKRMSGILQHTNS-SPTPS- 439

Query: 477  RNKRMSVQNLETSSN--PPPIPVDMLKDYGNSTSSHANAKRASRISK------RLSVLPN 528
            R KR+SV N++ S N  PPP+P++ML+DY N++    N +R  +  K      RL+++ N
Sbjct: 440  RTKRISVINIDDSENKAPPPVPMEMLEDYKNNSK---NVRRTIKKKKKKKNNYRLTLV-N 495

Query: 529  AKRGSITTKIISTYAKLSEDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQIXXXXXXX 588
             KR SITTK++STYAKLSEDD+WE+IE+ETKR SSDFATLIDE+FEHEKYE+I       
Sbjct: 496  NKRVSITTKLLSTYAKLSEDDNWEYIERETKRTSSDFATLIDELFEHEKYERI------- 548

Query: 589  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTQITKELQQDTKNFQEDEVV 648
                                                     ++ +++ ++    +ED + 
Sbjct: 549  -------RKEKEELERKVRETRVREQRREEEERAELQREQLKLQQKIDEEISKLKEDALE 601

Query: 649  HKNVRSISSPVENGNEAKSEEDA-SGQRSFSLQTRPVSKLDPGIKCGSNKPV-QMEEIVE 706
              N RS+S+P++   +    E+    +R FSLQTRPVS+LDPGI   +   +   E +V 
Sbjct: 602  KDNFRSVSAPIKENEDEDENENELRNRRQFSLQTRPVSRLDPGILYSAPAEIPSYERVVV 661

Query: 707  DEL--DKTIDSQKVILETIRRSKFLGSSFNIDKELKQVKKDAEVKRMRKSQKEDRDVSGR 764
            +E     +   Q+ ILETIRRSKFLGSSFNI +EL+  +++  V    K Q  D D    
Sbjct: 662  NESGNKSSAQQQRKILETIRRSKFLGSSFNIQQELEFSQRNVLVP--TKEQVVDVD---- 715

Query: 765  IVSETNEQYETQVLPKNATAFGALKDDSEEVEPRKISDIQVPQFTRKSKLFTDSNKRLSV 824
                                 G L         RKIS++++PQFTRKS+ F+DSNKRLSV
Sbjct: 716  ----------------EVKLEGGL---------RKISEVKIPQFTRKSRHFSDSNKRLSV 750

Query: 825  LSIYSSTQSYTNLANVLKEGGVDIXXXXXXXXXXXXXXPEFQFETVGTXXXXXXXXXXXX 884
            LS+YS+ QSYTNL ++LK+G                  PE  FE+               
Sbjct: 751  LSMYSTKQSYTNLGHILKDG--------TEESEPAKKTPELLFES--------------- 787

Query: 885  XXXXXXLSQGANIKL----NYADRFDTAGNVNEVKLPTLPPL---------GDDKVSDGL 931
                     G + +L       +  +   ++  V LP LPPL          ++   +GL
Sbjct: 788  ---------GRDDRLYEVSEEPEIQEEKEDIETVTLPQLPPLKQSANTNANANETEINGL 838

Query: 932  GIYX-----XXXXXXXXXXXPVPSIKENKSEETL-----KEKNVEPKPPLNDVVPKTRDT 981
             I+                  +PS    K +        +   V+P+  L+++ P     
Sbjct: 839  AIFRPKENIELEDITKEVKEVIPSQDHGKDKPIAINNPKQRLEVKPERQLDEIAP----- 893

Query: 982  KKTNVVQNNNAKHSSDKPRSTSFFRKISKGLTVQNDTT--GYDVKLFSNVSVTQLYNGLF 1039
                     N   +++K R+ SFFRK S      N  T  GYD +++ N+   QLY GL 
Sbjct: 894  ---------NKVGTTEKKRNVSFFRKFS-----NNSATIKGYDHEIYVNIGSRQLYTGLR 939

Query: 1040 NLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVFSEG-KHSVIGFRKKS 1098
             LL+GW  YGLK+++S+  A  I+ +L++DNILSLRST  +++V  +G K+S+IGF K  
Sbjct: 940  KLLEGWTQYGLKDVRSDNTAMKITGKLANDNILSLRSTLFELLVEPKGSKYSLIGFTKVQ 999

Query: 1099 GSSKTLKRLTSEVEKVLRKEGVL 1121
            GSSK ++RL +E+EKVL KEGVL
Sbjct: 1000 GSSKVVRRLFTEIEKVLNKEGVL 1022

>CAGL0K05709g Chr11 complement(556732..560043) [3312 bp, 1103 aa] {ON}
            similar to uniprot|Q12263 Saccharomyces cerevisiae
            YDR507c GIN4
          Length = 1103

 Score =  959 bits (2479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 572/1156 (49%), Positives = 739/1156 (63%), Gaps = 94/1156 (8%)

Query: 2    ISSNKGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXX 61
            ISSN  ++ +K + IGPWKLGETLG GSTGKV LA NE+T QQAA+KVI           
Sbjct: 4    ISSNTVSV-IKNNQIGPWKLGETLGSGSTGKVLLASNETTKQQAAVKVISKAVFEAMNNS 62

Query: 62   XXXXXXTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLV 121
                  T ++L Y IE+EIIIMKLLNHPNVLRL+DVWETN++LY+VLEYAEKGELFN+LV
Sbjct: 63   ESNGDAT-NALPYNIEQEIIIMKLLNHPNVLRLFDVWETNSDLYLVLEYAEKGELFNMLV 121

Query: 122  EKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETE 181
            E+GPLPENEA+R FRQIIIG+SYCH+LG+VHRDLKPEN+LLD+KLNIKIADFGMAALE+E
Sbjct: 122  ERGPLPENEAVRAFRQIIIGISYCHSLGVVHRDLKPENLLLDNKLNIKIADFGMAALESE 181

Query: 182  DKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241
            DKLLETSCGSPHYAAPEI+SGLPY G  +DVWSCGVILFALLTGRLPFDEEDGNIRNLLL
Sbjct: 182  DKLLETSCGSPHYAAPEIISGLPYEGFSSDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241

Query: 242  KVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRN 301
            KVQKGEFEMP DDEI+KEAQDLL ++L VDP KRI  REILKHPLLQKYPSIKDS++IRN
Sbjct: 242  KVQKGEFEMPDDDEITKEAQDLLARLLTVDPSKRITIREILKHPLLQKYPSIKDSRSIRN 301

Query: 302  LPREDTYLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALL 361
            LPREDTYL+PL      ++ ID  ILQNLV+LWHG++  +IA KLREPGAN EKTLYALL
Sbjct: 302  LPREDTYLSPLADT---NSKIDDAILQNLVILWHGKDAREIAAKLREPGANTEKTLYALL 358

Query: 362  YRFKVDSEQE---ALKNSQIKKRQSIISNNNLKS-GNINTTTPQKKKNRNSVISVSSSHK 417
            YRFK D+++E   A + S+I +R S I +   +S     T TPQKK  R S+I  +SS K
Sbjct: 359  YRFKCDTQREANRARRQSKIVQRNSTIRSTAPESPSKKKTYTPQKKNKRASII--ASSSK 416

Query: 418  RPVSLNRLSTIQNGKDVISVPSSSNTTPGSSKRISMSLSSNKGSKILPQSNSGSPTPAPR 477
            RPVS+ + +T       I+V SS   TP S+KR+SM+ S+ K    L      SPT   R
Sbjct: 417  RPVSVTKTAT------NITVNSSITGTPKSAKRMSMNNSARKRMSAL-YGTRDSPTKTSR 469

Query: 478  NKRMSVQNLETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSITTK 537
            ++R S+   +   N P           +S  S ++ KRAS+ SKR+S++PN KR S+TTK
Sbjct: 470  SRRSSIITKDFLGNRP----------RDSVISMSHNKRASKSSKRISLVPNLKRQSVTTK 519

Query: 538  IISTYAKLSEDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXX 597
            +++TYAKLSEDDDWE+IE+ETKR SSDFATLIDEIFE+EKYEQI                
Sbjct: 520  LMATYAKLSEDDDWEYIERETKRTSSDFATLIDEIFEYEKYEQIRKEKAELERKVRETKE 579

Query: 598  XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXTQITKELQQDTKNFQEDEVVHKNVRSISS 657
                                            Q+ +E+    K    D+      RS+S 
Sbjct: 580  REERERKERQEKELQERLERERIEKQKEDIARQMDEEISNLKKELVGDQDNEDKFRSVSE 639

Query: 658  PVENGNEAKS--EEDASG---QRSFSLQTRPVSKLDPGIKCGSNKPVQMEEIV------E 706
            P+E+ ++     EED  G    R +SLQTRPVS+LDPGI    +KP Q E+ V      E
Sbjct: 640  PLESKSKKIEDIEEDIDGILRNRKYSLQTRPVSRLDPGIGF-IDKPRQSEQHVPETVNLE 698

Query: 707  DELDKTIDSQKVILETIRRSKFLGSSFNIDKELKQVKKDAEVKRMRKSQKEDRDVSGRIV 766
             EL++T   ++ ILETIRRSKFLGSSF+I KEL+ VK+  +      SQ  +++++   +
Sbjct: 699  PELEET---EQKILETIRRSKFLGSSFDIKKELENVKRHRQT-----SQPIEKEMAPPAL 750

Query: 767  SETNEQYETQVLPKNATAFGALKDDSEEVEP--RKISDIQVPQFTRKSKLFTDSNKRLSV 824
             ET        LPK      A++  +  ++P  RKISDI+VPQFTRKS+ F+ SN+RLSV
Sbjct: 751  PET--------LPK------AVEKKNVSMDPSLRKISDIKVPQFTRKSRHFSTSNRRLSV 796

Query: 825  LSIYSSTQSYTNLANVLKEGGVDIXXXXXXXXXXXXXXPEFQFETVGTXXXXXXXXXXXX 884
            LS+YS+ +SY+NLA++LK G  +                +  F+T+              
Sbjct: 797  LSMYSTKESYSNLADILKNGPGEKEMIQTAPTPKSADDSDQLFDTIDEADTPASVSREER 856

Query: 885  XXXXXXLSQG--ANIKLNYADRFDTAG----NVNE----VKLPTLPPLGDDKVSDGLGIY 934
                   S+   AN K++ AD  ++ G    +V E    +KLP LPPL +D         
Sbjct: 857  LYEVAEESENELANKKIDIADLLNSEGSNLKSVEEQEDSMKLPKLPPLFED--------- 907

Query: 935  XXXXXXXXXXXXPVP-SIKENKSEETLKEKNVEPKPPLNDVVPKTRDT--------KKTN 985
                         +P +++ ++S++ +++ N +    LN  + K RD         K T 
Sbjct: 908  GSTKETKEQSKSMIPENMQSSESQKQIEKNNSDEGGSLNPFMTKHRDVSDKGVTKEKPTV 967

Query: 986  VVQNNNAKHSSDKPRSTSFFRKISKGLTVQNDTTGYDVKLFSNVSVTQLYNGLFNLLKGW 1045
             ++  + + S+DK R+ SF RK+SKG +   D    DV L ++VS  QL++GL NLLKGW
Sbjct: 968  TMKTTSEQVSADKKRNMSFLRKLSKGSSSSKDNV--DVTLSTSVSSKQLFSGLVNLLKGW 1025

Query: 1046 KDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVFSEGKHSVIGFRKKSGSSKTLK 1105
              YGLK I  +  + +I+ +L++DNILS RST   +++FS+ K S + FRK SGS K ++
Sbjct: 1026 TKYGLKGIAIDSTSQTITGKLANDNILSFRSTAFSILIFSQEKGSAVTFRKVSGSGKAVR 1085

Query: 1106 RLTSEVEKVLRKEGVL 1121
            RL+ EV+KVL KEGVL
Sbjct: 1086 RLSDEVKKVLSKEGVL 1101

>SAKL0C01716g Chr3 (143880..147527) [3648 bp, 1215 aa] {ON} similar
           to uniprot|Q12263 Saccharomyces cerevisiae YDR507C
          Length = 1215

 Score =  768 bits (1983), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/605 (64%), Positives = 460/605 (76%), Gaps = 49/605 (8%)

Query: 10  SVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXX---XXXXXXXXXXXXX 66
           ++K D IGPWKLG  LG GS GKV +A +E+T QQAA+K++                   
Sbjct: 17  TLKNDKIGPWKLGSILGAGSAGKVLMAQHETTGQQAAVKIVSKSIFGAVAQNNSSTIVGS 76

Query: 67  XTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPL 126
             PD L YGIEREIIIMKLLNH NVLRLYDVWET +NLYMVLEY EKGELFNLLVE+GPL
Sbjct: 77  NDPDLLPYGIEREIIIMKLLNHTNVLRLYDVWETKSNLYMVLEYVEKGELFNLLVERGPL 136

Query: 127 PENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLE 186
           PENEA+RFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIKIADFGMAALE++DKLLE
Sbjct: 137 PENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLE 196

Query: 187 TSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKG 246
           TSCGSPHYAAPEIVSGLPYHG E+DVWSCGVIL+ALLTGRLPFDE++GNIR+LLLKVQ G
Sbjct: 197 TSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDNGNIRSLLLKVQSG 256

Query: 247 EFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPRED 306
           E+EMPG+DEIS EAQDL+ KIL VDP++RIK+REILKHPLLQKYPSIKDSK+IRNLPRED
Sbjct: 257 EYEMPGNDEISSEAQDLIAKILTVDPDRRIKTREILKHPLLQKYPSIKDSKSIRNLPRED 316

Query: 307 TYLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKV 366
           TYLNPL   D GD +ID  ILQNLVVLWHGR+ ++I  KL EPGAN EKT Y LL+RFK 
Sbjct: 317 TYLNPL---DHGDGSIDDGILQNLVVLWHGRDRNEIVAKLNEPGANLEKTFYVLLFRFKH 373

Query: 367 D-----------------------------SEQEALKNSQIKKRQSIISNNNLKSGNINT 397
           D                             S Q    + +    +   S  ++ S +++ 
Sbjct: 374 DVHQQQQQQQQQQQQQQQQQQQQQQQQQQQSRQSGYVSPKKLAMKKSASRKSITSTSLSG 433

Query: 398 TTPQKKKNRNSVISVSSSHKRPVSLNRLSTIQNGKDVISVPSSSNTTPGSS-KRISMSLS 456
           TT  KKKNR S+ISVSSSHKRPVS N+LST   GK       S+  TPGSS KR+S+SLS
Sbjct: 434 TTTPKKKNRVSMISVSSSHKRPVSFNKLSTA--GKS-----DSACGTPGSSTKRMSISLS 486

Query: 457 SNKGSKILPQSNSGSPTPAPRNKRMSVQNLETSSNPPPIPVDMLKDYGNSTSSHANAKRA 516
           S+K  ++     + SPTPA  NKRMSV+++++S+  PP+P+D+L DY ++  +    KRA
Sbjct: 487 SSK--RLSAMGPNTSPTPA--NKRMSVRDMDSSA--PPVPMDVLNDYTSALPNRKATKRA 540

Query: 517 SRISKRLSVLPNAKRGSITTKIISTYAKLSEDDDWEFIEKETKRVSSDFATLIDEIFEHE 576
           SR SKRLS LPN KRGSITTK+I+TYAKLSE+DDWE+IEKETKR S+DFATL D+IFEHE
Sbjct: 541 SRASKRLSFLPNIKRGSITTKLIATYAKLSEEDDWEYIEKETKRTSADFATLCDQIFEHE 600

Query: 577 KYEQI 581
           KYEQI
Sbjct: 601 KYEQI 605

 Score =  287 bits (735), Expect = 7e-80,   Method: Compositional matrix adjust.
 Identities = 203/502 (40%), Positives = 270/502 (53%), Gaps = 58/502 (11%)

Query: 669  EDASGQRSFSLQTRPVSKLDPGIKCGSNKPVQMEEIVEDELDKTIDSQKVILETIRRSKF 728
            +D   +R+ SLQTRPVS+LDPGI    N    + E  +   + T+ ++K ILETIRRS+F
Sbjct: 719  DDLLKRRTVSLQTRPVSRLDPGIVAAENLGSVIYEEADGVDETTLRTEKTILETIRRSRF 778

Query: 729  LGSSFNIDKELKQVKKDAEVKRMRKSQKEDRDVSGRIVSETNEQYETQVLPKNATAFGAL 788
            LGSSF+I KEL++ ++  E    R+ Q+     S    S TN+ YE++ LPKNA A   L
Sbjct: 779  LGSSFDIKKELERAQRKKEEALARQHQQRILS-SATAASATNDAYESRALPKNAAAVDTL 837

Query: 789  KDDSEEVEPRKISDIQVPQFTRKSKLFTDSNKRLSVLSIYSSTQSYTNLANVLKEGGVDI 848
             D+    EPRKIS+I+VPQFTR+S+ FT SNKRLSVLS+YS+  S+TNLA+ LK GG D+
Sbjct: 838  NDE-RNPEPRKISEIKVPQFTRRSRHFTASNKRLSVLSMYSTKSSFTNLADHLK-GGADL 895

Query: 849  XXXXXXXXXXX--XXXPEFQFETVGTXXXXXXXXXXXXX--------XXXXXLSQGANIK 898
                            PEF FE+V                             S  A ++
Sbjct: 896  QEVSGSAPSTTKITQEPEFLFESVHEEDSEETPDTTADSRLYEVPDGSESSKTSTKAAMR 955

Query: 899  LNYADRFDT-AG-NVNEVKLPTLPPL--GDDKVSDGLGIYXXXXXXXX------------ 942
            LN+ADRF+T AG N  +VKLP LPPL     K  +GLGIY                    
Sbjct: 956  LNFADRFNTRAGDNPADVKLPPLPPLEKNGSKKPNGLGIYQSPERPRADPNPTSMVHEPK 1015

Query: 943  -------XXXXPVPSIKENKSEE--TLKEKNVEPK-------------PPLNDVVPKTRD 980
                       P  S K  +SE   T   K  EPK             PPLN ++ K  D
Sbjct: 1016 VFSMIPDDIAGPAKSTKPAESENVPTSATKKSEPKNALHSADAPEASQPPLNGMMRKNND 1075

Query: 981  TKKTNVVQNNNAKHSSDKPRSTSFFRKISKGLTVQNDTTGYDVKLFSNVSVTQLYNGLFN 1040
             K    +       +++K R+ SFFRK S+  + +  +  +D KL ++V   Q++N L  
Sbjct: 1076 RKPLEDIT-----PAAEKKRNRSFFRKFSRS-SEEKKSDNFDAKLNTSVEAVQMFNALGK 1129

Query: 1041 LLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVFSE-GKHSVIGFRKKSG 1099
            LL GWKDYGLKE++      +I+ +LSSDNILSLRST  +++V  +  K SV+ F KKSG
Sbjct: 1130 LLGGWKDYGLKEVRVQGPTKTITGKLSSDNILSLRSTMFEILVRDDSSKGSVVWFVKKSG 1189

Query: 1100 SSKTLKRLTSEVEKVLRKEGVL 1121
            S+KT KRL  EVEKVL +E VL
Sbjct: 1190 STKTFKRLVKEVEKVLERENVL 1211

>AFR696C Chr6 complement(1722130..1725558) [3429 bp, 1142 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR507C
           (GIN4) and YCL024W (KCC4)
          Length = 1142

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/590 (66%), Positives = 454/590 (76%), Gaps = 47/590 (7%)

Query: 1   MISSNKGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXX 60
           M   N    S++GD IGPWKLGETLG GSTGKV LA N  T Q AA+KVI          
Sbjct: 1   MGDKNNNVTSLRGDRIGPWKLGETLGAGSTGKVLLAQNTETGQIAAVKVISKSVFNAQGS 60

Query: 61  XXXXXXXTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLL 120
                   PD L YGIEREIIIMKLLNHPNVLRLYDVWET  +LYMVLEY EKGELFNLL
Sbjct: 61  TFVGSND-PDVLPYGIEREIIIMKLLNHPNVLRLYDVWETAQDLYMVLEYVEKGELFNLL 119

Query: 121 VEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALET 180
           V++GPLPENEA+RFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIK+ADFGMAALE+
Sbjct: 120 VQRGPLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALES 179

Query: 181 EDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLL 240
           +DKLLETSCGSPHYAAPEIVSGLPYHG E+DVWSCGVIL+ALLTGRLPFDEEDGNIRNLL
Sbjct: 180 KDKLLETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEEDGNIRNLL 239

Query: 241 LKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIR 300
           LKVQ G++E+PG+DEIS EA+DL+ +IL V+PE+RIK+REILKHPLLQKYPSIKDSK+IR
Sbjct: 240 LKVQSGKYEIPGEDEISPEARDLIVQILTVEPEQRIKTREILKHPLLQKYPSIKDSKSIR 299

Query: 301 NLPREDTYLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYAL 360
           NLPREDTYLNPL  NDG   TID+ ILQNLVVLWHGR++++I  KL+EPGAN EKT YAL
Sbjct: 300 NLPREDTYLNPLDHNDG---TIDQAILQNLVVLWHGRDKNEITMKLKEPGANLEKTFYAL 356

Query: 361 LYRFKVDSEQEALKNSQIKKR---------QSIISNNNLKSGNINTTTPQKKKNRNSVIS 411
           L+RFK ++EQ+ LK  QI KR         Q+I+ +++ +S N   +TP+KK  R+S I+
Sbjct: 357 LHRFKFENEQQQLKQQQIAKRISSTSSSPQQNIVKSSSRRSINNILSTPKKK--RSSAIN 414

Query: 412 VSSSHKRPVSLNRLSTIQNGKDVISVPSSSNTTPGSSKRISMSLSSNKGSKILPQSNSGS 471
           VSS+HKRPVS+ +L+             + N T  S KR   SLS+ K S +L  SNS S
Sbjct: 415 VSSAHKRPVSIQKLNDC----------GTLNPTSPSKKR---SLSNRKLSAVLAGSNSSS 461

Query: 472 PTPAPRNKRMSVQNLETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKR 531
           P+     KRMSV       + PP+P  +L+DY          KRASR SKRLS LP +KR
Sbjct: 462 PS----RKRMSV-----GQDAPPVPTAVLRDYN---------KRASRASKRLSFLP-SKR 502

Query: 532 GSITTKIISTYAKLSEDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQI 581
           GSITTKII+TYAKLSED+DWE+I++E KR SSDFATLID IFEHEKYEQI
Sbjct: 503 GSITTKIIATYAKLSEDNDWEYIDREAKRTSSDFATLIDNIFEHEKYEQI 552

 Score =  246 bits (627), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 185/520 (35%), Positives = 272/520 (52%), Gaps = 62/520 (11%)

Query: 650  KNVRSISSPVENGNEAKSEEDAS-----------GQRSFSLQTRPVSKLDPGIKCGSNKP 698
            ++VRSIS P+E      S+ D+             +R+ SL+TRP+S+LDPGI+      
Sbjct: 635  QHVRSISEPMERKGTRPSKRDSFLALQNNINSLLKRRTLSLETRPISRLDPGIRLS---- 690

Query: 699  VQMEEIVEDELDKTIDSQKV---ILETIRRSKFLGSSFNIDKELKQVKKDA-EVKRMRKS 754
             +   I+ED+L+   D  +V   ILETIRRSKFLGS ++IDKEL++V+++  E   MRKS
Sbjct: 691  -EENTILEDDLECNEDRLRVEKNILETIRRSKFLGSQYDIDKELQRVRREKLEKVNMRKS 749

Query: 755  Q-----------KEDRDVS-GRIVSETNEQYETQVLPKNATAFGALKDDSEEVEPRKISD 802
            Q           +E R VS G  V+ ++E  E+ +LPKN TA G LKD  EE EPRK+S+
Sbjct: 750  QDRKLEPGLHSRQEQRFVSDGTTVTSSHEDSESIILPKNVTAIGVLKD--EESEPRKLSE 807

Query: 803  IQVPQFTRKSKLFTDSNKRLSVLSIYSSTQSYTNLANVL-KEGGVDIXXXXXXXXXXXXX 861
            +++PQFTR+SK F+ S+KRLSVLS+YS+  SYTNLA+ L  +  +               
Sbjct: 808  VKIPQFTRRSKHFSASSKRLSVLSMYSTKVSYTNLADYLNNDVQLKSLQPSAPTSIKIPQ 867

Query: 862  XPEFQFETVGTXXXXXXXXXXXXXXXXXXLS------QGANIKLNYADRFD------TAG 909
             PEF FE+ G                   +        G  ++L   D  +      +  
Sbjct: 868  EPEFMFESAGQENRYQAAAPTDTYLERPKVGVEGDHEPGEPVELIELDDSEDRSKQYSEE 927

Query: 910  NVNEVKLPTLPPLGDDKVSDGLGIYXXXXXXXXXXXXPVPSIKENKSEETLKEKNVEPKP 969
            ++ +VKLP LPPL      +GLGIY            PV         +++   +++ K 
Sbjct: 928  DIAKVKLPILPPLDHLNKPNGLGIYQAPAPPKEPLGQPV--------MKSMIPDDIKIKC 979

Query: 970  PLNDVVPKTRDTKK------TNVVQNNNAKHSSDKPRSTSFFRKISKGLTVQNDTTGYDV 1023
              N + P+ R T++      T  V        +  P +T       K  + +   +  DV
Sbjct: 980  VPNQLSPRRRATERAPEKKLTKTVPERVIAAETFPPPNTKKKPSFFKKFSREKMHSDCDV 1039

Query: 1024 KLFSNVSVTQLYNGLFNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVV 1083
            +L + V  ++++  L  LL GW  YGLKE++S   +++I+ +LSSDNILSLRST  ++V+
Sbjct: 1040 QLDTTVGDSKMFRALNKLLNGWTSYGLKEVRSMPASYTITGKLSSDNILSLRSTAFEIVI 1099

Query: 1084 FSEG-KHSVIGFRKKSGSSKTLKRLTSEVEKVLRKEGVLA 1122
             S     S + F KKSGS KT  RL +E+EK+L KE VL 
Sbjct: 1100 LSVADTGSSVKFTKKSGSKKTFTRLVNEIEKILEKESVLV 1139

>Ecym_1058 Chr1 (105835..109329) [3495 bp, 1164 aa] {ON} similar to
           Ashbya gossypii AFR696C
          Length = 1164

 Score =  732 bits (1890), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 379/586 (64%), Positives = 442/586 (75%), Gaps = 45/586 (7%)

Query: 5   NKGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXX 64
           N    S+KG  IGPW LGETLG+GSTGKV +A N  T Q AA+K+I              
Sbjct: 6   NSNVTSLKGGRIGPWMLGETLGVGSTGKVLMAQNVQTGQIAAVKIISKSIFNAQGSTFVG 65

Query: 65  XXXTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKG 124
               PD L YGIEREI IMKLLNHPNVLRLYDVWET+ +LYMVLEY EKGELFNLL+E+G
Sbjct: 66  SND-PDVLPYGIEREITIMKLLNHPNVLRLYDVWETSTDLYMVLEYVEKGELFNLLIERG 124

Query: 125 PLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKL 184
           PLPENEA+RFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIK+ADFGMAALE++DKL
Sbjct: 125 PLPENEAVRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKFNIKLADFGMAALESKDKL 184

Query: 185 LETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQ 244
           LETSCGSPHYAAPEIVSGLPYHG E+DVWSCGVIL+ALLTGRLPFDE+DGNIR LLLKVQ
Sbjct: 185 LETSCGSPHYAAPEIVSGLPYHGFESDVWSCGVILYALLTGRLPFDEDDGNIRKLLLKVQ 244

Query: 245 KGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPR 304
            GEFEMP  DEIS EAQDL+ KIL VDP  RIK+REILKHPLL+KYPSIKDSK+IRNLPR
Sbjct: 245 SGEFEMPDKDEISIEAQDLIAKILTVDPSGRIKTREILKHPLLKKYPSIKDSKSIRNLPR 304

Query: 305 EDTYLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRF 364
           EDTYLNPL  NDG   T+D+TIL+NLVVLWHGR+E++I  KL E G N EKT YALL+RF
Sbjct: 305 EDTYLNPLDHNDG---TVDRTILKNLVVLWHGRDENEIVMKLNEQGPNLEKTFYALLHRF 361

Query: 365 KVDSEQEALKNSQIKKR---------QSIISNNNLKSGNINTTTPQKKKNRNSVISVSSS 415
           K ++EQ+ LK  QI KR         ++I+ +++ +S N    TP+KK  R+S I+VSS+
Sbjct: 362 KYENEQQQLKQQQIAKRISSASSSPQRNIVKSSSRRSINQILVTPKKK--RSSGINVSSA 419

Query: 416 HKRPVSLNRLSTIQNGKDVISVPSSSNTTPGSSKRISMSLSSNKGSKILPQSNSGSPTPA 475
           HKRPVS+ +   I  G + +  P        S KR   SLS+ K S IL      +P+ +
Sbjct: 420 HKRPVSIQKWGEIGGGNNGLISP--------SKKR---SLSNRKLSAIL-----NTPSSS 463

Query: 476 PRNKRMSVQNLETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSIT 535
           P  KRMS+     + + PP+P  +L+DY          KRASR SKR S LP+ KR SIT
Sbjct: 464 PSRKRMSI-----AQDAPPMPTSVLRDYN---------KRASRNSKRFSFLPSIKRQSIT 509

Query: 536 TKIISTYAKLSEDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQI 581
           +KII+TYAKLSED+DWE+I+KE KR SSDFATLID IFEHEKYEQI
Sbjct: 510 SKIIATYAKLSEDNDWEYIDKEAKRTSSDFATLIDNIFEHEKYEQI 555

 Score =  227 bits (579), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 177/483 (36%), Positives = 249/483 (51%), Gaps = 54/483 (11%)

Query: 674  QRSFSLQTRPVSKLDPGIKCGSNKPVQMEEIVEDE---LDKTIDSQKVILETIRRSKFLG 730
            +R+ S+QTRP+S+LDPGI     + V  E   +DE    ++T+  +K ILETIRRS FLG
Sbjct: 697  KRAVSVQTRPISRLDPGIMA---QEVAHELDYDDEEILSERTLRREKTILETIRRSNFLG 753

Query: 731  SSFNIDKELKQVKKDAEVKRM-----------RKSQKEDRDVS-GRIVSETNEQYETQVL 778
            S F+I KELK  KK+   K             R S  + R VS G  ++  ++ Y+T  L
Sbjct: 754  SQFDIHKELKNAKKEKIEKAKKRKQLNRKLPDRISYHDQRFVSDGTTITSAHDGYDTTSL 813

Query: 779  PKNATAFGALKDDSEEVEPRKISDIQVPQFTRKSKLFTDSNKRLSVLSIYSSTQSYTNLA 838
             ++ T  G L+DD  E EP+K+S++++P+ TR+S+  + S+KR SVLS+YS+  SYTNLA
Sbjct: 814  TRHTTV-GVLRDD--ESEPKKLSEVRIPEVTRRSRHLSASSKRFSVLSMYSTMTSYTNLA 870

Query: 839  NVLKEGGVDIXXXXXXXXXXXXXXPEFQFETVGTXXXXXXXXXXXXXXXXXXLSQGANIK 898
            + +K   V +              PEF FE+                           IK
Sbjct: 871  DFMK-SDVQLKPLNDTASSKVTQQPEFMFEST-IDNVERISSNDNSHISSMEAPNNTVIK 928

Query: 899  LNYADRF-----------------DTAGNVNEVKLPTLPPLGD-DKVSDGLGIYXXXXXX 940
            LNYADRF                 DT  ++ +VKLP LPPL   +K  +GLGIY      
Sbjct: 929  LNYADRFYKPVEVIELDDTDNTQPDTEEDITKVKLPALPPLEKLNKSPNGLGIYQHSSPR 988

Query: 941  XXXXXXPVPSIKENKSEETLKEKNVEPKPPLNDVVPKTRDTKKTNVVQ--NNNAKHSSDK 998
                   V S+  N+++E     N +P        P T   K+  + +   + A+    K
Sbjct: 989  EDFKHA-VRSVTPNENKE-----NEDPAGTTQQKAPLTSVGKELGIREPLTDLAQQGVPK 1042

Query: 999  PRSTSFFRKISKGLTVQNDTTGYDVKLFSNVSVTQLYNGLFNLLKGWKDYGLKEIKSNKE 1058
             R  SFFRK SK    +     YD +L + V+ T+++  L  LL GW  YGLK+++S+  
Sbjct: 1043 KRP-SFFRKFSK----EKIKPEYDYQLDTTVNNTKMFRALDKLLNGWTSYGLKQVRSSPS 1097

Query: 1059 AFSISVRLSSDNILSLRSTFVDMVVFSEGKHSVIGFRKKSGSSKTLKRLTSEVEKVLRKE 1118
               I+ +LSSDNILSLRST   +VV      S + F KKSGS KT  RL +E+EK+L KE
Sbjct: 1098 VSMITGKLSSDNILSLRSTAFQVVVAGSNHGSSVRFTKKSGSKKTFARLVNEIEKILEKE 1157

Query: 1119 GVL 1121
             VL
Sbjct: 1158 KVL 1160

>TBLA0A07150 Chr1 (1776160..1780335) [4176 bp, 1391 aa] {ON}
           Anc_1.52 YDR507C
          Length = 1391

 Score =  731 bits (1888), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 367/532 (68%), Positives = 419/532 (78%), Gaps = 37/532 (6%)

Query: 4   SNKGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXX-XXXXXXXX 62
           +NK ++ VKG+T+GPWKLGETLGLGSTGKVQLAYN ST QQAAIKVI             
Sbjct: 5   TNKPSLEVKGNTVGPWKLGETLGLGSTGKVQLAYNSSTGQQAAIKVISKAVFNNDNANAS 64

Query: 63  XXXXXTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVE 122
                TPDSL YGIEREIIIMKLLNHPNVLRLYDVWET++NLYMVLEYAEKGELFNLLVE
Sbjct: 65  DSALLTPDSLPYGIEREIIIMKLLNHPNVLRLYDVWETDSNLYMVLEYAEKGELFNLLVE 124

Query: 123 KGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETED 182
           +GPLPENEAIRFFRQIIIG+SYCHALGIVHRDLKPEN+LLDHK NIKIADFGMAALETED
Sbjct: 125 RGPLPENEAIRFFRQIIIGISYCHALGIVHRDLKPENLLLDHKYNIKIADFGMAALETED 184

Query: 183 KLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK 242
           KLLETSCGSPHYAAPEI+SGLPYHGLETDVWSCG+ILFALLTGRLPFDEEDGNIRNLLLK
Sbjct: 185 KLLETSCGSPHYAAPEIISGLPYHGLETDVWSCGIILFALLTGRLPFDEEDGNIRNLLLK 244

Query: 243 VQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNL 302
           VQ G+FEMPG+DEIS+EAQDL+ KIL VDP+KRIK+REILKHPL+QKYPSIKDSKTIRNL
Sbjct: 245 VQSGQFEMPGNDEISREAQDLISKILTVDPKKRIKTREILKHPLVQKYPSIKDSKTIRNL 304

Query: 303 PREDTYLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLY 362
           PREDTYLNPL  ++G    ID  ILQNLVVLWHGR+  +I KKL+EPGANAEKTLYALL 
Sbjct: 305 PREDTYLNPLSDDNGDVCEIDPKILQNLVVLWHGRDSKEITKKLKEPGANAEKTLYALLD 364

Query: 363 RFKVDSEQEALKNSQIKKRQSIISNNNLKSGNINTT------------TPQKKKNRNSVI 410
           RFK D+E+E  + SQ+KKRQS +   +  S N NT+            TP K+KNR S++
Sbjct: 365 RFKNDTEKEIKRQSQLKKRQSQVQQTHSHS-NSNTSAYSHVSRGALVNTPTKRKNRASMV 423

Query: 411 SVSSSHKRPVSLNRLSTIQNGKDVISVPSSSNTTP---------------GSSKRISMSL 455
           SVSS+HKRPVS NRLS       VI+  +  N TP                SSKR+S++L
Sbjct: 424 SVSSAHKRPVSFNRLSRADLSNHVIN--TGINGTPQRHSQIESSGTLQRNSSSKRMSINL 481

Query: 456 SSNKG-SKILPQSNSGSPTPAPRNKRMSVQNLETSSNPPPIPVDMLKDYGNS 506
           SSNK  S++L    + SPTP+   KRMS+ N       PP+P+D++K+Y ++
Sbjct: 482 SSNKRISQLLANDLNTSPTPSNCTKRMSIIN-----GTPPVPMDIMKNYNDA 528

 Score =  184 bits (466), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 139/370 (37%), Positives = 197/370 (53%), Gaps = 74/370 (20%)

Query: 634  ELQQDTKNFQEDEVVHKNVRSISSPVENGNEAK-SEEDASGQRSFSLQTRPVSKLDPGIK 692
            +++ +T + + D +V    RS+S+P+E   +++ S  D S QR+FSL+TRPVS+LDPG+ 
Sbjct: 743  KIKTETDDEERDIIVDIQPRSVSAPLEKTEKSRDSPFDYSKQRNFSLRTRPVSRLDPGLM 802

Query: 693  CGS-------NKPVQMEEIVEDELDKTIDSQKVILETIRRSKFLGSSFNIDKELKQVKKD 745
              S       N     E++        ID+QKVILETIRRSKFLGSSF++ KEL+ V+ +
Sbjct: 803  YSSGTGSSAYNPSHSTEDLHSTSSLNRIDTQKVILETIRRSKFLGSSFDLKKELEMVE-E 861

Query: 746  AEVKRMRKSQKED------RDVS------------GRIVSETNEQYETQVLPKN---ATA 784
             E  R+++   +D       DV+             RIVS TN++YET++LPK+    T 
Sbjct: 862  LESNRIKQQAFQDSHLEEMNDVTEDLSQHNVDTSNDRIVSTTNDRYETEILPKSHAGKTQ 921

Query: 785  FGALKDDSEEVEPRKISDIQVPQFTRKSKLFTDSNKRLSVLSIYSSTQSYTNLANVLKEG 844
               L D S  V+PR +S+I+VPQFTRKSK F++SNKRLSVLS+YSS +S+TNL ++LKE 
Sbjct: 922  TIGLNDSS--VQPRTLSEIKVPQFTRKSKFFSESNKRLSVLSLYSSRESFTNLVDMLKED 979

Query: 845  GVDIXXXXXXXXXXXXXXPEFQFETVGTXXXXXXXXXXXXXXXXXXLS---QGANIKLNY 901
            G+++              PEF FE+                      S   Q  N++L++
Sbjct: 980  GINV-EPTERSPTTKSQEPEFLFESPSVDTYSRDSSTEDKPINEKENSEPIQSNNLRLSF 1038

Query: 902  ADRF-------DT-------AGNV-----------------------NEVKLPTLPPLGD 924
             DRF       DT       +G++                       N VKLP LPPL  
Sbjct: 1039 HDRFNRQLSTEDTEKTKNSPSGHIKDEPKKDDDNGVDLSTPKAKDESNLVKLPALPPLTT 1098

Query: 925  DKVSDGLGIY 934
             K +DGLGIY
Sbjct: 1099 KK-TDGLGIY 1107

 Score =  123 bits (308), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 67/105 (63%), Positives = 78/105 (74%), Gaps = 4/105 (3%)

Query: 478 NKRMSVQNLETSSNPPPIPVDMLKDYGNSTSSHA-NAKRASRISKRLSVLPNAKRGSITT 536
           NKR SV N + ++   P     +   G ++ S A N  RASR  KR SV PN +RGSITT
Sbjct: 571 NKRNSVINTKYTN---PANSTQISTNGQTSDSAAQNVNRASRSQKRKSVRPNMQRGSITT 627

Query: 537 KIISTYAKLSEDDDWEFIEKETKRVSSDFATLIDEIFEHEKYEQI 581
           K+ISTYA+L+EDDDWEFIEKETKRVSS+FATLID IFEHEKYEQI
Sbjct: 628 KLISTYAQLAEDDDWEFIEKETKRVSSNFATLIDNIFEHEKYEQI 672

 Score =  104 bits (259), Expect = 1e-21,   Method: Compositional matrix adjust.
 Identities = 74/208 (35%), Positives = 104/208 (50%), Gaps = 46/208 (22%)

Query: 955  KSEETLKEKNVEPKPP----LNDVVPKTRDTKKTNVVQNNNAKHSSDKPRSTSFFRKISK 1010
            K E + K    E  PP    LNDV+ K   +K     ++N       K    SFFRK SK
Sbjct: 1191 KPERSNKADQSERAPPAETTLNDVMTKRNQSKS----RDNPQPSEEGKKGVNSFFRKFSK 1246

Query: 1011 G----------------------------------LTVQNDTTGYDVKLFSNVSVTQLYN 1036
            G                                  ++  ND   YD +L +NV+  Q++ 
Sbjct: 1247 GSSRQSSNSSNKNKSLADDKNIPSVPKPVAHPASPVSTSND---YDFQLKANVAAPQMFK 1303

Query: 1037 GLFNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVFSEG-KHSVIGFR 1095
            GL  L +GW  YGLK IKS+ E+   + ++SS+NILS +ST  ++ + S   K  ++ F+
Sbjct: 1304 GLDTLFRGWSKYGLKNIKSSPESLRFTGKVSSENILSFKSTVFELEIISNSVKTCLLRFK 1363

Query: 1096 KKSGSSKTLKRLTSEVEKVLRKEGVLAK 1123
            K SGSSK+++RL +EVE VLRKEGVL K
Sbjct: 1364 KTSGSSKSVRRLVNEVENVLRKEGVLLK 1391

>Suva_3.190 Chr3 (288639..288813,288870..291766) [3072 bp, 1024 aa]
           {ON} YDR507C (REAL)
          Length = 1024

 Score =  675 bits (1741), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 405/837 (48%), Positives = 520/837 (62%), Gaps = 116/837 (13%)

Query: 14  DTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLS 73
           +TIGPW+LGETLG GSTG+VQLA +E T  + A+KVI                  P    
Sbjct: 8   NTIGPWRLGETLGSGSTGRVQLAQHERTGHKTAVKVISKTIFDTEDGGGXXXLALP---- 63

Query: 74  YGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIR 133
           Y IEREI++MKLL+HPNVL LYDVWETNNNLY++LEYAEKGELFNLLV++GPLPE EA++
Sbjct: 64  YNIEREIVVMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDRGPLPEKEAVK 123

Query: 134 FFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPH 193
            FRQIII +SYCHALGIVHRDLKPEN+LLD+  NIKIADFGMAAL+T+ +LLETSCGSPH
Sbjct: 124 CFRQIIIAISYCHALGIVHRDLKPENLLLDNDYNIKIADFGMAALQTDARLLETSCGSPH 183

Query: 194 YAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGD 253
           YAAPEIVSGLPY G  +DVWSCGVILFALLTGRLPFDE++GN+R+LLLKVQ+G+FEMP  
Sbjct: 184 YAAPEIVSGLPYRGFASDVWSCGVILFALLTGRLPFDEDNGNVRDLLLKVQRGQFEMPDA 243

Query: 254 DEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDTYLNPLI 313
            EISK+AQ+L+ +ILVVDP +R+K+R+IL HPLL+KY +I+DSK+IRNLPRE+TYL PL 
Sbjct: 244 TEISKDAQNLISRILVVDPTQRMKTRDILTHPLLKKYQTIRDSKSIRNLPRENTYLYPLA 303

Query: 314 GNDGG---DATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKVDSEQ 370
             D G   +ATID +ILQNLVVLWHGR  D+I   L++ G N EKTLYALLYRFK    Q
Sbjct: 304 --DAGNHTNATIDGSILQNLVVLWHGRPADEIVANLKDNGTNTEKTLYALLYRFK----Q 357

Query: 371 EALKNSQIKKRQSIISNNNLKSGNINTTTPQKKKNRNSVISVSSSHKRPVSLNRLSTIQN 430
           EA K S+ K +++  +  N    +++  +     NR S  +      +  S+N  S+ + 
Sbjct: 358 EANKRSRHKIKKT--TKKNPPYPSMSILSSSSSHNRLSGSTPRRRTPKRRSMNFSSSKKR 415

Query: 431 GKDVISVPSSSNTTPGSSKRISMSLSSNKGSKILPQSNSGSPTPAPRNKRMSVQNLETSS 490
              +                    L+SN        S++GSP P+  +KR S  N   S+
Sbjct: 416 SSFI--------------------LASN--------SSNGSPMPSRNSKRSSFFN-TASA 446

Query: 491 NPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSITTKIISTYAKLSEDDD 550
           N PP+PV +L  Y        N+KR+   SKRLS +PN KRGS+T+K +S Y  L ++DD
Sbjct: 447 NVPPVPVKLLNSY------KRNSKRS---SKRLSYVPNVKRGSLTSKSLSKYTNLIDEDD 497

Query: 551 WEFIEKETKRVSSDFATLIDEIFEHEKYEQIXXXXXXXXXXXXXXXXXXXXXXXXXXXXX 610
           WE+IEK+TKR SS+FATLIDEIFE EK+E                               
Sbjct: 498 WEYIEKDTKRTSSNFATLIDEIFEPEKFE--------------------------LARRE 531

Query: 611 XXXXXXXXXXXXXXXXXXTQITKELQQDTKNFQEDEVVHKNVRSISSPVENGNEAKSE-- 668
                              ++ +E   +T      E + K    +SSP+ N   ++ E  
Sbjct: 532 KAELQRKVQEAKRGKSDVAKLNQENGNETGKSDAMEELKKINNKVSSPLINYEYSQQELL 591

Query: 669 EDA----SGQRSFSLQTRPVSKLDPGIKCGSNKPVQMEEIVEDELDKTIDSQKVILETIR 724
           +D     + +   S  TRP+SKLDPG+      P  +   ++++ D  +D++  ILETIR
Sbjct: 592 QDINTLLTNRCQLSAYTRPISKLDPGLMP---TPETIPYDIKEKTDLLLDTEMKILETIR 648

Query: 725 RSKFLGSSFNIDKELKQVKKDAEVKRMRKSQKEDRDVSGRIVSETNEQYETQVLPKNATA 784
           +SK L SS N+ KE   V +DA           DR  S   V E+         P  +T 
Sbjct: 649 KSKILDSSLNLRKE---VSRDA-----------DRLPS---VEES---------PIASTT 682

Query: 785 FGALKDDSEEVEPRKISDIQVPQFTRKSKLFTDSNKRLSVLSIYSSTQSYTNLANVL 841
                +DS+EV   KISDIQVP FTRKSK FT +N R SVLS+YSS  S+  L+ +L
Sbjct: 683 PLVYNNDSKEV--CKISDIQVPHFTRKSKCFTPTNNRRSVLSLYSSRHSFKGLSRIL 737

 Score = 98.2 bits (243), Expect = 7e-20,   Method: Compositional matrix adjust.
 Identities = 69/218 (31%), Positives = 114/218 (52%), Gaps = 30/218 (13%)

Query: 914  VKLPTLPPLGDDKVSDGLGIYXXXXX---XXXXXXXPVPSIK------ENKSEETLKEKN 964
            VKLP+L     +K + GLGIY               P+P++       +   E  ++ +N
Sbjct: 825  VKLPSLSSF-QEKNASGLGIYQREPSIEPSIESSIEPLPNVTIAIEDVDEDGENEIQHEN 883

Query: 965  VEPKPPLNDVVPKTRDTKKTNVVQNNNAKHSSDKPRSTSFFRKISKGLTVQNDTTGYDVK 1024
            +            T      N+ +N++ K +  +  + SF +K SKG  ++       ++
Sbjct: 884  I------------TTSLSNDNIKKNDDTKDTIREYSNVSFLKKFSKGKILE-------LE 924

Query: 1025 LFSNVSVTQLYNGLFNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVF 1084
            + + +   +L+ GL  LL+GWK YGLK +  +     I+ +L +DNILSLRST  +++V 
Sbjct: 925  IHAKIPAERLFEGLHKLLEGWKQYGLKNLGFDTANMIITGKLVNDNILSLRSTLFEIIVL 984

Query: 1085 -SEGKHSVIGFRKKSGSSKTLKRLTSEVEKVLRKEGVL 1121
             +    S+I F KK+GS+KTLK+L  E++ VL+KEGVL
Sbjct: 985  PNRDDRSLIKFNKKTGSTKTLKKLGYEIQIVLQKEGVL 1022

>Skud_3.39 Chr3 (66201..69254) [3054 bp, 1017 aa] {ON} YCL024W
           (REAL)
          Length = 1017

 Score =  615 bits (1586), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 325/572 (56%), Positives = 397/572 (69%), Gaps = 67/572 (11%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           TIGPWKLGETLG+GS GKV+LA +E T  + A+K+I                  P    Y
Sbjct: 17  TIGPWKLGETLGVGSAGKVRLAQHEGTAHKTAVKIISKSIFNTEGNYGNHGSVLP----Y 72

Query: 75  GIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRF 134
            IEREI+IMKLL+HPNVL LYDVWETNNNLY++LEYAEKGELFNLLV++G LPE EA++ 
Sbjct: 73  NIEREIVIMKLLSHPNVLGLYDVWETNNNLYLILEYAEKGELFNLLVDRGALPEREAMKC 132

Query: 135 FRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHY 194
           FRQIII +SYCHALGIVHRDLKPEN+LLD   NIK+ADFGMAAL+T+  LLETSCGSPHY
Sbjct: 133 FRQIIIAVSYCHALGIVHRDLKPENLLLDSDYNIKVADFGMAALQTDAALLETSCGSPHY 192

Query: 195 AAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDD 254
           AAPEIVSGLPY G  +DVWSCGVILFALLTGRLPFDEE+GNIR LLLKVQ+G+FEMP D 
Sbjct: 193 AAPEIVSGLPYEGFSSDVWSCGVILFALLTGRLPFDEENGNIRTLLLKVQRGQFEMPDDT 252

Query: 255 EISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDTYLNPLIG 314
           EISK+AQDL+ KILVVDP +RIK R+IL HPLL++Y +IKDSK+I++LPREDTYL PL  
Sbjct: 253 EISKDAQDLISKILVVDPAQRIKIRDILSHPLLKRYQTIKDSKSIKDLPREDTYLYPLA- 311

Query: 315 NDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKVDSEQEALK 374
            D G A ID +ILQNLVVLWHGR+ D+I  KL+  G N EKTLYALLYRFK++S +E+ K
Sbjct: 312 -DAG-AAIDDSILQNLVVLWHGRHADEIKAKLKASGTNTEKTLYALLYRFKLESMRESNK 369

Query: 375 NSQIKKRQSIISNNNLKSGNINTTTPQKKKNRNSVISVSSSHKRPVSLNRLSTIQNGKDV 434
               ++R                   + KK +N   S SSS            +  G+++
Sbjct: 370 ----RRRH------------------KTKKTKNRKFSTSSS------------LVKGRNL 395

Query: 435 ISVP------SSSNTTPGSSKRISMSLSSNKGSKILPQSNSGSPTPAPRNKRMSVQNLET 488
            S P      + SN      KR S  LS        P S + SP P   +K +S++N  T
Sbjct: 396 ESTPRKRTSKTHSNNFSSGKKRSSFILS--------PNSINSSPIPLRNSKGISLRN-AT 446

Query: 489 SSNPPPIPVDMLKDYGNSTSSHANAKRASRIS-KRLSVLPNAKRGSITTKIISTYAKLSE 547
           S   P +PV +L  +          KR S++S KR S +PN K GS+T++++S Y KL +
Sbjct: 447 SGGSPVVPVILLNSF----------KRNSKLSSKRSSYMPNLKSGSVTSRLLSNYNKLID 496

Query: 548 DDDWEFIEKETKRVSSDFATLIDEIFEHEKYE 579
           +DDWE IEK+TKR SS+FATLIDEIFE E++E
Sbjct: 497 EDDWECIEKDTKRTSSNFATLIDEIFEPEEFE 528

 Score = 92.0 bits (227), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 71/215 (33%), Positives = 113/215 (52%), Gaps = 20/215 (9%)

Query: 914  VKLPTLPPLGDDKVSDGLGIYXXXXXXXXXXXXPVPSIKENKSEETLKEKNVEPKPPLND 973
            V+LP+L      K + GLGIY            P  +I  + + E  +E  V+ +   + 
Sbjct: 818  VELPSLSSF-QGKNASGLGIYQREPSKVSL---PTATIDTSDAVEN-RETEVKKELKHDS 872

Query: 974  VVPKTRDTKKTNVVQNNNAKHSS----DKPRSTSFFRKISKGLTVQNDTTGYDVKLFSNV 1029
            +     D    NV +NNNA   +     K  + S  + ISKG  ++       +++ + +
Sbjct: 873  IATNLPDD---NVKENNNATAEAPSRIKKSSNVSILKNISKGKILE-------LEIHAKI 922

Query: 1030 SVTQLYNGLFNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVFSEG-K 1088
               +L+ GL  LL+GWK YGLK++  +     I  +L +D+ILSLRST  +++V   G  
Sbjct: 923  PNKRLFEGLHKLLEGWKQYGLKKLGFDAAKMIIKGKLVNDSILSLRSTLFEIIVLPNGDD 982

Query: 1089 HSVIGFRKKSGSSKTLKRLTSEVEKVLRKEGVLAK 1123
             S+I F KK+GSSK L +L +E++ +L+KEGVL K
Sbjct: 983  RSLIKFNKKTGSSKVLTKLATEIQIILQKEGVLDK 1017

 Score = 80.9 bits (198), Expect = 1e-14,   Method: Compositional matrix adjust.
 Identities = 62/167 (37%), Positives = 87/167 (52%), Gaps = 34/167 (20%)

Query: 677 FSLQTRPVSKLDPGIK-CGSNKPVQMEEIVEDELDKTIDSQKVILETIRRSKFLGSSFNI 735
            S  TRP+SKLDPG+       P  ++E    +     D++  I+ETI RSKFLGS  N+
Sbjct: 598 LSAYTRPISKLDPGLMPAAGTTPHDIKE----QTALIRDTEVKIIETIHRSKFLGSLLNV 653

Query: 736 DKELKQVKKDAEVKRMRKSQKEDRDVSGRIVSETNEQYETQVLPKNATAFGALKDDSEEV 795
            + +   K D E+  + +S          I+S T   Y                DD  EV
Sbjct: 654 REGMS--KDDDELAPIEESS---------IISTTPLIY----------------DDRTEV 686

Query: 796 EPRKISDIQVPQFTRKSKLFTDSNKRLSVLSIYSSTQSYTNLANVLK 842
             RKISD++VP FTRKS+ FT ++ R SVLS+YSS  S+ +L+ + K
Sbjct: 687 --RKISDVEVPHFTRKSRHFTAASNRRSVLSLYSSRDSFKDLSQISK 731

>Smik_3.54 Chr3 (80309..83407) [3099 bp, 1032 aa] {ON} YCL024W
           (REAL)
          Length = 1032

 Score =  603 bits (1556), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 327/565 (57%), Positives = 397/565 (70%), Gaps = 47/565 (8%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           IGPWKLGETLG GSTGKVQLA +E T Q+ A+KVI                  P    + 
Sbjct: 18  IGPWKLGETLGFGSTGKVQLARHERTGQKTAVKVIPKSIFKSEGSHGNNDSVLP----FN 73

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           IEREI+IMKLL+HPNVL LYDVWET+NNLY++LEYAEKGELFNLLV++GPLPE EAI+ F
Sbjct: 74  IEREIVIMKLLSHPNVLSLYDVWETDNNLYLILEYAEKGELFNLLVDRGPLPEREAIKCF 133

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
           +QIII +SYCHALGIVHRDLKPEN+LLD+  NIKIADFGMAAL+T+  +LETSCGSPHYA
Sbjct: 134 KQIIIAISYCHALGIVHRDLKPENLLLDNSYNIKIADFGMAALQTDAGMLETSCGSPHYA 193

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           APEIVSGLPY G  +DVWSCGVILFALLTGRLPFDEE+GN+R+LLLKVQKG+FEMP + E
Sbjct: 194 APEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNNAE 253

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDTYLNPLIGN 315
           IS +AQDL+ +ILVVDP +RIK R+IL HPLL+KY +IKDSK+I++LPRE+TYL PL   
Sbjct: 254 ISGDAQDLIRRILVVDPTQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLADA 313

Query: 316 DGGDA-TIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKVDSEQEALK 374
           D   + TID +ILQNLV+LWHGR  ++I KKL++ G N EKTLYALLYRFK++S +E  K
Sbjct: 314 DNHTSVTIDDSILQNLVILWHGRPAEEIMKKLQDNGTNTEKTLYALLYRFKLESMKETNK 373

Query: 375 NSQIKKRQSIISNNNLKSGNINTTTPQKKKNRNSVISVSSSHKRPVSLNRLSTIQNGKDV 434
            S+ K               IN T   KK  R S +S SSS     + N  S     +  
Sbjct: 374 RSRSK---------------INKT---KKSKRVSTLSSSSS----SAFNHQSLDSAPRKH 411

Query: 435 ISVPSSSNTTPGSSKRISMSLSSNKGSKILPQSNSGSPTPAPRNKRMSVQNLETSSNPPP 494
            S   S N  P S KR S  LSSN        S   SP P        +++ +  S    
Sbjct: 412 ASRGHSKN-FPSSRKRSSFILSSN--------STDCSPIP--------LRSSKRISISSA 454

Query: 495 IPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSITTKIISTYAKLSEDDDWEFI 554
           +P + L+   +S     N+KR+   SKRLS +PN  RGS+TT ++S Y  L +DDDWE+I
Sbjct: 455 VPGNTLQVPDSSLKLKRNSKRS---SKRLSYMPNLGRGSLTTNLLSNYTNLIDDDDWEYI 511

Query: 555 EKETKRVSSDFATLIDEIFEHEKYE 579
           +K+TKR SS+FATLIDEIFE EK+E
Sbjct: 512 DKDTKRTSSNFATLIDEIFEPEKFE 536

 Score =  100 bits (248), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 73/211 (34%), Positives = 113/211 (53%), Gaps = 17/211 (8%)

Query: 914  VKLPTLPPLGDDKVSDGLGIYXXXXXXXXXXXXPVPSIKENKSEETLKEKNVEPKPPLND 973
            VKLP+L      K + GLGIY             +PS+  N SE    +K  E     N+
Sbjct: 834  VKLPSLSSF-QRKNASGLGIYQRESSRES-----LPSVTINISES---DKTTE-----NE 879

Query: 974  VVPKTRDTKKTNVVQNNNAKHSSDKPRSTSFFRKISKGLTVQNDTTG--YDVKLFSNVSV 1031
               + +  K   ++ N++ K  S K   ++  R+ S G  ++  + G   ++ + + +S 
Sbjct: 880  AQKEIKHDKSDTILSNHDGKADSYKGDISNIVRESSHGSFLKKLSKGKILELDVRAKISE 939

Query: 1032 TQLYNGLFNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMVVFSEGK-HS 1090
             +LY GL  LL+GWK YGLK +  N     IS +L +D ILSLRST  ++V+   G   S
Sbjct: 940  KRLYEGLHKLLEGWKQYGLKNLGINTADMIISGKLVNDGILSLRSTLFEIVILPNGSGRS 999

Query: 1091 VIGFRKKSGSSKTLKRLTSEVEKVLRKEGVL 1121
            +I F KK+GS+KTL +  +E++ +L+KEGVL
Sbjct: 1000 LIKFNKKTGSTKTLTKFATEIQIILQKEGVL 1030

 Score = 78.6 bits (192), Expect = 6e-14,   Method: Compositional matrix adjust.
 Identities = 58/168 (34%), Positives = 86/168 (51%), Gaps = 36/168 (21%)

Query: 677 FSLQTRPVSKLDPGIKCGSNKPV--QMEEIVEDELDKTIDSQKVILETIRRSKFLGSSFN 734
            S  TRP+S+LDPG+      PV   +   ++++     D++  I+ETIR+S+FLGS  N
Sbjct: 614 LSSYTRPISRLDPGLT-----PVTGAIPHSIKEKTALLQDTEMKIIETIRKSEFLGSLLN 668

Query: 735 IDKELKQVKKDAEVKRMRKSQKEDRDVSGRIVSETNEQYETQVLPKNATAFGALKDDSEE 794
           + + + Q                          + N+    +V PK +T      D   +
Sbjct: 669 VREGISQ--------------------------DNNQLASIEVSPKISTTPLMYND---Q 699

Query: 795 VEPRKISDIQVPQFTRKSKLFTDSNKRLSVLSIYSSTQSYTNLANVLK 842
           VE RKISD++VP FTRKSK FT +N R SVLS+YS  +S  +L  + K
Sbjct: 700 VEIRKISDVEVPHFTRKSKHFTTANNRRSVLSLYSLKESLEDLNQISK 747

>YCL024W Chr3 (79162..82275) [3114 bp, 1037 aa] {ON}  KCC4Protein
           kinase of the bud neck involved in the septin
           checkpoint, associates with septin proteins, negatively
           regulates Swe1p by phosphorylation, shows structural
           homology to bud neck kinases Gin4p and Hsl1p
          Length = 1037

 Score =  579 bits (1493), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 320/577 (55%), Positives = 392/577 (67%), Gaps = 67/577 (11%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           TIGPWKLGETLG GSTGKVQLA +E T  + A+KVI                  P    Y
Sbjct: 17  TIGPWKLGETLGFGSTGKVQLAQHERTGHRTAVKVISKSIFNNNGNHSNDDSVLP----Y 72

Query: 75  GIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRF 134
            IEREI+IMKLL+HPNVL LYDVWETNNNLY++LEYAEKGELFNLLV+ GPLPE EAI  
Sbjct: 73  NIEREIVIMKLLSHPNVLSLYDVWETNNNLYLILEYAEKGELFNLLVDHGPLPEREAINC 132

Query: 135 FRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHY 194
           FRQIIIG+SYCHALGIVHRDLKPEN+LLD   NIKIADFGMAAL+T+  LLETSCGSPHY
Sbjct: 133 FRQIIIGISYCHALGIVHRDLKPENLLLDSFYNIKIADFGMAALQTDADLLETSCGSPHY 192

Query: 195 AAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDD 254
           AAPEIVSGLPY G  +DVWSCGVILFALLTGRLPFDEE+GN+R+LLLKVQKG+FEMP D 
Sbjct: 193 AAPEIVSGLPYEGFASDVWSCGVILFALLTGRLPFDEENGNVRDLLLKVQKGQFEMPNDT 252

Query: 255 EISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDTYLNPLI- 313
           EIS++AQDL+ KILVVDP +RIK R+IL HPLL+KY +IKDSK+I++LPRE+TYL PL  
Sbjct: 253 EISRDAQDLIGKILVVDPRQRIKIRDILSHPLLKKYQTIKDSKSIKDLPRENTYLYPLAD 312

Query: 314 GNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKVDSEQEAL 373
            N+   A+ID +ILQNLVVLWHGR+ DDI  KL+E G N EK LYALLYRFK+DS + + 
Sbjct: 313 SNNHTSASIDDSILQNLVVLWHGRHADDIVSKLKENGTNKEKILYALLYRFKLDSVRGSN 372

Query: 374 KNSQIKKRQSIISNNNLKSGNINT---------TTPQKKKNRNSVISVSSSHKRPVSLNR 424
           K ++ K +++  +  +    + ++         +TP+++ ++      SSS KR   L  
Sbjct: 373 KKNRNKIKKTKKNKRSSTLSSSSSLLLNNRSIQSTPRRRTSKRHSREFSSSRKRSSFL-- 430

Query: 425 LSTIQNGKDVISVPSSSNTTP-GSSKRISMSLSSNKGSKILPQSNSGSPTPAPRN-KRMS 482
                    + S P+ S+  P  SSKRI+    ++  ++  P   SG P P  RN K+ S
Sbjct: 431 ---------LSSNPTDSSPIPLRSSKRITHINVASANTQATP---SGVPNPHKRNSKKRS 478

Query: 483 VQNLETSSNPPPIPVDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSITTKIISTY 542
            + L                     S   N KR+S                +T+K +S +
Sbjct: 479 SKRL---------------------SYMPNTKRSS----------------LTSKSLSNF 501

Query: 543 AKLSEDDDWEFIEKETKRVSSDFATLIDEIFEHEKYE 579
             L +DDDWE+IEK+ KR SS+FATLIDEIFE EK+E
Sbjct: 502 TNLIDDDDWEYIEKDAKRTSSNFATLIDEIFEPEKFE 538

 Score =  144 bits (363), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 150/475 (31%), Positives = 216/475 (45%), Gaps = 80/475 (16%)

Query: 677  FSLQTRPVSKLDPGIKCGSNKPVQMEEIVEDELDKTI---DSQKVILETIRRSKFLGSSF 733
             S  TRP+S+LDPG+      PV  E +  +  +KT    D++K I+ETIRRSKFLGS  
Sbjct: 615  LSSYTRPISRLDPGLT-----PV-TETLPNNLKEKTALLQDTEKKIIETIRRSKFLGSLL 668

Query: 734  NIDKELKQVKKDAEVKRMRKSQKEDRDVSGRIVSETNEQYETQVLPKNATAFGALKDDSE 793
            N+   L   K  +E+  + +S          IVS T   Y                  ++
Sbjct: 669  NVRGGLSPGK--SELAPIEESP---------IVSTTPLIY------------------ND 699

Query: 794  EVEPRKISDIQVPQFTRKSKLFTDSNKRLSVLSIYSSTQSYTNLANVLKEGGVDIXXXXX 853
             +EPR+ISD++VP FTRKSK FT +N R SVLS+Y+   S  +L   L +   D+     
Sbjct: 700  RMEPRRISDVEVPHFTRKSKHFTTANNRRSVLSLYAK-DSIKDLNEFLIKEDPDLPPQGS 758

Query: 854  XXXXXXXXXPEFQFETVGTXXXXXXXXXXX------XXXXXXXLSQGANIKLNYADRFDT 907
                     PE       +                          QG  I   Y D  D 
Sbjct: 759  TDNESRSEDPEIAESITDSRNIQYDEDDSKDGDNVNNDNILSDFPQGVGISQEY-DMKDK 817

Query: 908  AGNVNE----------VKLPTLPPLGDDKVSDGLGIYXXXXXXXXXXXXPVPSIKENKSE 957
              N +           VKLP+L      K + GLG+Y             +PS+  N S 
Sbjct: 818  NPNQSPISKSAEPTLVVKLPSLSSF-QGKNASGLGLYQREPSKVT-----LPSLTSNNSS 871

Query: 958  -----ETLKEKNVEPK---PPLNDVVPKTRDTKKTNVVQNNNAKHSSDKPRSTSFFRKIS 1009
                 E   EK  E +     L+D   K  + KK N     NA  +  KP ++   +K S
Sbjct: 872  VGENIEDGAEKGTESEKIAASLSDDDLKEDNDKKDN--DTVNAPTTVKKPPNSVLLKKFS 929

Query: 1010 KGLTVQNDTTGYDVKLFSNVSVTQLYNGLFNLLKGWKDYGLKEIKSNKEAFSISVRLSSD 1069
            KG  ++       +++ + +   +LY GL  LL+GWK YGLK +  N     I+ +L +D
Sbjct: 930  KGKILE-------LEIHAKIPEKRLYEGLHKLLEGWKQYGLKNLVFNITNMIITGKLVND 982

Query: 1070 NILSLRSTFVDMVVFSEGK-HSVIGFRKKSGSSKTLKRLTSEVEKVLRKEGVLAK 1123
            +IL LRST  +++V   G   S+I F KK+GS+KTL +L +E++ +L+KEGVL K
Sbjct: 983  SILFLRSTLFEIMVLPNGDGRSLIKFNKKTGSTKTLTKLATEIQIILQKEGVLDK 1037

>Kwal_33.13225 s33 (127676..130570) [2895 bp, 964 aa] {ON} YFR016C -
           Hypothetical ORF [contig 120] FULL
          Length = 964

 Score =  468 bits (1205), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 244/385 (63%), Positives = 293/385 (76%), Gaps = 24/385 (6%)

Query: 203 LPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQD 262
           LPYHG E+DVWSCG+ILFALLTGRLPFDEEDGNIRNLLLKVQ G+FEMP  DEIS EAQD
Sbjct: 10  LPYHGFESDVWSCGIILFALLTGRLPFDEEDGNIRNLLLKVQSGQFEMPDSDEISPEAQD 69

Query: 263 LLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDTYLNPLIGNDGGDATI 322
           L+ KIL VDP  RIKSREILKHPLLQKYPSIKDSK+IRNLPREDTYLNPL   D  + +I
Sbjct: 70  LIAKILTVDPAARIKSREILKHPLLQKYPSIKDSKSIRNLPREDTYLNPL---DSVNGSI 126

Query: 323 DKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKVDSEQEALKNSQIKKRQ 382
           D++I+ NLVVLWHGR+ ++I  +L+EPGAN EKT YALL+RFK DS QE LK  Q + + 
Sbjct: 127 DESIINNLVVLWHGRDRNEITAQLKEPGANLEKTFYALLFRFKHDSHQEQLKQ-QRRSQA 185

Query: 383 SIIS------NNNLKSGNINTTTPQKKKNRNSVISVSSSHKRPVSLNRLSTIQNGKDVIS 436
           S IS       N++   +I   TP KKKN+  VIS SSSHKRPVS NRLS   NG +   
Sbjct: 186 SHISPKRSNMRNSVSRRSITNVTP-KKKNKAPVISASSSHKRPVSFNRLS-FNNGSNTAH 243

Query: 437 VPSSSNTTPGSSKRISMSLSSNKGSKILPQSNSGSPTPAPRNKRMSVQNLETSSNPPPIP 496
            P +S     +SKR S++LSSNK    L   N+   +P P +KR S+++L+ S+  PPIP
Sbjct: 244 TPPTS-----ASKRASVNLSSNKRISALINPNN---SPTPVHKRSSMRDLDASA--PPIP 293

Query: 497 VDMLKDYGNSTSSHANAKRASRISKRLSVLPNAKRGSITTKIISTYAKLSEDDDWEFIEK 556
           +DMLKDY  S      ++R++R+SKRLS LP  KRGSITTK+I+TYAK+S+D+DWE+IEK
Sbjct: 294 MDMLKDYNKSAPKV--SRRSTRLSKRLSFLPGNKRGSITTKLIATYAKISKDNDWEYIEK 351

Query: 557 ETKRVSSDFATLIDEIFEHEKYEQI 581
           ET+R S+DFATL DEIFEHEKYEQI
Sbjct: 352 ETRRTSADFATLCDEIFEHEKYEQI 376

 Score =  248 bits (633), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 181/519 (34%), Positives = 263/519 (50%), Gaps = 61/519 (11%)

Query: 651  NVRSISSPVEN-------GNEAKSEEDASG---QRSFSLQTRPVSKLDPGIKCGSNKPVQ 700
            +VRS+S+P E+       G+    + D      +R+FSL+TRP S+LDPGI        +
Sbjct: 455  HVRSVSAPAESVLKVDKRGSTGNLDNDIMALLNRRTFSLETRPKSRLDPGIYTS-----E 509

Query: 701  MEEIVEDELDKTIDSQKVILETIRRSKFLGSSFNIDKELKQVKKDAEVKRMRKSQKEDRD 760
             E+         + ++K ILETIRRSKFLGSSF+I+KEL + ++  E +     +K++  
Sbjct: 510  EEDFGSKNHGADLSTEKTILETIRRSKFLGSSFDINKELARERRLKEERAALAKRKDEER 569

Query: 761  VSGRIVSE--TNEQYETQVLPKNATAFGALKDDSEEVEPRKISDIQVPQFTRKSKLFTDS 818
            V+    +       YE+Q LPK      A++  SE   PRKIS+++VPQFTR+S+ FT S
Sbjct: 570  VASNATTANVVGNGYESQTLPKRKMG-SAMEASSE---PRKISEVEVPQFTRRSRHFTAS 625

Query: 819  NKRLSVLSIYSSTQSYTNLANVLK-EGGVDIXXXXXXXXXXXXXXPEFQFETVGTXXXXX 877
            NKRLSVLS+YS+  S+TNLA+ LK +  V +               EF FE+V       
Sbjct: 626  NKRLSVLSMYSTKTSFTNLADHLKGKADVQLIQTSPPSASKMDQEAEFMFESVDKEGKET 685

Query: 878  XXXXXXXXXXXXXLSQGAN-----IKLNYADRF---------DTAGNVNEVKLPTLPPLG 923
                          ++ A      +KLN+ADRF         DT  +   +KLP LPPL 
Sbjct: 686  ADTSADSRLYEVAETKDAKNAKPAVKLNFADRFNRPTSPPSQDTDSSA-AIKLPALPPLD 744

Query: 924  DDK--VSDGLGIYXXXXXXXXXXXXPV----------------PSIKENKSEETLKEKNV 965
             +K  +  GLG+Y            PV                P     ++EE  K   V
Sbjct: 745  KNKPNMVSGLGLYQATAEPSHEDAQPVAKSMVIDDVESEITTEPRNTVTETEEAAKNSTV 804

Query: 966  ---EPKPPLNDVVPKTRDTKKTNVVQNNNAKHSSDKPRSTSFFRKISKGLTVQNDTTGYD 1022
                P  PLN+V+ K  D  +  +   ++   + +K  + SFFRK S   + +  +  YD
Sbjct: 805  VPTAPVAPLNNVMKKNTDADRKPL---SDITPAVEKKANKSFFRKFSSKGSDEKKSGDYD 861

Query: 1023 VKLFSNVSVTQLYNGLFNLLKGWKDYGLKEIKSNKEAFSISVRLSSDNILSLRSTFVDMV 1082
             +  + +  TQ++N L  LL  WKDYGLK++ ++     I  +LSSDNILSLRST   + 
Sbjct: 862  FRFKTVIEETQMFNALSKLLAAWKDYGLKDVIASPSLKQIRGKLSSDNILSLRSTLFIIT 921

Query: 1083 VFSEGKHSVIGFRKKSGSSKTLKRLTSEVEKVLRKEGVL 1121
            V   G+ S + F KKSGS+KT K+L  E+EK+L  +  L
Sbjct: 922  VVGRGEGSYVEFTKKSGSNKTFKKLVKEIEKILESKKAL 960

>KLTH0D05566g Chr4 (498055..501441) [3387 bp, 1128 aa] {ON} weakly
           similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101W HSL1 Nim1p-related protein kinase that regulates
           the morphogenesis and septin checkpoints associates with
           the assembled septin filament required along with Hsl7p
           for bud neck recruitment phosphorylation and degradation
           of Swe1p
          Length = 1128

 Score =  396 bits (1017), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 198/353 (56%), Positives = 249/353 (70%), Gaps = 18/353 (5%)

Query: 14  DTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLS 73
           DTIGPWKLG+TLG GS+G+V+LA N  T + AA+K++                  P++L 
Sbjct: 53  DTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAVKIVPKTKSSR-----------PNALP 101

Query: 74  YGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIR 133
           YGIEREIIIMKL++HPNV+ LY+VWE    L++VLEY + GELF+ LV +G L E EAI 
Sbjct: 102 YGIEREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLSEKEAIH 161

Query: 134 FFRQIIIGMSYCHALGIVHRDLKPENILLDHK-LNIKIADFGMAALETEDKLLETSCGSP 192
           +FRQII G +YCH+  I HRDLKPEN+LLD K   IKIADFGMAAL+T +KLLETSCGSP
Sbjct: 162 YFRQIIEGTAYCHSFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCGSP 221

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG 252
           HYA+PEIV G  Y+G  +DVWSCG+ILFALLTG LPF+  D NI+ LLLKVQ G+++MP 
Sbjct: 222 HYASPEIVMGKTYNGGPSDVWSCGIILFALLTGHLPFN--DDNIKRLLLKVQAGKYQMP- 278

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDTYLNPL 312
              IS EAQDL+ +ILVVDP KRI   +IL HPL+ KY   K SK+  +L    ++ +P 
Sbjct: 279 -QAISLEAQDLISRILVVDPNKRITINDILSHPLITKY-DYKRSKSNSDL-HILSHTSPQ 335

Query: 313 IGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFK 365
           I     +  +D TILQNL +LWHG  +D I K+L EP    EKT Y+LL  ++
Sbjct: 336 ICTIRSERDVDPTILQNLQILWHGAPKDYIMKRLLEPELTEEKTFYSLLLAYQ 388

>Ecym_7392 Chr7 complement(803240..807544) [4305 bp, 1434 aa] {ON}
           similar to Ashbya gossypii ABL034W
          Length = 1434

 Score =  398 bits (1022), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 206/389 (52%), Positives = 266/389 (68%), Gaps = 19/389 (4%)

Query: 14  DTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLS 73
           DT+GPWKLG+TLG GS+G+V+LA N  T + AAIK++                    SL 
Sbjct: 59  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKRNVRHNNTQLT-------SLP 111

Query: 74  YGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIR 133
           YGIEREIIIMKL++HPNV+ LY+VWE    LY+VLEY E GELF+ L+ +G LPE EA+ 
Sbjct: 112 YGIEREIIIMKLISHPNVMALYEVWENKPELYLVLEYVEGGELFDYLISRGKLPEQEAVH 171

Query: 134 FFRQIIIGMSYCHALGIVHRDLKPENILLDHK-LNIKIADFGMAALETEDKLLETSCGSP 192
           +F+QI+ G+SYCH   I HRDLKPEN+LLD K L++KIADFGMAALET DKLLETSCGSP
Sbjct: 172 YFKQIVQGVSYCHHFNICHRDLKPENLLLDKKNLSVKIADFGMAALETTDKLLETSCGSP 231

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG 252
           HYA+PEIV G  YHG  +DVWSCG+ILFALLTG LPF+  D N++ LLLKVQ G+++MP 
Sbjct: 232 HYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVKKLLLKVQSGKYQMPQ 289

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDTYLNPL 312
           +  IS EA+DL+ KIL+VDP  RI   E+L+HPLL KY   + SK+  NL   D+  N +
Sbjct: 290 N--ISNEAKDLIAKILIVDPAMRITIDEVLEHPLLLKYQKTR-SKSSSNLHALDSTPNIV 346

Query: 313 IGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKVDSEQEA 372
           +     +  ID++IL NL +LWHG  ++ +  KL + G   EK  Y+LL R++    Q+ 
Sbjct: 347 VLE--SEDKIDESILSNLQILWHGAPKEYLTGKLLQQGFTEEKLFYSLLLRYQ--ERQKL 402

Query: 373 LKNSQIKKRQSIISNNNLKSGNINTTTPQ 401
            + SQ K   S+      K+G+ N  TPQ
Sbjct: 403 PEASQPKPLSSLAPLR--KTGSSNADTPQ 429

>ABL034W Chr2 (333432..337709) [4278 bp, 1425 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL101W (HSL1)
          Length = 1425

 Score =  394 bits (1012), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 194/353 (54%), Positives = 245/353 (69%), Gaps = 14/353 (3%)

Query: 14  DTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLS 73
           DT+GPWKLG+TLG GS+G+V+LA N  + + AAIK++                    +L 
Sbjct: 56  DTVGPWKLGKTLGKGSSGRVRLAKNMQSGKLAAIKIVPKRNVRHNQKQVT-------ALP 108

Query: 74  YGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIR 133
           YGIEREIIIMKL+ HPN++ LY+VWE  + LY+VLEY E GELF+ L+ +G LPE EAI 
Sbjct: 109 YGIEREIIIMKLITHPNIMALYEVWENKSELYLVLEYVEGGELFDYLIARGKLPEQEAIH 168

Query: 134 FFRQIIIGMSYCHALGIVHRDLKPENILLDHK-LNIKIADFGMAALETEDKLLETSCGSP 192
           +F+QI+ G+SYCH   I HRDLKPEN+LLD K   +KIADFGMAALET ++LLETSCGSP
Sbjct: 169 YFKQIVQGVSYCHNFNICHRDLKPENLLLDKKNKTVKIADFGMAALETTNRLLETSCGSP 228

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG 252
           HYA+PEIV G  YHG  +DVWSCG+ILFALLTG LPF+  D N+R LLLKVQ G ++MP 
Sbjct: 229 HYASPEIVMGQKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVRKLLLKVQHGRYQMPS 286

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDTYLNPL 312
           +  +SKEA+DL+ KILVVDPEKRI   +IL+HPLL KY +    K     P E     P 
Sbjct: 287 N--VSKEAKDLISKILVVDPEKRITVDKILEHPLLVKYDN--PGKGGLACPLEKPEERPK 342

Query: 313 IGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFK 365
           + +      ID+TIL NL +LWHG  ++ +  KL + G   EK  YALL R++
Sbjct: 343 VLDIHSIDDIDETILSNLQILWHGAPKEYLVDKLLQSGFTEEKLFYALLLRYQ 395

>Kwal_26.7788 s26 (511530..515333) [3804 bp, 1267 aa] {ON} YKL101W
           (HSL1) - Putative protein kinase homologous to S. pombe
           cdr1/nim1 [contig 55] FULL
          Length = 1267

 Score =  390 bits (1002), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 198/353 (56%), Positives = 247/353 (69%), Gaps = 18/353 (5%)

Query: 14  DTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLS 73
           DTIGPWKLG+TLG GS+G+V+LA N  T + AAIK++                    SL 
Sbjct: 53  DTIGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKTKSSRT-----------GSLP 101

Query: 74  YGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIR 133
           YGIEREIIIMKL++HPNV+ LY+VWE    L++VLEY + GELF+ LV +G LPE EAI 
Sbjct: 102 YGIEREIIIMKLISHPNVMGLYEVWENKLELFLVLEYVDGGELFDYLVSRGRLPEKEAIH 161

Query: 134 FFRQIIIGMSYCHALGIVHRDLKPENILLDHK-LNIKIADFGMAALETEDKLLETSCGSP 192
           +FRQII G +YCH   I HRDLKPEN+LLD K   IKIADFGMAAL+T +KLLETSCGSP
Sbjct: 162 YFRQIIEGTAYCHGFNICHRDLKPENLLLDKKNKRIKIADFGMAALQTSNKLLETSCGSP 221

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG 252
           HYA+PEIV G  Y+G  +DVWSCG+ILFALLTG LPF+  D NI+ LLLKVQ G+++MP 
Sbjct: 222 HYASPEIVMGKNYNGGPSDVWSCGIILFALLTGHLPFN--DDNIKRLLLKVQAGKYQMP- 278

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDTYLNPL 312
              +S  AQDL+ +ILVVDP+KRI   EIL HPLL KY + K SK+  +L    ++  P 
Sbjct: 279 -QSVSSGAQDLISRILVVDPDKRISINEILAHPLLAKYGN-KRSKSNSDL-HILSHSKPQ 335

Query: 313 IGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFK 365
           I     ++ +D TILQNL +LWHG  ++ I K L +P    EKT Y+LL  ++
Sbjct: 336 ISTIKSESDVDPTILQNLQILWHGAPKESILKGLLKPELTEEKTFYSLLLAYQ 388

>KLLA0F13552g Chr6 complement(1252906..1256709) [3804 bp, 1267 aa]
           {ON} weakly similar to uniprot|P34244 Saccharomyces
           cerevisiae YKL101W HSL1 Nim1p-related protein kinase
           that regulates the morphogenesis and septin checkpoints
           associates with the assembled septin filament required
           along with Hsl7p for bud neck recruitment
           phosphorylation and degradation of Swe1p
          Length = 1267

 Score =  389 bits (1000), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 195/368 (52%), Positives = 254/368 (69%), Gaps = 21/368 (5%)

Query: 14  DTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLS 73
           DT+GPWKLG+TLG GS+G+V+LA N  T + +AIK++                     L 
Sbjct: 68  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLSAIKIVPKKFVKSNQIKQ---------LP 118

Query: 74  YGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIR 133
           YGIEREIIIMKL++HPNV+ LY+VWE  + LY+VLEY E GELF+ LV KG LPE+EAI 
Sbjct: 119 YGIEREIIIMKLISHPNVMGLYEVWENKSELYLVLEYVEGGELFDYLVSKGKLPESEAIH 178

Query: 134 FFRQIIIGMSYCHALGIVHRDLKPENILLD-HKLNIKIADFGMAALETEDKLLETSCGSP 192
           +F+QI+  ++YCH   I HRDLKPEN+LLD  K +IKIADFGMAALET DKLLETSCGSP
Sbjct: 179 YFKQIVQAVAYCHGFNICHRDLKPENLLLDKKKRSIKIADFGMAALETSDKLLETSCGSP 238

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG 252
           HYA+PEIV G  YHG  +DVWSCG+ILFALLTG LPF+  D N++ LLLKVQ G+++MP 
Sbjct: 239 HYASPEIVLGRKYHGSPSDVWSCGIILFALLTGHLPFN--DDNVKKLLLKVQSGKYQMP- 295

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDTYLN-- 310
              +S EA+DL+ +ILVVDP +RI   +IL+H LL KY     SK+  +L      LN  
Sbjct: 296 -QWLSVEAKDLISRILVVDPNRRITIDQILQHELLTKYDQKSRSKSNSDL----NLLNRT 350

Query: 311 PLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKVDSEQ 370
           P I +   +  ID+TIL NL +LWHG     +  +L +PG   EK  Y+LL+ ++ + +Q
Sbjct: 351 PNIVSFSSERDIDETILSNLQILWHGAARKHLVTRLMKPGFTEEKMFYSLLWNYQ-EKQQ 409

Query: 371 EALKNSQI 378
           ++++   I
Sbjct: 410 KSMQKDLI 417

>SAKL0E02860g Chr5 complement(228726..232859) [4134 bp, 1377 aa]
           {ON} similar to uniprot|Q75DQ1 Ashbya gossypii ABL034W
           ABL034Wp and weakly similar to YKL101W uniprot|P34244
           Saccharomyces cerevisiae YKL101W HSL1 Nim1p-related
           protein kinase that regulates the morphogenesis and
           septin checkpoints associates with the assembled septin
           filament required along with Hsl7p for bud neck
           recruitment phosphorylation and degradation of Swe1p
          Length = 1377

 Score =  385 bits (990), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 191/356 (53%), Positives = 242/356 (67%), Gaps = 15/356 (4%)

Query: 14  DTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLS 73
           DT+GPWKLG+TLG GS+G+V+LA N  T + AAIK++                    +L 
Sbjct: 56  DTVGPWKLGKTLGKGSSGRVRLAKNMETGKLAAIKIVPKKVVRSTNASKKSNAAN-GNLP 114

Query: 74  YGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIR 133
           YGIEREIIIMKL++HPN++ LY+VWE  + L++VLEY E GELF+ LV KG LPE EA+ 
Sbjct: 115 YGIEREIIIMKLISHPNIMALYEVWENKSELFLVLEYVEGGELFDYLVSKGKLPEQEAVH 174

Query: 134 FFRQIIIGMSYCHALGIVHRDLKPENILLDHK-LNIKIADFGMAALETEDKLLETSCGSP 192
           +FRQII G++YCH   I HRDLKPEN+L+D K   IKIADFGMAALET +KLLETSCGSP
Sbjct: 175 YFRQIIQGVAYCHNYNICHRDLKPENLLVDKKNHQIKIADFGMAALETTNKLLETSCGSP 234

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG 252
           HYA+PEIV G  YHG  +DVWSCG+ILFALLTG LPF+  D NI+ LLLKVQ G++ MP 
Sbjct: 235 HYASPEIVMGKNYHGSPSDVWSCGIILFALLTGHLPFN--DDNIKKLLLKVQSGKYHMPQ 292

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDTYL--- 309
           +  IS EAQDL+ KIL+VDP  RI   E+L+HPL+ KY         R+    D +L   
Sbjct: 293 N--ISSEAQDLISKILIVDPRGRITINEVLQHPLITKY------DKARSKSNSDLHLLSR 344

Query: 310 NPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFK 365
            P +        ID +IL NL +LWHG   + I  +L + G   EK  Y+LL++++
Sbjct: 345 TPQLVTLQSKEDIDGSILGNLQILWHGAPSEYIVARLLQHGFTEEKLFYSLLWQYQ 400

>Smik_11.139 Chr11 (235511..240115) [4605 bp, 1534 aa] {ON} YKL101W
           (REAL)
          Length = 1534

 Score =  387 bits (993), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 221/508 (43%), Positives = 306/508 (60%), Gaps = 74/508 (14%)

Query: 14  DTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXX------------XXXXXX 61
           DT+GPWKLG+TLG GS+G+V+LA N  T Q AAIK++                       
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHRSTNGTMPNSYSSSM 135

Query: 62  XXXXXXTPDSLS-----------YGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEY 110
                 +P  +S           YGIEREI+IMKL++H NV+ L++VWE  + LY+VLEY
Sbjct: 136 VTSNVSSPSIVSKEYSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLVLEY 195

Query: 111 AEKGELFNLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHK-LNIK 169
            + GELF+ LV KG LPE EAI +F+QI+ G+SYCH+  I HRDLKPEN+LLD K   IK
Sbjct: 196 VDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNRRIK 255

Query: 170 IADFGMAALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPF 229
           IADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  +DVWSCG++LFALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 230 DEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
           +  D NI+ LLLKVQ G+++MP +  +S EA+DL+ KILV+DP KRI ++EILKHPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPMN--LSAEARDLISKILVIDPAKRITTQEILKHPLIKK 371

Query: 290 YPSIKDSKTIRNLPRE---------DTYL----NPLIGNDGGDATIDKTILQNLVVLWHG 336
           Y  +  +K +R + R+         D +L    +P I      + ID++IL++L +LWHG
Sbjct: 372 YDDLPVNKILRKMKRDNMARGKSNSDLHLLNNVSPSIVTLYSRSDIDESILRSLQILWHG 431

Query: 337 RNEDDIAKKLREPGANAEKTLYALLYRFK---------VDSEQEALKNSQIKKRQ----S 383
            + + I  KL +   + EK  Y+LL ++K             +++ K S I + +    +
Sbjct: 432 VSRELITAKLLQKPMSEEKLFYSLLLQYKQRHSISLSSASEHKKSAKESSINESKIEHTA 491

Query: 384 IISNNNLKSGNINTTTPQ----------KKKNRNSVISVSSSHKRPV-------SLNRLS 426
            ISN+  +  N +  TP           +  N ++ ISV+     PV       SLN LS
Sbjct: 492 EISNSTNEGNNNDVKTPHSLEVHSENTSRFNNNDTSISVNPEINAPVLTQKSQFSLNTLS 551

Query: 427 TIQNGK---DVISVPSSSNTTPGSSKRI 451
              N K   +++++PS+      SS R+
Sbjct: 552 HQDNDKLEAEIVTLPSAIPIFNASSSRV 579

>YKL101W Chr11 (248920..253476) [4557 bp, 1518 aa] {ON}
           HSL1Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints; associates with
           the assembled septin filament; required along with Hsl7p
           for bud neck recruitment, phosphorylation, and
           degradation of Swe1p
          Length = 1518

 Score =  386 bits (992), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 195/392 (49%), Positives = 259/392 (66%), Gaps = 47/392 (11%)

Query: 14  DTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLS 73
           DT+GPWKLG+TLG GS+G+V+LA N  T Q AAIK++                  P+S S
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHCSNNGT---VPNSYS 132

Query: 74  --------------------------YGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMV 107
                                     YGIEREI+IMKL++H NV+ L++VWE  + LY+V
Sbjct: 133 SSMVTSNVSSPSIASREHSNHSQTNPYGIEREIVIMKLISHTNVMALFEVWENKSELYLV 192

Query: 108 LEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHK-L 166
           LEY + GELF+ LV KG LPE EAI +F+QI+ G+SYCH+  I HRDLKPEN+LLD K  
Sbjct: 193 LEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNR 252

Query: 167 NIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGR 226
            IKIADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  +DVWSCG++LFALLTG 
Sbjct: 253 RIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGH 312

Query: 227 LPFDEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPL 286
           LPF+  D NI+ LLLKVQ G+++MP +  +S EA+DL+ KILV+DPEKRI ++EILKHPL
Sbjct: 313 LPFN--DDNIKKLLLKVQSGKYQMPSN--LSSEARDLISKILVIDPEKRITTQEILKHPL 368

Query: 287 LQKYPSIKDSKTIRNLPRE---------DTYL----NPLIGNDGGDATIDKTILQNLVVL 333
           ++KY  +  +K +R + ++         D +L    +P I        ID++IL++L +L
Sbjct: 369 IKKYDDLPVNKVLRKMRKDNMARGKSNSDLHLLNNVSPSIVTLHSKGEIDESILRSLQIL 428

Query: 334 WHGRNEDDIAKKLREPGANAEKTLYALLYRFK 365
           WHG + + I  KL +   + EK  Y+LL ++K
Sbjct: 429 WHGVSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>TBLA0I01150 Chr9 complement(235187..240424) [5238 bp, 1745 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1745

 Score =  387 bits (995), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 197/385 (51%), Positives = 247/385 (64%), Gaps = 41/385 (10%)

Query: 14  DTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXX------------- 60
           DT+GPWKLG+TLG GS+G+V+LA N  T Q AAIK++                       
Sbjct: 68  DTVGPWKLGKTLGKGSSGRVRLAKNMKTGQLAAIKIVPKNFHSKKKRQDSPAKSLSSSPD 127

Query: 61  ---XXXXXXXTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELF 117
                      P + SYGIEREI+IMKL++HPNV+ LY+VWE  + LY+VLEY + GELF
Sbjct: 128 KPYTTHSNETNPSNNSYGIEREIVIMKLISHPNVMGLYEVWENKSELYLVLEYVDGGELF 187

Query: 118 NLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLN-IKIADFGMA 176
           + LV +G LPE EA+ +F+QII G++YCHA  I HRDLKPEN+LLD K   IKIADFGMA
Sbjct: 188 DYLVSRGKLPEREAVHYFKQIIQGVAYCHAFNICHRDLKPENLLLDKKNKIIKIADFGMA 247

Query: 177 ALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNI 236
           ALE  DKLL TSCGSPHYA+PEIV G  YHG  TDVWSCG+ILFALLTG LPF+ +  NI
Sbjct: 248 ALEVSDKLLSTSCGSPHYASPEIVMGKSYHGSPTDVWSCGIILFALLTGHLPFNHD--NI 305

Query: 237 RNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYP----- 291
           + LLLKVQ G + MP D  +S +A+DL+ KILVVDP+KR+ + EIL H L+ KY      
Sbjct: 306 KKLLLKVQSGVYHMPSD--LSPDAKDLISKILVVDPDKRLTTTEILNHSLITKYDRMGLT 363

Query: 292 --------SIKDSKTIRNLPREDTYLNPLIGND---GGDATIDKTILQNLVVLWHGRNED 340
                   S+   K+  NL     ++N L   D        ID +IL NL +LWHG ++ 
Sbjct: 364 NRNYNNNLSMARDKSNSNL----NFINNLSNVDILLQNPCDIDTSILSNLQILWHGESKH 419

Query: 341 DIAKKLREPGANAEKTLYALLYRFK 365
            I  KL +P  N EK  Y+LL ++K
Sbjct: 420 AIIDKLLQPNMNEEKLFYSLLLKYK 444

>Skud_11.126 Chr11 (235011..239567) [4557 bp, 1518 aa] {ON} YKL101W
           (REAL)
          Length = 1518

 Score =  381 bits (979), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 193/392 (49%), Positives = 259/392 (66%), Gaps = 47/392 (11%)

Query: 14  DTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLS 73
           DT+GPWKLG+TLG GS+G+V+LA N  T Q AAIK++                  P+S S
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKKAFVHRSNNGT---VPNSYS 132

Query: 74  --------------------------YGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMV 107
                                     YGIEREI+IMKL++H NV+ L++VWE  + LY+V
Sbjct: 133 SSMITSNVSSPSIASKEHSNHTQTNPYGIEREIVIMKLISHANVMALFEVWENKSELYLV 192

Query: 108 LEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHK-L 166
           LEY + GELF+ LV KG LPE EAI +F+QI+ G+S+CH+  I HRDLKPEN+LLD K  
Sbjct: 193 LEYVDGGELFDYLVSKGKLPEREAIHYFKQIVEGVSFCHSFNICHRDLKPENLLLDKKNR 252

Query: 167 NIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGR 226
            IKIADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  +DVWSCG++LFALLTG 
Sbjct: 253 KIKIADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGH 312

Query: 227 LPFDEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPL 286
           LPF+  D NI+ LLLKVQ G+++MP +  +S EA+DL+ KILV++PEKRI ++EIL HPL
Sbjct: 313 LPFN--DDNIKKLLLKVQSGKYQMPMN--LSAEARDLISKILVINPEKRITTQEILNHPL 368

Query: 287 LQKYPSIKDSKTIRNLPRE---------DTYL----NPLIGNDGGDATIDKTILQNLVVL 333
           ++KY ++  +K IR + R+         D +L    +P +        ID++IL++L +L
Sbjct: 369 IKKYDNLPINKMIRKMKRDNMARGKSNSDLHLLNNVSPSVVTLHSRGEIDESILRSLQIL 428

Query: 334 WHGRNEDDIAKKLREPGANAEKTLYALLYRFK 365
           WHG + + I  KL +   + EK  Y+LL ++K
Sbjct: 429 WHGVSRELITAKLLQKPMSEEKLFYSLLLQYK 460

>KAFR0D03200 Chr4 (628993..633339) [4347 bp, 1448 aa] {ON} Anc_2.479
           YKL101W
          Length = 1448

 Score =  379 bits (973), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 220/489 (44%), Positives = 301/489 (61%), Gaps = 48/489 (9%)

Query: 14  DTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVI-------XXXXXXXXXXXXXXXX 66
           DT+GPWKLG+TLG GS+G+V+LA N  T Q AAIK++                       
Sbjct: 87  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKTKIFRKQNDNSFQMSSYSSND 146

Query: 67  XTP------DSLS----YGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGEL 116
            +P      D+ S    YGIEREI+IMKL++HPNV+ LY+VWE  + L++VLEY + GEL
Sbjct: 147 ESPKHTNNNDTYSKINPYGIEREIVIMKLISHPNVMGLYEVWENKSELFLVLEYVDGGEL 206

Query: 117 FNLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLN-IKIADFGM 175
           F+ LV +G L E EA+ +F+QII G+SYCH+  I HRDLKPEN+LLD K+N IKIADFGM
Sbjct: 207 FDYLVSRGKLSEREAVHYFKQIIEGVSYCHSFNICHRDLKPENLLLDKKINTIKIADFGM 266

Query: 176 AALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGN 235
           AALE  +KLL TSCGSPHYA+PEIV G  YHG  +DVWSCG+ILFALLTG LPF+  D +
Sbjct: 267 AALELPNKLLVTSCGSPHYASPEIVMGKSYHGSPSDVWSCGIILFALLTGHLPFN--DDS 324

Query: 236 IRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKD 295
           I+ LLLKVQ G+F+MP +  IS EA+DL+ +ILVVDPEKRI+  +IL HPL++KY   +D
Sbjct: 325 IKKLLLKVQSGKFQMPQN--ISLEAEDLISRILVVDPEKRIQINDILIHPLIRKY---ED 379

Query: 296 SKTIRNLPREDTYLNPL-----IGNDGGDAT--------IDKTILQNLVVLWHGRNEDDI 342
           +KT  N        +       I ND G +         ID++IL+NL +LWHG + + I
Sbjct: 380 NKTDSNNVSSYKKSSKSNSNLHILNDMGPSIVTLKARNEIDESILKNLQILWHGTSRELI 439

Query: 343 AKKLREPGANAEKTLYALLYRFKVDSEQEALK--NSQIKKRQSIISNNNLKSGNINTTTP 400
             KL +   + EK  Y+LL ++K  +    ++  N +     S +S +N ++G  +T + 
Sbjct: 440 ISKLLQTPMSEEKLFYSLLLQYKKKNSIPLIQHTNHEASASNSPVSQSNSENG--DTKSI 497

Query: 401 QKKKNRNSVISVSSSHKRPVSLNRLSTIQNGKDVISVPSSSNTTPGSSKRIS------MS 454
           +K    +   +     K   S+  L   ++  DV S+P + +  P SS R        +S
Sbjct: 498 RKPTTNDEWHAPKLDQKSQFSIPALVRQESATDVPSLPPAVSIFPASSSRSFRKSGSILS 557

Query: 455 LSSNKGSKI 463
           +SS K  K+
Sbjct: 558 MSSKKSIKV 566

>Suva_11.123 Chr11 (235064..239644) [4581 bp, 1526 aa] {ON} YKL101W
           (REAL)
          Length = 1526

 Score =  379 bits (973), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 192/389 (49%), Positives = 258/389 (66%), Gaps = 41/389 (10%)

Query: 14  DTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXX------------XXXXXX 61
           DT+GPWKLG+TLG GS+G+V+LA N  T Q AAIK++                       
Sbjct: 76  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKAFVHRSNNGTVPNSYSSSM 135

Query: 62  XXXXXXTPDSLS-----------YGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEY 110
                 +P  +S           YGIEREI+IMKL++H NV+ L++VWE  + LY+VLEY
Sbjct: 136 VTSNVSSPSIVSKEHSNHSQTNPYGIEREIVIMKLISHANVMALFEVWENKSELYLVLEY 195

Query: 111 AEKGELFNLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHK-LNIK 169
            + GELF+ LV +G LPE EAI +F+QI+ G+SYCH+  I HRDLKPEN+LLD K   IK
Sbjct: 196 VDGGELFDYLVSRGKLPEREAIHYFKQIVEGVSYCHSFNICHRDLKPENLLLDKKNKKIK 255

Query: 170 IADFGMAALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPF 229
           IADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  +DVWSCG++LFALLTG LPF
Sbjct: 256 IADFGMAALELPNKLLKTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIVLFALLTGHLPF 315

Query: 230 DEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
           +  D NI+ LLLKVQ G+++MP +  +S EA++L+ KILV+DPEKRI ++EIL+HPL++K
Sbjct: 316 N--DDNIKKLLLKVQSGKYQMPMN--LSLEARNLISKILVIDPEKRITTQEILEHPLIKK 371

Query: 290 YPSIKDSKTIRNL---------PREDTYL----NPLIGNDGGDATIDKTILQNLVVLWHG 336
           Y ++  +K +R +            D +L    +P I        ID++IL++L +LWHG
Sbjct: 372 YDNLPVNKMLRKMKGDSMTRGKSNSDLHLLDNVSPSIVTLNTKNEIDESILRSLQILWHG 431

Query: 337 RNEDDIAKKLREPGANAEKTLYALLYRFK 365
            + + I  KL +   + EK  Y+LL R+K
Sbjct: 432 VSRELITAKLLQKPMSEEKLFYSLLLRYK 460

>KNAG0A06540 Chr1 (1002435..1006733) [4299 bp, 1432 aa] {ON}
           Anc_2.479 YKL101W
          Length = 1432

 Score =  377 bits (969), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 196/377 (51%), Positives = 249/377 (66%), Gaps = 30/377 (7%)

Query: 14  DTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLS 73
           DT+GPWKLG+TLG GS+G+V+LA N    Q AAIK++                    +L+
Sbjct: 83  DTVGPWKLGKTLGKGSSGRVRLAKNMENGQLAAIKIVPKNKCLKGGTDNCSSNDNSTTLT 142

Query: 74  -----------------YGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGEL 116
                            YGIEREI+IMKL++H NV+ L++VWE  N+L++VLEY + GEL
Sbjct: 143 TNYSMENTSDKDIPLNPYGIEREIVIMKLISHRNVMGLFEVWENKNDLFLVLEYVDGGEL 202

Query: 117 FNLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLN-IKIADFGM 175
           F+ LV KG LPE EA+ +F+QII G+++CH+  I HRDLKPEN+LLD K   IKIADFGM
Sbjct: 203 FDYLVSKGKLPEWEAVHYFKQIIEGVAFCHSYNICHRDLKPENLLLDKKNKIIKIADFGM 262

Query: 176 AALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGN 235
           AALE  +KLLETSCGSPHYA+PEIV G PYHG  +DVWSCG+ILFALLTG LPF+  D N
Sbjct: 263 AALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPFN--DDN 320

Query: 236 IRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKD 295
           IR LLLKVQ G F +P +  IS EAQDL+ KILVV+P +RIK  +ILKHPL+ KY     
Sbjct: 321 IRKLLLKVQSGRFRLPRN--ISLEAQDLIAKILVVNPRQRIKISDILKHPLITKYRQFFK 378

Query: 296 SK-------TIRNLPREDTYLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLRE 348
            K       +  NL  E   L P        A ID++IL+NL +LWHG + + I  KL +
Sbjct: 379 VKFNQVPNPSATNLNSEH-MLTPNNLKLASRADIDESILRNLQILWHGTSREIIIAKLLQ 437

Query: 349 PGANAEKTLYALLYRFK 365
              +AEK  Y+LL+++K
Sbjct: 438 YPMSAEKIFYSLLWQYK 454

>TDEL0A02550 Chr1 (457841..461950) [4110 bp, 1369 aa] {ON} Anc_2.479
           YKL101W
          Length = 1369

 Score =  375 bits (962), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 197/397 (49%), Positives = 251/397 (63%), Gaps = 54/397 (13%)

Query: 14  DTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVI----------------XXXXXXX 57
           DT+GPWKLG+TLG GS+G+V+LA N  T Q AAIK++                       
Sbjct: 74  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKNNVLGKNDACSTSSASYTSN 133

Query: 58  XXXXXXXXXXTPDSLS-----------YGIEREIIIMKLLNHPNVLRLYDVWETNNNLYM 106
                     T ++ +           YGIEREI+IMKL++H NVL LY+VWE  + LY+
Sbjct: 134 SSQTSTMMNTTANNYTTAGHSNVATNPYGIEREIVIMKLISHANVLGLYEVWENKSELYL 193

Query: 107 VLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHK- 165
           VLEY + GELF+ LV +G L E EA+ +F+QII G+SYCHA  I HRDLKPEN+LLD K 
Sbjct: 194 VLEYVDGGELFDYLVSRGRLCEREAVHYFKQIIQGVSYCHAFNICHRDLKPENLLLDKKN 253

Query: 166 LNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTG 225
             IKIADFGMAALE  +KLL+TSCGSPHYA+PEIV G  YHG  +DVWSCG+ILFALLTG
Sbjct: 254 STIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGKQYHGGPSDVWSCGIILFALLTG 313

Query: 226 RLPFDEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHP 285
            LPF+  D +I+ LLLKVQ G+++MP +  +SKEAQDL+ KIL V+P KR+ + EIL+HP
Sbjct: 314 HLPFN--DDSIKKLLLKVQSGKYQMPQN--LSKEAQDLIAKILTVNPAKRLTTEEILRHP 369

Query: 286 LLQKYPSIKDSKTIRNLPREDTYLNPLIGNDGGD--------AT---------IDKTILQ 328
           L+ KY S+  +K  + L     Y N   G    D        AT         ID TIL 
Sbjct: 370 LIVKYDSMMKTKKYKAL-----YKNMGQGKSNADLHLLNNYEATTINLNSRKDIDDTILN 424

Query: 329 NLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFK 365
           NL +LWHG + + I  KL +P  + EK  Y+LL ++K
Sbjct: 425 NLQILWHGASRELIVAKLLQPRMSEEKVFYSLLLKYK 461

>Kpol_431.9 s431 complement(22310..26968) [4659 bp, 1552 aa] {ON}
           complement(22310..26968) [4659 nt, 1553 aa]
          Length = 1552

 Score =  373 bits (957), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 207/465 (44%), Positives = 282/465 (60%), Gaps = 59/465 (12%)

Query: 14  DTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSL- 72
           DT+GPWKLG+TLG GS+G+V+LA N  T + AAIK++                     L 
Sbjct: 89  DTVGPWKLGKTLGKGSSGRVRLAKNIETGKLAAIKIVPKNKKFNNQHRSKNTNSNNGDLF 148

Query: 73  ------------------------------SYGIEREIIIMKLLNHPNVLRLYDVWETNN 102
                                          YGIEREI+IMKLL+HPNV+ LY+VWE NN
Sbjct: 149 LSYSSIHNTTNTHNARNTDNTAIENSGGGNPYGIEREIVIMKLLSHPNVMALYEVWENNN 208

Query: 103 NLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILL 162
            LY+VLEY + GELF+ LV KG L E+EA+ +F+QII G+SYCH+  I HRDLKPEN+LL
Sbjct: 209 ELYLVLEYVDGGELFDYLVSKGKLTESEAVHYFKQIINGISYCHSFNICHRDLKPENLLL 268

Query: 163 DHKLN-IKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFA 221
           D K   IKIADFGMAAL+  ++LL+TSCGSPHYA+PEIV G  Y+G  +D+WSCG+ILFA
Sbjct: 269 DKKRRIIKIADFGMAALQVSNRLLQTSCGSPHYASPEIVMGKCYNGAPSDIWSCGIILFA 328

Query: 222 LLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREI 281
           LLTG LPF+  D NI+ LL+KVQ G ++MP    IS+EA++L+ +ILVVDP KRI + +I
Sbjct: 329 LLTGHLPFN--DDNIKKLLIKVQNGRYQMPS--YISQEAKNLISRILVVDPSKRISTEQI 384

Query: 282 LKHPLLQKYP---SIKDSKTIRN-----LPREDTYLNPL--------IGNDGGDATIDKT 325
           L HPLL KY      KD K  +N       + ++ LN L        I      + ID++
Sbjct: 385 LSHPLLTKYDKRLGKKDRKVTKNNKIMHRGKSNSDLNMLSNIPQNTEIVKLRARSDIDES 444

Query: 326 ILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKVDSEQEALKNSQIKKRQSII 385
           IL+NL +LWHG + D I  KL +   + EK +Y+LL+++K    Q   K+S+     S  
Sbjct: 445 ILKNLQILWHGISRDIIIAKLLQTPMSEEKLIYSLLWKYK----QINFKSSKAPSISSAS 500

Query: 386 SNNNLKSGNINTTTPQKKKNRNSV--ISVSSSHKRPVSLNRLSTI 428
            N ++ + +  T+T   + N NS   IS+   +  P+  N+++ +
Sbjct: 501 VNISVSAQDTETST-NTRTNSNSATDISIPFVNTEPLQFNKINPV 544

>ZYRO0G03366g Chr7 (261014..265864) [4851 bp, 1616 aa] {ON} similar
           to uniprot|P34244 Saccharomyces cerevisiae YKL101W HSL1
           Nim1p-related protein kinase that regulates the
           morphogenesis and septin checkpoints associates with the
           assembled septin filament required along with Hsl7p for
           bud neck recruitment phosphorylation and degradation of
           Swe1p
          Length = 1616

 Score =  369 bits (948), Expect = e-107,   Method: Compositional matrix adjust.
 Identities = 194/404 (48%), Positives = 248/404 (61%), Gaps = 62/404 (15%)

Query: 14  DTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLS 73
           DT+GPWKLG+TLG GS+G+V+LA N  T Q AAIK++                 T    S
Sbjct: 96  DTVGPWKLGKTLGKGSSGRVRLAKNMETGQLAAIKIVPKKKCKNDPGSHSSSKSTESDFS 155

Query: 74  -------------------------------YGIEREIIIMKLLNHPNVLRLYDVWETNN 102
                                          YGIEREI+IMKL++H N+L LY+VWE  +
Sbjct: 156 ATMNTTTNTNRATTNGGTNANAGPSEVPANPYGIEREIVIMKLISHSNILGLYEVWENKS 215

Query: 103 NLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILL 162
            LY+VLEY + GELF+ LV +G L E EA+ +F+QI+ G+SYCH+  I HRDLKPEN+LL
Sbjct: 216 ELYLVLEYVDGGELFDYLVSRGKLGEREAVHYFKQIVQGVSYCHSFNICHRDLKPENLLL 275

Query: 163 DHK-LNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFA 221
           D K  +IKIADFGMAALE  +KLL+TSCGSPHYA+PEIV G PYHG  +DVWSCG+ILFA
Sbjct: 276 DKKNKSIKIADFGMAALEVSNKLLQTSCGSPHYASPEIVMGRPYHGGPSDVWSCGIILFA 335

Query: 222 LLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREI 281
           LLTG LPF+  D NI+ LLLKVQ G+F MP +  +S EA+DL+ KILVV+P KRI + EI
Sbjct: 336 LLTGHLPFN--DDNIKKLLLKVQSGKFHMPQN--LSAEAKDLMSKILVVNPFKRIATEEI 391

Query: 282 LKHPLLQKYPSIKDSKTIRNLPREDTYLNPLIGNDGG--------DAT------------ 321
           L HPLL KY  +      R      + +NP+  + G         DA+            
Sbjct: 392 LNHPLLTKYDKLVKPVKYR------SSVNPVALSQGKSNSDLHVLDASNSNIVDLRSRED 445

Query: 322 IDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFK 365
           ID +I+ NL +LWHG + + I  KL +P  + EK  Y+LL  +K
Sbjct: 446 IDDSIVSNLQILWHGASRELIVAKLLQPRMSEEKLFYSLLLSYK 489

>NCAS0A05770 Chr1 (1132854..1137239) [4386 bp, 1461 aa] {ON}
           Anc_2.479
          Length = 1461

 Score =  367 bits (941), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 192/385 (49%), Positives = 248/385 (64%), Gaps = 41/385 (10%)

Query: 14  DTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXX---------------XXXXX 58
           DT+GPWKLG+TLG GS+G+V+LA N  T Q AAIK++                       
Sbjct: 96  DTVGPWKLGKTLGKGSSGRVRLAKNIETGQLAAIKIVPKKHKLFMKSSHSNVSFFSAASN 155

Query: 59  XXXXXXXXXTPDSLS----------YGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVL 108
                    T   ++          YGIEREI+IMKL++HPNV+ LY+VWE  + LY+VL
Sbjct: 156 SNSNISTLATSPPMNNGSEKNQPNPYGIEREIVIMKLISHPNVMALYEVWENKSELYLVL 215

Query: 109 EYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHK-LN 167
           EY + GELF+ LV KG L E EA+ +F+QII G+SYCH+  I HRDLKPEN+LLD K  +
Sbjct: 216 EYVDGGELFDYLVSKGKLSEKEAVHYFKQIIQGVSYCHSFNICHRDLKPENLLLDKKNKS 275

Query: 168 IKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRL 227
           IKIADFGMAALE  +KLL+TSCGSPHYA+PEIV G  YHG  +DVWSCG+ILFALLTG L
Sbjct: 276 IKIADFGMAALELPNKLLQTSCGSPHYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHL 335

Query: 228 PFDEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
           PF+  D NI+ LLLKVQ G+F MP    +S EAQDL+ +ILV+DP KRI +  IL HPL+
Sbjct: 336 PFN--DDNIKKLLLKVQAGKFRMPS--TLSPEAQDLISRILVIDPSKRITTDRILNHPLI 391

Query: 288 QKY-PSIKDSKTIRNLPREDTYL------NPLIGNDGGDATIDKTILQNLVVLWHGRNED 340
            KY P+ K+   +      D ++       P+      D  ID +IL+NL +LWHG + +
Sbjct: 392 LKYEPAGKN--MVSGKSNSDLHVLEHISPQPISLTSRND--IDASILKNLQILWHGTSRE 447

Query: 341 DIAKKLREPGANAEKTLYALLYRFK 365
            I  KL +   + EK  Y+LL+++K
Sbjct: 448 LIIAKLLQTPMSEEKLFYSLLWQYK 472

>CAGL0K08514g Chr11 complement(854143..858612) [4470 bp, 1489 aa]
           {ON} similar to uniprot|P34244 Saccharomyces cerevisiae
           YKL101w serine/threonine-protein kinase
          Length = 1489

 Score =  359 bits (922), Expect = e-104,   Method: Compositional matrix adjust.
 Identities = 189/396 (47%), Positives = 246/396 (62%), Gaps = 57/396 (14%)

Query: 14  DTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXX------ 67
           DT+GPWKLG+TLG GS+G+V+LA N      AAIK++                       
Sbjct: 88  DTVGPWKLGKTLGKGSSGRVRLAKNIENGTLAAIKIVPKRTYNRRMRDQKMKTAGGVSSG 147

Query: 68  ----------------TPDSLS-YGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEY 110
                           T  +L+ YGIEREI+IMKL++HPNV+ L +VWE  + LY+VLEY
Sbjct: 148 TDSKDSSNREDPIKNGTDSALNPYGIEREIVIMKLISHPNVMGLLEVWENKSELYLVLEY 207

Query: 111 AEKGELFNLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLN-IK 169
            + GELF+ LV KG L E EA+ +F QII G+SYCH+  I HRDLKPEN+LLD K   IK
Sbjct: 208 VDGGELFDYLVSKGKLSEPEAVHYFTQIIQGVSYCHSFNICHRDLKPENLLLDKKNKVIK 267

Query: 170 IADFGMAALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPF 229
           IADFGMAALE  +KLLETSCGSPHYA+PEIV G PYHG  +DVWSCG+ILFALLTG LPF
Sbjct: 268 IADFGMAALELPNKLLETSCGSPHYASPEIVMGKPYHGGPSDVWSCGIILFALLTGHLPF 327

Query: 230 DEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
           +  D NI+ LLLKVQ G F++P    ++ +A+DL+ +ILV +PEKR+   EIL HPL++K
Sbjct: 328 N--DDNIKKLLLKVQAGRFQLPP--YLTNDAKDLITRILVTNPEKRLTINEILNHPLIKK 383

Query: 290 YPSIKDSKTIRNLPREDTYLNPLIGNDGGDA-------------------TIDKTILQNL 330
           Y         RN P     LN L+G    ++                    ID++IL++L
Sbjct: 384 Y---------RNPPAHIRKLN-LLGRGKSNSDLHVLEYNTPATVCLNSEEDIDQSILKSL 433

Query: 331 VVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKV 366
            +LWHG     + ++L   GA  EK  Y+LL+++K+
Sbjct: 434 QILWHGTPRQRLVERLLVEGATEEKLFYSLLFQYKL 469

>NDAI0D02750 Chr4 (639802..644349) [4548 bp, 1515 aa] {ON} Anc_2.479
           YKL101W
          Length = 1515

 Score =  328 bits (842), Expect = 4e-93,   Method: Compositional matrix adjust.
 Identities = 177/359 (49%), Positives = 238/359 (66%), Gaps = 22/359 (6%)

Query: 73  SYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAI 132
           +YGIEREI+IMKL++HPNV+ LY+VWE  + LY++LEY + GELF+ LV +G LPE EAI
Sbjct: 196 TYGIEREIVIMKLISHPNVMGLYEVWENKSELYLILEYVDGGELFDYLVSRGKLPEAEAI 255

Query: 133 RFFRQIIIGMSYCHALGIVHRDLKPENIL-LDHKLNIKIADFGMAALETEDKLLETSCGS 191
            +F+QII G+SYCH+  I HRDLKPEN+L    K +IKIADFGMAALE   KLL+TSCGS
Sbjct: 256 HYFKQIIQGVSYCHSFNICHRDLKPENLLIDKKKKSIKIADFGMAALELPKKLLQTSCGS 315

Query: 192 PHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMP 251
           PHYA+PEIV G  YHG  +DVWSCG+ILFALLTG LPF+  D NI+ LLLKVQ G+++MP
Sbjct: 316 PHYASPEIVMGKSYHGGPSDVWSCGIILFALLTGHLPFN--DDNIKKLLLKVQAGKYQMP 373

Query: 252 GDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY-PSIKDSKTIRNLPREDTYLN 310
            +  +S EA+DL+ +ILVV P KR+ + EIL HPL+ KY  S K    ++     D +L 
Sbjct: 374 KN--LSDEAKDLISRILVVSPSKRLTTVEILNHPLILKYEKSSKKKHMVKGKSNSDLHLL 431

Query: 311 PLIGND----GGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKV 366
             I  +         ID++IL+NL +LWHG + D I  KL +   + EK  Y+LL ++K 
Sbjct: 432 DSISPENITLNSRMDIDESILKNLQILWHGTSRDIIIAKLLQKPISEEKLFYSLLLQYKQ 491

Query: 367 ---------DSEQEALKNSQIKKRQSIISNNNLKSGNINTTTPQKKKNRNSVISVSSSH 416
                     +E+E+L  + I    S +S+  +K  N+ +  P  K N+    +V  S+
Sbjct: 492 RHSAKPVVKPAERESLPTATI---ISSLSHTPMKQKNLPSVAPNVKSNQKEESNVEDSY 547

 Score = 57.4 bits (137), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 24/37 (64%), Positives = 31/37 (83%)

Query: 14  DTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVI 50
           DT+GPWKLG+TLG GS+G+V+LA N  T Q AAIK++
Sbjct: 88  DTVGPWKLGKTLGKGSSGRVRLAKNVETGQLAAIKIV 124

>TPHA0G03200 Chr7 (683296..687900) [4605 bp, 1534 aa] {ON} Anc_2.479
           YKL101W
          Length = 1534

 Score =  322 bits (825), Expect = 7e-91,   Method: Compositional matrix adjust.
 Identities = 157/314 (50%), Positives = 215/314 (68%), Gaps = 26/314 (8%)

Query: 74  YGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIR 133
           YGIEREI+IMKL++HPNV+ LY+VWE  N LY+VLEY + GELF+ LV KG L E EA+R
Sbjct: 205 YGIEREIVIMKLVSHPNVMALYEVWENKNELYLVLEYVDGGELFDYLVSKGKLTELEAVR 264

Query: 134 FFRQIIIGMSYCHALGIVHRDLKPENILLDHKLN-IKIADFGMAALETEDKLLETSCGSP 192
           +F+QII G+ YCH+  I HRDLKPEN+LLD K   IKIADFGMAAL+  + LL+TSCGSP
Sbjct: 265 YFKQIIRGVQYCHSFNICHRDLKPENLLLDKKRKLIKIADFGMAALQVSNTLLKTSCGSP 324

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG 252
           HYA+PEIV G  Y+G  +DVWSCG+ILFALLTG LPF+  D +I+ LL+KVQ G ++MP 
Sbjct: 325 HYASPEIVMGKTYNGGPSDVWSCGIILFALLTGHLPFN--DDSIKKLLIKVQNGRYQMP- 381

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPRE--DTYLN 310
            + +SK+A+DL+ +IL+V+P+ R+ + +IL+HPL+ KY +    K    L ++    Y N
Sbjct: 382 -NYLSKDAKDLISRILLVNPKARLTTEQILEHPLITKYDNQYSLKKENKLTKQAIKNYNN 440

Query: 311 PLIGNDGGDAT-------------------IDKTILQNLVVLWHGRNEDDIAKKLREPGA 351
            + G    D                     ID +IL+NL +LW+G   + +  KL +   
Sbjct: 441 LMRGKSNTDLAILQNIPDKTDIIQLRSRNDIDDSILRNLQILWNGVPRETLISKLIQDPV 500

Query: 352 NAEKTLYALLYRFK 365
           + EK +Y+LL+++K
Sbjct: 501 SEEKLIYSLLWQYK 514

 Score = 57.0 bits (136), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 25/45 (55%), Positives = 33/45 (73%)

Query: 6   KGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVI 50
           +G      D IGPWKLG+TLG GS+G+V+LA N+ T Q AAIK++
Sbjct: 83  RGKKKTSRDMIGPWKLGKTLGKGSSGRVRLAKNKETGQLAAIKIV 127

>Kwal_33.13222 s33 (127342..127788) [447 bp, 148 aa] {OFF} YDR507C
           (GIN4) - putative serine/threonine kinase [contig 120]
           PARTIAL
          Length = 148

 Score =  243 bits (621), Expect = 3e-74,   Method: Composition-based stats.
 Identities = 109/120 (90%), Positives = 117/120 (97%)

Query: 83  MKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGM 142
           MKLL+H NVLRLYDVWETN+NLYMVLEY EKGELFNLLVE+GPLPENEA+RFFRQIIIG+
Sbjct: 1   MKLLHHANVLRLYDVWETNSNLYMVLEYVEKGELFNLLVERGPLPENEAVRFFRQIIIGI 60

Query: 143 SYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSG 202
           SYCHALGIVHRDLKPEN+LLDHK NIKIADFGMAALE++DKLLETSCGSPHYAAPEIVSG
Sbjct: 61  SYCHALGIVHRDLKPENLLLDHKFNIKIADFGMAALESKDKLLETSCGSPHYAAPEIVSG 120

>CAGL0M08910g Chr13 complement(887703..889541) [1839 bp, 612 aa]
           {ON}
          Length = 612

 Score =  242 bits (618), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 125/280 (44%), Positives = 181/280 (64%), Gaps = 17/280 (6%)

Query: 4   SNKGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXX 63
           SNK +    G  +G +++ +TLG GS GKV+LAY+ +T Q+ A+K+I             
Sbjct: 24  SNKVSSLADGSRVGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVL-------- 75

Query: 64  XXXXTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEK 123
                   +   IEREI  ++LL HP++++LYDV ++ + + MV+EYA   ELF+ +V++
Sbjct: 76  ----AKSDMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQR 130

Query: 124 GPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDK 183
             + E EA RFF+QII  + YCH   IVHRDLKPEN+LLD  LN+KIADFG++ + T+  
Sbjct: 131 NKMSEQEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGN 190

Query: 184 LLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKV 243
            L+TSCGSP+YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD+E  +I  L   +
Sbjct: 191 FLKTSCGSPNYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNI 248

Query: 244 QKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILK 283
             G + +P    +S  A DL+ ++L+V+P  RI   EI++
Sbjct: 249 SNGVYTLP--KFLSPGASDLIKRMLIVNPLNRISIHEIMQ 286

>TPHA0C00470 Chr3 (81482..83377) [1896 bp, 631 aa] {ON} Anc_5.611
           YDR477W
          Length = 631

 Score =  241 bits (616), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 172/510 (33%), Positives = 270/510 (52%), Gaps = 60/510 (11%)

Query: 13  GDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSL 72
           G  IG +++ +TLG GS GKV+LA++ +T Q+ A+K+I                 +   +
Sbjct: 24  GSKIGNYQIVKTLGEGSFGKVKLAFHSTTRQKVALKIINKKVL------------SKSDM 71

Query: 73  SYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAI 132
              IEREI  ++LL HP++++LYDV ++ + + MV+EYA+  ELF+ +V++  + ENE  
Sbjct: 72  QGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYADH-ELFDYIVQREKMSENEGR 130

Query: 133 RFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSP 192
           RFF+QII  + YCH   IVHRDLKPEN+LLD   N+KI DFG++ + T+   L+TSCGSP
Sbjct: 131 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHYNVKITDFGLSNIITDGNFLKTSCGSP 190

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG 252
           +YAAPE++SG  Y G E DVWSCGVIL+ LL  RLPFD+E  +I  L   +  G + +P 
Sbjct: 191 NYAAPEVISGKLYAGPEVDVWSCGVILYVLLCRRLPFDDE--SIPTLFKNINNGVYTIP- 247

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILKHPL----LQKY--PSIKDSKTIRNLPRED 306
            + +S+ A  L+ K+L+V+P  RI   +I++ P     L +Y  PS KD+  I       
Sbjct: 248 -NFLSEGAASLIKKMLIVNPMNRITIGDIIQDPWFKVDLPEYLVPSEKDAIKINGTNNNA 306

Query: 307 TYLNPLIGNDGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKV 366
             L  L   D  +  ID  IL   +      ++++I + L+    +   + + +   + +
Sbjct: 307 ENLQNLTAADIDEEAID--ILTKTM----NYSKEEIYESLQSGDVDTNPSHHEIKEAYLL 360

Query: 367 DSEQEALKNSQIKKRQSIISNNNLKSGNINTTTPQKKKNRNSVISVS---SSHKRPVSLN 423
             E + L N+ +KK  +I   +   S +  +     ++N  + +S+S    S K   +LN
Sbjct: 361 IKENQNLINT-LKKGDNIKQLDTFLSQSPPSFQKYNEQNGTTGMSISKPTHSGKDRRNLN 419

Query: 424 RLSTIQNGKDVISVPSSSN----------------TTPGSSKRISMSLSSNKGSKILPQS 467
            +  I + +  + VPSS +                T P   K+   +++      ILP S
Sbjct: 420 NIPGISDAQRPVHVPSSKHQFIPEENNQQRTYLPKTFPDEDKQADSTIT------ILPSS 473

Query: 468 NSGSPTPAPRNKRMSVQNLETSSNPPPIPV 497
                 P      M  Q L  +SN  P+PV
Sbjct: 474 -----LPQIHRTNMVSQGLVGTSNVTPLPV 498

>Kpol_1018.65 s1018 (189779..191584) [1806 bp, 601 aa] {ON}
           (189779..191584) [1806 nt, 602 aa]
          Length = 601

 Score =  240 bits (613), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 123/271 (45%), Positives = 180/271 (66%), Gaps = 17/271 (6%)

Query: 13  GDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSL 72
           G  IG +++ +TLG GS GKV+LAY+ +TNQ+ A+K+I                     +
Sbjct: 36  GSRIGNYQIIKTLGEGSFGKVKLAYHVTTNQRVALKIINKKILAKS------------DM 83

Query: 73  SYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAI 132
              IEREI  ++LL HP++++LYDV ++  ++ MV+EYA+  ELF+ +V++  + ENEA 
Sbjct: 84  QGRIEREISYLRLLRHPHIIKLYDVIKSKEDIIMVIEYADH-ELFDYIVQRDKMSENEAR 142

Query: 133 RFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSP 192
           +FF+QII  + YCH   IVHRDLKPEN+LLD +LN+KIADFG++ + T+   L+TSCGSP
Sbjct: 143 KFFQQIISAVEYCHRHKIVHRDLKPENLLLDEELNVKIADFGLSNIMTDGNFLKTSCGSP 202

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG 252
           +YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD  D +I  L   +  G + +P 
Sbjct: 203 NYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFD--DDSIPVLFKNISNGIYTLP- 259

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILK 283
              +S  A +L+ ++L+V+P  RI   EI++
Sbjct: 260 -KFLSPGAANLIKRMLIVNPLNRISMNEIME 289

>KLLA0A03806g Chr1 complement(338807..340615) [1809 bp, 602 aa] {ON}
           highly similar to uniprot|P06782 Saccharomyces
           cerevisiae YDR477W SNF1 Protein serine/threonine kinase
           required for release from glucose repression invertase
           expression sporulation and for expression of catabolite-
           repressed genes when glucose is limiting regulates
           Adr1p- dependent transcription primarily at the level of
           chromatin binding
          Length = 602

 Score =  240 bits (613), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 124/273 (45%), Positives = 179/273 (65%), Gaps = 17/273 (6%)

Query: 11  VKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPD 70
            +G  IG +++ +TLG GS GKV+LAY+ ST Q+ A+K+I                    
Sbjct: 27  AQGQHIGKYQIIKTLGEGSFGKVKLAYHISTGQKVALKIINKKVLAKS------------ 74

Query: 71  SLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENE 130
            +   IEREI  ++LL HP++++LYDV ++ + + MV+EYA   ELF+ +V++  +PE E
Sbjct: 75  DMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMPEQE 133

Query: 131 AIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCG 190
           A RFF+QII  + YCH   IVHRDLKPEN+LLD  LN+KIADFG++ + T+   L+TSCG
Sbjct: 134 ARRFFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCG 193

Query: 191 SPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEM 250
           SP+YAAPE++SG  Y G E DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +
Sbjct: 194 SPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTI 251

Query: 251 PGDDEISKEAQDLLYKILVVDPEKRIKSREILK 283
           P  + +S+ A  L+ K+L+V+P  RI   EI++
Sbjct: 252 P--NFLSQGAASLIKKMLIVNPVNRITVHEIMQ 282

>NCAS0A08080 Chr1 complement(1594221..1596092) [1872 bp, 623 aa]
           {ON} Anc_5.611
          Length = 623

 Score =  241 bits (614), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 123/271 (45%), Positives = 179/271 (66%), Gaps = 17/271 (6%)

Query: 13  GDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSL 72
           G  IG +++ +TLG GS GKV+LAY+ +T Q+ A+K+I                     +
Sbjct: 40  GSHIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKS------------DM 87

Query: 73  SYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAI 132
              IEREI  ++LL HP++++LYDV ++ + + MV+EYA   ELF+ +V++  + E+EA 
Sbjct: 88  QGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSEDEAR 146

Query: 133 RFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSP 192
           RFF+QII  + YCH   IVHRDLKPEN+LLD  LN+KIADFG++ + T+   L+TSCGSP
Sbjct: 147 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSP 206

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG 252
           +YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + +P 
Sbjct: 207 NYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNINNGVYTIP- 263

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILK 283
              +S+ A  L+ K+L+V+P  RI  +EI++
Sbjct: 264 -KFLSQGASTLIKKMLIVNPLNRISIQEIMQ 293

>TPHA0D02840 Chr4 (591733..593637) [1905 bp, 634 aa] {ON} 
          Length = 634

 Score =  241 bits (614), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 123/270 (45%), Positives = 177/270 (65%), Gaps = 17/270 (6%)

Query: 13  GDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSL 72
           G  IG +++ +TLG GS GKV+LAY+ +TNQ+ A+K+I                     +
Sbjct: 62  GARIGNYQIIKTLGEGSFGKVKLAYHVTTNQKVALKIINKKVL------------AKSDM 109

Query: 73  SYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAI 132
              +EREI  ++LL HP++++LYDV ++ + + MV+EYA   ELF  +V++  + ENEA 
Sbjct: 110 QGRVEREISFLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-NNELFEYIVQRDKMTENEAR 168

Query: 133 RFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSP 192
           +FF+QII  + YCH   IVHRDLKPEN+LLD  LN+KIADFG++ + T+   L+TSCGSP
Sbjct: 169 KFFQQIISAVEYCHRHKIVHRDLKPENLLLDENLNVKIADFGLSNIMTDGNFLKTSCGSP 228

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG 252
           +YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD  D +I  L   +  G + +P 
Sbjct: 229 NYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFD--DDSIPALFKNISNGIYTLP- 285

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREIL 282
              +S+ A +L+ K+L+V+P  RI   EI+
Sbjct: 286 -KFLSEGAANLIKKMLIVNPLNRISMTEII 314

>Suva_2.651 Chr2 (1164264..1166165) [1902 bp, 633 aa] {ON} YDR477W
           (REAL)
          Length = 633

 Score =  239 bits (609), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 122/271 (45%), Positives = 177/271 (65%), Gaps = 17/271 (6%)

Query: 13  GDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSL 72
           G  IG +++ +TLG GS GKV+LAY+ +T Q+ A+K+I                     +
Sbjct: 48  GAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKS------------DM 95

Query: 73  SYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAI 132
              IEREI  ++LL HP++++LYDV ++ + + MV+EYA   ELF+ +V++  + E+EA 
Sbjct: 96  QGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEDEAR 154

Query: 133 RFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSP 192
           RFF+QII  + YCH   IVHRDLKPEN+LLD  LN+KIADFG++ + T+   L+TSCGSP
Sbjct: 155 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSP 214

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG 252
           +YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + +P 
Sbjct: 215 NYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSLP- 271

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILK 283
              +S  A  L+ ++L+V+P  RI   EI++
Sbjct: 272 -KFLSPGAASLIKRMLIVNPLNRISIHEIMQ 301

>TBLA0E03360 Chr5 complement(838512..840476) [1965 bp, 654 aa] {ON}
           Anc_5.611 YDR477W
          Length = 654

 Score =  239 bits (610), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 123/271 (45%), Positives = 178/271 (65%), Gaps = 17/271 (6%)

Query: 13  GDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSL 72
           G  IG +++ +TLG GS GKV+LAY+ +T Q+ A+K+I                     +
Sbjct: 38  GSKIGNYQIIKTLGEGSFGKVKLAYHATTGQKVALKIINRKVLAKS------------DM 85

Query: 73  SYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAI 132
              IEREI  ++LL HP++++LYDV ++ + + MV+EYA+  ELF+ +V++  + E EA 
Sbjct: 86  QGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYAD-NELFDYIVQRDKMSEQEAR 144

Query: 133 RFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSP 192
           RFF+QII  + YCH   IVHRDLKPEN+LLD  LN+KIADFG++ + T+   L+TSCGSP
Sbjct: 145 RFFQQIISAVDYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSP 204

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG 252
           +YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + +P 
Sbjct: 205 NYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNINNGIYTLP- 261

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILK 283
              +S+ A  L+ K+L+V+P  RI   EI++
Sbjct: 262 -RFLSEGASSLIKKMLIVNPLNRISIHEIMQ 291

>YDR477W Chr4 (1412373..1414274) [1902 bp, 633 aa] {ON}
           SNF1AMP-activated serine/threonine protein kinase found
           in a complex containing Snf4p and members of the
           Sip1p/Sip2p/Gal83p family; required for transcription of
           glucose-repressed genes, thermotolerance, sporulation,
           and peroxisome biogenesis
          Length = 633

 Score =  239 bits (609), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 122/271 (45%), Positives = 176/271 (64%), Gaps = 17/271 (6%)

Query: 13  GDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSL 72
           G  IG +++ +TLG GS GKV+LAY+ +T Q+ A+K+I                     +
Sbjct: 49  GAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKS------------DM 96

Query: 73  SYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAI 132
              IEREI  ++LL HP++++LYDV ++ + + MV+EYA   ELF+ +V++  + E EA 
Sbjct: 97  QGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEAR 155

Query: 133 RFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSP 192
           RFF+QII  + YCH   IVHRDLKPEN+LLD  LN+KIADFG++ + T+   L+TSCGSP
Sbjct: 156 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSP 215

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG 252
           +YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + +P 
Sbjct: 216 NYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLP- 272

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILK 283
              +S  A  L+ ++L+V+P  RI   EI++
Sbjct: 273 -KFLSPGAAGLIKRMLIVNPLNRISIHEIMQ 302

>Smik_4.754 Chr4 (1333667..1335565) [1899 bp, 632 aa] {ON} YDR477W
           (REAL)
          Length = 632

 Score =  238 bits (608), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 122/271 (45%), Positives = 176/271 (64%), Gaps = 17/271 (6%)

Query: 13  GDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSL 72
           G  IG +++ +TLG GS GKV+LAY+ +T Q+ A+K+I                     +
Sbjct: 49  GAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKS------------DM 96

Query: 73  SYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAI 132
              IEREI  ++LL HP++++LYDV ++ + + MV+EYA   ELF+ +V++  + E EA 
Sbjct: 97  QGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEAR 155

Query: 133 RFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSP 192
           RFF+QII  + YCH   IVHRDLKPEN+LLD  LN+KIADFG++ + T+   L+TSCGSP
Sbjct: 156 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSP 215

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG 252
           +YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + +P 
Sbjct: 216 NYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLP- 272

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILK 283
              +S  A  L+ ++L+V+P  RI   EI++
Sbjct: 273 -KFLSPGAAGLIKRMLIVNPLNRISIHEIMQ 302

>Ecym_5588 Chr5 complement(1205102..1206943) [1842 bp, 613 aa] {ON}
           similar to Ashbya gossypii AEL230W
          Length = 613

 Score =  237 bits (605), Expect = 2e-66,   Method: Compositional matrix adjust.
 Identities = 124/271 (45%), Positives = 178/271 (65%), Gaps = 17/271 (6%)

Query: 13  GDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSL 72
           G  IG +++ +TLG GS GKV+LAY+ ST+Q+ A+K+I                     +
Sbjct: 37  GQRIGKYQVIKTLGEGSFGKVKLAYHVSTSQKVALKIINKKVLAKS------------DM 84

Query: 73  SYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAI 132
              IEREI  ++LL HP++++LYDV ++ + + MV+EYA   ELF+ +V++  + ENEA 
Sbjct: 85  QGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSENEAR 143

Query: 133 RFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSP 192
           RFF+QII  + YCH   IVHRDLKPEN+LLD  LN+KIADFG++ + T+   L+TSCGSP
Sbjct: 144 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSP 203

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG 252
           +YAAPE++SG  Y G E DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P 
Sbjct: 204 NYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYSIP- 260

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILK 283
              +S  A +L+ K+L+V+P  RI   EI++
Sbjct: 261 -KFLSPGAANLIKKMLIVNPLNRITIHEIME 290

>KNAG0B03230 Chr2 complement(625072..626997) [1926 bp, 641 aa] {ON}
           Anc_5.611 YDR477W
          Length = 641

 Score =  237 bits (605), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 123/276 (44%), Positives = 178/276 (64%), Gaps = 17/276 (6%)

Query: 13  GDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSL 72
           G  IG +++ +TLG GS GKV+LAY+ +TNQ+ A+K+I                     +
Sbjct: 39  GSRIGNYQIVKTLGEGSFGKVKLAYHITTNQKVALKIINKKVLAKS------------DM 86

Query: 73  SYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAI 132
              IEREI  ++LL HP++++LYDV ++ + + +V+E+A   ELF+ ++++  + E EA 
Sbjct: 87  QGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDKMSEQEAR 145

Query: 133 RFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSP 192
           RFF+QII  + YCH   IVHRDLKPEN+LLD  LN+KIADFG++ + T+   L+TSCGSP
Sbjct: 146 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCGSP 205

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG 252
           +YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + +P 
Sbjct: 206 NYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYILP- 262

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQ 288
              +S  A +L+ K+L+V+P  RI   EI K    Q
Sbjct: 263 -KFLSLGAANLIKKMLIVNPLNRISISEIFKDEWFQ 297

>Skud_4.751 Chr4 (1332135..1334039) [1905 bp, 634 aa] {ON} YDR477W
           (REAL)
          Length = 634

 Score =  237 bits (604), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 122/271 (45%), Positives = 176/271 (64%), Gaps = 17/271 (6%)

Query: 13  GDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSL 72
           G  IG +++ +TLG GS GKV+LAY+ +T Q+ A+K+I                     +
Sbjct: 50  GAHIGNYQIVKTLGEGSFGKVKLAYHTTTGQKVALKIINKKVLAKS------------DM 97

Query: 73  SYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAI 132
              IEREI  ++LL HP++++LYDV ++ + + MV+EYA   ELF+ +V++  + E EA 
Sbjct: 98  QGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEQEAR 156

Query: 133 RFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSP 192
           RFF+QII  + YCH   IVHRDLKPEN+LLD  LN+KIADFG++ + T+   L+TSCGSP
Sbjct: 157 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSP 216

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG 252
           +YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + +P 
Sbjct: 217 NYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLP- 273

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILK 283
              +S  A  L+ ++L+V+P  RI   EI++
Sbjct: 274 -KFLSPGAAGLIKRMLIVNPLNRISIHEIMQ 303

>Kpol_495.14 s495 (33810..35684) [1875 bp, 624 aa] {ON}
           (33810..35684) [1875 nt, 625 aa]
          Length = 624

 Score =  236 bits (602), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 120/271 (44%), Positives = 177/271 (65%), Gaps = 17/271 (6%)

Query: 13  GDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSL 72
           G  IG +++ +TLG GS GKV+LA++ +T Q+ A+K+I                 +   +
Sbjct: 36  GSRIGNYQIVKTLGEGSFGKVKLAFHVTTGQKVALKIINRKVL------------SKSDM 83

Query: 73  SYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAI 132
              IEREI  ++LL HP+++RLYDV ++ + + M++EYA   ELF+ +V++  + ENEA 
Sbjct: 84  QGRIEREIAYLRLLRHPHIIRLYDVIKSKDEIIMIIEYAHH-ELFDYIVQRDKMSENEAR 142

Query: 133 RFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSP 192
           +FF+QII  + YCH   IVHRDLKPEN+LLD   N+KI DFG++ + T+   L+TSCGSP
Sbjct: 143 KFFQQIISAVDYCHRHMIVHRDLKPENLLLDEHYNVKITDFGLSNIMTDGNFLKTSCGSP 202

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG 252
           +YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + +P 
Sbjct: 203 NYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPILFKNISNGIYTLP- 259

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILK 283
            + +S  A  L+ K+L+V+P  RI   EI++
Sbjct: 260 -NFLSDGAASLIKKMLIVNPINRISISEIMQ 289

>NDAI0H00940 Chr8 complement(209645..211702) [2058 bp, 685 aa] {ON}
           Anc_5.611
          Length = 685

 Score =  237 bits (605), Expect = 9e-66,   Method: Compositional matrix adjust.
 Identities = 126/290 (43%), Positives = 184/290 (63%), Gaps = 18/290 (6%)

Query: 13  GDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSL 72
           G  IG +++ +TLG GS GKV+LAY+ +T Q+ A+K+I                     +
Sbjct: 55  GAHIGNYQIVKTLGEGSFGKVKLAYHMTTGQKVALKIINKKVLAKS------------DM 102

Query: 73  SYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAI 132
              IEREI  ++LL HP++++LYDV ++ + + MV+EYA   ELF+ +V++  + ENEA 
Sbjct: 103 QGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVMEYA-GNELFDYIVQRDKMSENEAR 161

Query: 133 RFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSP 192
           RFF+QII  + YCH   IVHRDLKPEN+LLD  LN+KIADFG++ + T+   L+TSCGSP
Sbjct: 162 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSP 221

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG 252
           +YAAPE++SG  Y G E DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P 
Sbjct: 222 NYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNINNGVYTIP- 278

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQ-KYPSIKDSKTIRN 301
              +S+ A  L+ ++L+V+P  RI   EI++    +   P    S+ +RN
Sbjct: 279 -KFLSQGASSLIKRMLIVNPLNRISISEIMQDEWFKVDLPEYLLSQDLRN 327

>KAFR0C05860 Chr3 (1160586..1162520) [1935 bp, 644 aa] {ON}
           Anc_5.611 YDR477W
          Length = 644

 Score =  236 bits (601), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 120/271 (44%), Positives = 177/271 (65%), Gaps = 17/271 (6%)

Query: 13  GDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSL 72
           G  IG +++ +TLG GS GKV+LAY+ +T Q+ A+K+I                     +
Sbjct: 43  GSKIGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKILAKS------------DM 90

Query: 73  SYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAI 132
              IEREI  ++LL HP++++LYDV ++ + + +V+E+A   ELF+ ++++  + ENEA 
Sbjct: 91  QGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIIVIEFA-SNELFDYIIQRDKMSENEAR 149

Query: 133 RFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSP 192
           RFF+QII  + YCH   IVHRDLKPEN+LLD  LN+KIADFG++ + T+   L+TSCGSP
Sbjct: 150 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEDLNVKIADFGLSNIMTDGNFLKTSCGSP 209

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG 252
           +YAAPE++SG  Y G E DVWSCGVIL+ +L  RLPFD+E  +I  L   +  G + +P 
Sbjct: 210 NYAAPEVISGKLYAGPEVDVWSCGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYILP- 266

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILK 283
              +S  A  L+ ++L+V+P  RI   EI++
Sbjct: 267 -KFLSPGASSLIKRMLIVNPLNRISIHEIMQ 296

>AEL230W Chr5 (198401..200227) [1827 bp, 608 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YDR477W (SNF1)
          Length = 608

 Score =  234 bits (598), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 124/277 (44%), Positives = 182/277 (65%), Gaps = 18/277 (6%)

Query: 7   GNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXX 66
           G+I + G  IG +++ +TLG GS GKV+LA++ ST Q+ A+K+I                
Sbjct: 28  GSIPI-GQRIGKYQVIKTLGEGSFGKVKLAHHVSTGQKVALKIINKKVLAKS-------- 78

Query: 67  XTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPL 126
                +   IEREI  ++LL HP++++LYDV ++ + + MV+EYA   ELF+ +V++  +
Sbjct: 79  ----DMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKM 133

Query: 127 PENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLE 186
            ENEA RFF+QII  + YCH   IVHRDLKPEN+LLD  LN+KIADFG++ + T+   L+
Sbjct: 134 SENEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLK 193

Query: 187 TSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKG 246
           TSCGSP+YAAPE++SG  Y G E DVWS GVIL+ +L  RLPFD+E  +I  L   +  G
Sbjct: 194 TSCGSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNG 251

Query: 247 EFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILK 283
            + +P    +S+ A +L+ ++L+V+P  RI   EI++
Sbjct: 252 VYSIP--KFLSQGAANLIKRMLIVNPLNRITIHEIME 286

>TDEL0A04780 Chr1 (842715..844580) [1866 bp, 621 aa] {ON} Anc_5.611
           YDR477W
          Length = 621

 Score =  233 bits (595), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 121/271 (44%), Positives = 175/271 (64%), Gaps = 17/271 (6%)

Query: 13  GDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSL 72
           G  IG +++ +TLG GS GKV+LAY+ +T Q+ A+K+I                     +
Sbjct: 36  GSRIGNYQIVKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKS------------DM 83

Query: 73  SYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAI 132
              IEREI  ++LL HP++++LYDV ++ + + MV+EYA   ELF+ +V++  + E EA 
Sbjct: 84  QGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMSEKEAR 142

Query: 133 RFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSP 192
           RFF+QII  + YCH   IVHRDLKPEN+LLD  LN+KIADFG++ + T+   L+TSCGSP
Sbjct: 143 RFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSP 202

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG 252
           +YAAPE++SG  Y G E DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P 
Sbjct: 203 NYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLP- 259

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILK 283
              +S  A  L+ ++L+V+P  RI   EI++
Sbjct: 260 -KFLSPGAAGLIKRMLIVNPLNRISIHEIMQ 289

>Kwal_47.18233 s47 complement(743846..745642) [1797 bp, 598 aa] {ON}
           YDR477W (SNF1) - protein serine/threonine kinase [contig
           197] FULL
          Length = 598

 Score =  233 bits (593), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 121/268 (45%), Positives = 175/268 (65%), Gaps = 17/268 (6%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           IG +++ +TLG GS GKV+LAY+ +T Q+ A+K+I                     +   
Sbjct: 28  IGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKS------------DMQGR 75

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           IEREI  ++LL HP++++LYDV ++ + + MV+EYA   ELF+ +V++  + ENEA RFF
Sbjct: 76  IEREISYLRLLRHPHIIKLYDVVKSKDEIVMVIEYA-GNELFDYIVQRDKMSENEARRFF 134

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
           +QII  + YCH   IVHRDLKPEN+LLD  LN+KIADFG++ + T+   L TSCGSP+YA
Sbjct: 135 QQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLRTSCGSPNYA 194

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           APE++SG  Y G E DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P    
Sbjct: 195 APEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGIYTLP--KF 250

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILK 283
           +S  A +L+ ++L+V+P  RI   EI++
Sbjct: 251 LSPGAANLIKRMLIVNPLNRITIHEIMQ 278

>ZYRO0A05544g Chr1 (450809..452704) [1896 bp, 631 aa] {ON} highly
           similar to uniprot|P06782 Saccharomyces cerevisiae
           YDR477W SNF1 Protein serine/threonine kinase required
           for release from glucose repression invertase expression
           sporulation and for expression of catabolite- repressed
           genes when glucose is limiting regulates Adr1p-
           dependent transcription primarily at the level of
           chromatin binding
          Length = 631

 Score =  232 bits (592), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 122/276 (44%), Positives = 178/276 (64%), Gaps = 17/276 (6%)

Query: 8   NISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXX 67
           N+   G  IG +++ +TLG GS GKV+LAY+ +T Q+ A+K+I                 
Sbjct: 40  NLLADGSHIGNYQIVKTLGEGSFGKVKLAYHITTGQKVALKIINKKVLAKS--------- 90

Query: 68  TPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLP 127
               +   IEREI  ++LL HP++++LYDV ++ + + MV+EYA   ELF+ +V++  + 
Sbjct: 91  ---DMQGRIEREISYLRLLRHPHIIKLYDVIKSKDEIIMVIEYA-GNELFDYIVQRDKMS 146

Query: 128 ENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLET 187
           E EA RFF+QII  + YCH   IVHRDLKPEN+LLD  LN+KIADFG++ + T+   L+T
Sbjct: 147 EEEARRFFQQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKT 206

Query: 188 SCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE 247
           SCGSP+YAAPE++SG  Y G E DVWS GVIL+ +L  RLPFD+E  +I  L   +  G 
Sbjct: 207 SCGSPNYAAPEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGV 264

Query: 248 FEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILK 283
           + +P    +S+ A  L+ ++L+V+P  RI   EI++
Sbjct: 265 YTLP--KFLSEGAAGLIKRMLIVNPLNRISILEIMQ 298

>SAKL0G06952g Chr7 (570584..572383) [1800 bp, 599 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite-repressed genes when
           glucose is limiting regulates Adr1p-dependent
           transcription primarily at the level of chromatin
           binding
          Length = 599

 Score =  231 bits (590), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 120/268 (44%), Positives = 176/268 (65%), Gaps = 17/268 (6%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           IG +++ +TLG GS GKV+LAY+ +T Q+ A+K+I                     +   
Sbjct: 29  IGKYQIIKTLGEGSFGKVKLAYHITTGQKVALKIINKKVLAKS------------DMQGR 76

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           IEREI  ++LL HP++++LYDV ++ + + MV+EYA   ELF+ +V++  + E+EA RFF
Sbjct: 77  IEREISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMNEDEARRFF 135

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
           +QII  + YCH   IVHRDLKPEN+LLD  LN+KIADFG++ + T+   L+TSCGSP+YA
Sbjct: 136 QQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYA 195

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           APE++SG  Y G E DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P    
Sbjct: 196 APEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPVLFKNISNGVYTLP--KF 251

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILK 283
           +S  A +L+ ++L+V+P  RI   EI++
Sbjct: 252 LSPGASNLIKRMLIVNPLNRITIHEIMQ 279

>KLTH0G05698g Chr7 (453530..455323) [1794 bp, 597 aa] {ON} similar
           to uniprot|P06782 Saccharomyces cerevisiae YDR477W SNF1
           Protein serine/threonine kinase required for release
           from glucose repression invertase expression sporulation
           and for expression of catabolite- repressed genes when
           glucose is limiting regulates Adr1p- dependent
           transcription primarily at the level of chromatin
           binding
          Length = 597

 Score =  229 bits (585), Expect = 7e-64,   Method: Compositional matrix adjust.
 Identities = 120/268 (44%), Positives = 175/268 (65%), Gaps = 17/268 (6%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           IG +++ +TLG GS GKV+LAY+ +T Q+ A+K+I                     +   
Sbjct: 27  IGKYQIIKTLGEGSFGKVKLAYHVTTGQKVALKIINKKVLAKS------------DMQGR 74

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           IEREI  ++LL HP++++LYDV ++ + + MV+EYA   ELF+ +V++  + E EA RFF
Sbjct: 75  IEREISYLRLLRHPHIIKLYDVIKSKDEIVMVIEYA-GNELFDYIVQRDKMSEREARRFF 133

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
           +QII  + YCH   IVHRDLKPEN+LLD  LN+KIADFG++ + T+   L+TSCGSP+YA
Sbjct: 134 QQIISAVEYCHRHKIVHRDLKPENLLLDEHLNVKIADFGLSNIMTDGNFLKTSCGSPNYA 193

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           APE++SG  Y G E DVWS GVIL+ +L  RLPFD+E  +I  L   +  G + +P    
Sbjct: 194 APEVISGKLYAGPEVDVWSSGVILYVMLCRRLPFDDE--SIPILFKNISNGIYTLP--KF 249

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILK 283
           +S  A +L+ ++L+V+P  RI   EI++
Sbjct: 250 LSPGAANLIKRMLIVNPLNRITIHEIME 277

>Kwal_26.8709 s26 (907885..910374) [2490 bp, 829 aa] {ON} YPL141C -
           Hypothetical ORF [contig 67] FULL
          Length = 829

 Score =  210 bits (535), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 118/289 (40%), Positives = 169/289 (58%), Gaps = 26/289 (8%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTN------QQAAIKVIXXXXXXXXXXXXXXXXXT 68
           T GP+ +G TLG G  GKV+L +++++N      +Q AIK+I                  
Sbjct: 36  TFGPYIVGSTLGEGEFGKVKLGWSKTSNSSMDVPKQVAIKLIRRDTIPKNSEKEIK---- 91

Query: 69  PDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPE 128
                  I REI  +K LNHPN++RL +V + +  + +VLEYA  GE +  + +K  L E
Sbjct: 92  -------IYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKE 144

Query: 129 NEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMA-ALETEDKLLET 187
             A R F Q+I G+ Y H+ G+VHRDLK EN+LLD   N+ I DFG       E++L++T
Sbjct: 145 GPACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELMKT 204

Query: 188 SCGSPHYAAPE-IVSGLPYHGLETDVWSCGVILFALLTGRLPFDEE----DG-NIRNLLL 241
           SCGSP YAAPE +V+  PY   + DVWSCGVIL+A+L G LP+D++    DG +I  L  
Sbjct: 205 SCGSPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPDGDDIGKLYR 264

Query: 242 KVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
            + +   + P  D I+   +DLL +IL+ DP++RI   + LKH  LQ +
Sbjct: 265 YITRTPLKFP--DYIAPVPRDLLREILIPDPKRRITISKTLKHQWLQPH 311

>KLTH0D10714g Chr4 (880389..883007) [2619 bp, 872 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 872

 Score =  209 bits (531), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 115/289 (39%), Positives = 168/289 (58%), Gaps = 26/289 (8%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTN------QQAAIKVIXXXXXXXXXXXXXXXXXT 68
           T GP+ +G TLG G  GKV++ ++++++      +Q AIK+I                  
Sbjct: 36  TFGPYIVGSTLGEGEFGKVKMGWSKTSSSSMDVPKQVAIKLIRRDTIPKNSEKEVK---- 91

Query: 69  PDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPE 128
                  I REI  +K LNHPN++RL +V + +  + +VLEYA  GE +  + +K  L E
Sbjct: 92  -------IYREINALKHLNHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKE 144

Query: 129 NEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMA-ALETEDKLLET 187
           + A R F Q+I G+ Y H+ G+VHRDLK EN+LLD   N+ I DFG       E++L++T
Sbjct: 145 SAACRLFAQLISGVYYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFLPENELMKT 204

Query: 188 SCGSPHYAAPE-IVSGLPYHGLETDVWSCGVILFALLTGRLPFDEE----DG-NIRNLLL 241
           SCGSP YAAPE +V+  PY   + D+WSCGVI++A+L G LP+D++    DG +I  L  
Sbjct: 205 SCGSPCYAAPELVVTARPYEARKADIWSCGVIMYAMLAGYLPWDDDPENPDGDDIGKLYR 264

Query: 242 KVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
            + +   + P  D I+   +DLL  ILV DP+KRI   + L H  LQ +
Sbjct: 265 YITRTPLKFP--DYIAPVPRDLLRAILVADPKKRITIAQTLHHQWLQPH 311

>CAGL0M02519g Chr13 complement(290723..292993) [2271 bp, 756 aa]
           {ON} highly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141c or uniprot|Q01919 Saccharomyces
           cerevisiae YOR233w KIN4
          Length = 756

 Score =  205 bits (521), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 119/303 (39%), Positives = 168/303 (55%), Gaps = 40/303 (13%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQA--------------------AIKVIXXXX 54
           T GP+ +G TLG G  GKV+LA+++S  QQ                     AIK+I    
Sbjct: 44  TFGPYVIGATLGEGEFGKVKLAWSKSAYQQCDNTEGNAGNKPMTFKVPKQVAIKLIKRDF 103

Query: 55  XXXXXXXXXXXXXTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKG 114
                                I REI  +K L+HPN+++L +V + +  + +VLEYA  G
Sbjct: 104 ITKDPSKETK-----------IYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYAAGG 152

Query: 115 ELFNLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFG 174
           E +  +  K  L EN A R F Q+I  + Y H+ G+VHRDLK EN+LLD++ N+ I DFG
Sbjct: 153 EFYKFIQRKRRLKENHACRLFSQLISAVHYIHSKGLVHRDLKLENLLLDNEENLIITDFG 212

Query: 175 MA-ALETEDKLLETSCGSPHYAAPE-IVSGLPYHGLETDVWSCGVILFALLTGRLPFDEE 232
                  ++ +++TSCGSP YAAPE +VS  PY   + D WSCG+ILFA+L G LP+D++
Sbjct: 213 FVNEFLRQNGMMKTSCGSPCYAAPELVVSNRPYDARKADTWSCGIILFAMLAGYLPWDDD 272

Query: 233 ----DGN-IRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
               DG+ I  L   +     + P  + I+   +DLL KILV+DP+KRI  R I KHP L
Sbjct: 273 PKNPDGHDISRLYNYILNTPLKFP--EYINPVPRDLLRKILVIDPKKRINIRSIEKHPWL 330

Query: 288 QKY 290
           + +
Sbjct: 331 ESH 333

>TPHA0G01710 Chr7 complement(350452..352869) [2418 bp, 805 aa] {ON}
           Anc_8.654 YPL141C
          Length = 805

 Score =  205 bits (522), Expect = 3e-54,   Method: Compositional matrix adjust.
 Identities = 115/285 (40%), Positives = 164/285 (57%), Gaps = 25/285 (8%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQ-----QAAIKVIXXXXXXXXXXXXXXXXXTP 69
           T GP+ +G TLG G  GKV+L + ++T++     Q AIK+I                   
Sbjct: 36  TFGPYYVGSTLGEGEFGKVKLGWTKTTSKLEMPKQVAIKLIRRDAILNYSEKETK----- 90

Query: 70  DSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPEN 129
                 I REI  +K L HPN+++L +V + +  + +VLE+A  GE +  + +K  L E 
Sbjct: 91  ------IYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEFASGGEFYKYIQKKRRLKET 144

Query: 130 EAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMA-ALETEDKLLETS 188
            A R F Q++ G+ Y H+ G+VHRDLK EN+LLD   N+ I DFG        ++L++TS
Sbjct: 145 PACRLFAQLVSGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFSQRNELMKTS 204

Query: 189 CGSPHYAAPE-IVSGLPYHGLETDVWSCGVILFALLTGRLPFDEE----DG-NIRNLLLK 242
           CGSP YAAPE +V+  PY   + DVWSCG+IL+A+L G LP+D++    DG +I  L L 
Sbjct: 205 CGSPCYAAPELVVTTEPYEARKADVWSCGIILYAMLAGYLPWDDDPQNPDGDDIAKLYLY 264

Query: 243 VQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
           + K   + P  + I+   +DLL KILV DP KR+  R I KH  L
Sbjct: 265 ITKTALKFP--EYINPIQRDLLRKILVSDPTKRLNIRNIEKHEWL 307

>ZYRO0F06842g Chr6 (561269..563800) [2532 bp, 843 aa] {ON} similar
           to Saccharomyces cerevisiae YPL141C and to YOR233W
           uniprot|Q01919 Saccharomyces cerevisiae YOR233W KIN4
           Nonessential protein kinase with unknown cellular role
          Length = 843

 Score =  204 bits (520), Expect = 9e-54,   Method: Compositional matrix adjust.
 Identities = 116/289 (40%), Positives = 170/289 (58%), Gaps = 26/289 (8%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTN------QQAAIKVIXXXXXXXXXXXXXXXXXT 68
           T GP+ +G TLG G  GKV+L ++++ +      +Q AIK+I                  
Sbjct: 35  TFGPYIVGSTLGEGEFGKVKLGWSKAASSSLEVPKQVAIKLIRRDSIPKNSEKEVK---- 90

Query: 69  PDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPE 128
                  I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  +  K  L E
Sbjct: 91  -------IYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQRKRRLKE 143

Query: 129 NEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMA-ALETEDKLLET 187
             A R F Q++ G++Y H+ G+VHRDLK EN+LLD   N+ I DFG      + ++L++T
Sbjct: 144 AIACRLFAQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFVSHNELMKT 203

Query: 188 SCGSPHYAAPE-IVSGLPYHGLETDVWSCGVILFALLTGRLPFDEE----DGN-IRNLLL 241
           SCGSP YAAPE +VS  PY   ++DVWSCGVIL+A+L G LP+D++    DGN I  L  
Sbjct: 204 SCGSPCYAAPELVVSTKPYEARKSDVWSCGVILYAMLAGYLPWDDDPKNPDGNDIVRLYY 263

Query: 242 KVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
            + +   + P  + I+  ++DLL +ILV DP+KRI  R I KH  L+ +
Sbjct: 264 YITRTPLKFP--EYITPLSRDLLRRILVSDPKKRITLRSIHKHEWLKPH 310

>NDAI0E02320 Chr5 (480203..483001) [2799 bp, 932 aa] {ON} 
          Length = 932

 Score =  205 bits (521), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 115/292 (39%), Positives = 164/292 (56%), Gaps = 30/292 (10%)

Query: 16  IGPWKLGETLGLGSTGKVQLAY----------NESTNQQAAIKVIXXXXXXXXXXXXXXX 65
            GP+ +G T+G G  GKV+L +          N   ++Q AIK+I               
Sbjct: 66  FGPYIIGSTIGQGEFGKVKLGWSKNPPSSPPNNLGISKQVAIKLIKRDAISKD------- 118

Query: 66  XXTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGP 125
                S    I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  +  K  
Sbjct: 119 ----SSKELKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYASGGEFYRYIQRKKR 174

Query: 126 LPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMA-ALETEDKL 184
           L E  A R F Q+I G+ Y H+ G+VHRDLK EN+LLD   N+ I DFG      + ++L
Sbjct: 175 LKETAACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFYSHNEL 234

Query: 185 LETSCGSPHYAAPEIV-SGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGN-----IRN 238
           ++TSCGSP YAAPE+V S  PY   + D+WSCG+IL+A+L G LP+D++ GN     I  
Sbjct: 235 MKTSCGSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDSGNPDGDDISR 294

Query: 239 LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
           L   + K   + P  D I+   +DLL KILV DP +RI  ++I KH  L+ +
Sbjct: 295 LYYYITKTPLKFP--DYINPIPRDLLRKILVSDPRRRITMKQIEKHEWLKPH 344

>SAKL0H07084g Chr8 complement(619288..622047) [2760 bp, 919 aa] {ON}
           weakly similar to uniprot|Q03002 Saccharomyces
           cerevisiae YPL141C Hypothetical ORF
          Length = 919

 Score =  204 bits (519), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 112/288 (38%), Positives = 167/288 (57%), Gaps = 25/288 (8%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTN-----QQAAIKVIXXXXXXXXXXXXXXXXXTP 69
           T GP+ +G TLG G  GKV+L ++++T      +Q AIK+I                   
Sbjct: 40  TFGPYIVGSTLGEGEFGKVKLGWSKTTGSNEVPKQVAIKLIRRDTVPKNSDKEVK----- 94

Query: 70  DSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPEN 129
                 I REI  +K L HPN++RL +V + +  + +VLEYA  GE +  + +K  L E+
Sbjct: 95  ------IYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYRYIQKKRRLKEH 148

Query: 130 EAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMA-ALETEDKLLETS 188
            A R F Q+I G+ Y H+ G+VHRDLK EN+LLD   N+ I DFG       +++L++TS
Sbjct: 149 AACRLFAQLISGVHYMHSKGLVHRDLKLENLLLDKNENLLITDFGFVNEFNHKNELMKTS 208

Query: 189 CGSPHYAAPE-IVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGN-----IRNLLLK 242
           CGSP YAAPE +V+  PY   + D+WSCGVI++A+L G LP+D++  N     I  L   
Sbjct: 209 CGSPCYAAPELVVTTKPYEARKADIWSCGVIMYAMLAGYLPWDDDSENPEGDDIAKLYHY 268

Query: 243 VQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
           + K   + P  + I+   +DLL +ILV +P+KR+  R++ +H  LQ +
Sbjct: 269 ITKTPLKFP--EYINPVPRDLLRRILVSNPKKRLNLRQVEQHQWLQPH 314

>KNAG0J01590 Chr10 (292565..294982) [2418 bp, 805 aa] {ON} Anc_8.654
           YPL141C
          Length = 805

 Score =  202 bits (514), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 121/332 (36%), Positives = 177/332 (53%), Gaps = 51/332 (15%)

Query: 11  VKGDTIGPWKLGETLGLGSTGKVQLAYNESTN--------QQAAIKVIXXXXXXXXXXXX 62
            K  + GP+ +G TLG G  GKV++ +             +Q AIK+I            
Sbjct: 34  AKCPSFGPYLIGSTLGQGGFGKVKMGWTTPMGNKGIYDVPKQVAIKLIKR---------- 83

Query: 63  XXXXXTPDSLS------YGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGEL 116
                  DS+S        I REI  +K L+HPN+++L +V + +  + +VLEYA  GE 
Sbjct: 84  -------DSISNDKSKEVKIYREINALKQLHHPNIVKLEEVLQNSKYIGIVLEYASGGEF 136

Query: 117 FNLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMA 176
           +  + ++  L E+ A R F Q+I G+ Y H+ G+VHRDLK EN+LLD   N+ I DFG  
Sbjct: 137 YKYIQKRRVLKEHVACRLFAQLISGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFV 196

Query: 177 -ALETEDKLLETSCGSPHYAAPEIV-SGLPYHGLETDVWSCGVILFALLTGRLPFDEEDG 234
               ++++L+ TSCGSP YAAPE+V S  PY G   D+WSCG+ILFA+L G LP+D++  
Sbjct: 197 NEYFSQNELMTTSCGSPCYAAPELVISTQPYQGRRADLWSCGIILFAMLAGYLPWDDDKD 256

Query: 235 N-----IRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
           N     I  L   +     + P  + I+   +DLL +ILV DP +R+  REI  H  L+K
Sbjct: 257 NPDGEDIAKLYYYITHTALKFP--EYITPIPRDLLRRILVADPRRRVTLREIQGHQWLKK 314

Query: 290 YPS-----------IKDSKTIRNLPREDTYLN 310
           +             I  SK I  LP+ + + +
Sbjct: 315 HAQFLSIQPEEWDRISQSKNITRLPKHNKHYS 346

>TDEL0A06000 Chr1 (1053427..1055799) [2373 bp, 790 aa] {ON}
           Anc_8.654 YPL141C
          Length = 790

 Score =  201 bits (510), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 114/282 (40%), Positives = 163/282 (57%), Gaps = 25/282 (8%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTN-----QQAAIKVIXXXXXXXXXXXXXXXXXTP 69
           T GP+ LG TLG G  G+V+L ++++T+     +Q AIK+I                   
Sbjct: 40  TFGPYILGSTLGEGEFGRVKLGWSKNTSPNEVSKQVAIKLIRRDTIPKNSDKEIK----- 94

Query: 70  DSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPEN 129
                 I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + +K  L E 
Sbjct: 95  ------IYREINALKHLSHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEA 148

Query: 130 EAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMA-ALETEDKLLETS 188
            A R F Q+I G+ Y H+ G+VHRDLK EN+LLD   N+ I DFG         +L++TS
Sbjct: 149 VACRLFAQLISGVQYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFAHSELMKTS 208

Query: 189 CGSPHYAAPE-IVSGLPYHGLETDVWSCGVILFALLTGRLPFDEE----DGN-IRNLLLK 242
           CGSP YAAPE +VS  PY   + D+WSCGVIL+A+L G LP+D++    DGN I  L   
Sbjct: 209 CGSPCYAAPELVVSSKPYEARKADIWSCGVILYAMLAGYLPWDDDTKNPDGNDIGKLYQY 268

Query: 243 VQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKH 284
           + +   + P  + I+   +DLL +IL  DP++RI  R I KH
Sbjct: 269 ITRTPLKFP--EYITPLPRDLLRRILYPDPKRRISMRSIQKH 308

>NDAI0J01250 Chr10 complement(291314..294844) [3531 bp, 1176 aa]
           {ON} 
          Length = 1176

 Score =  203 bits (517), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 112/310 (36%), Positives = 173/310 (55%), Gaps = 25/310 (8%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           ++G W   ET+G GS GKV+LA N  T +  AIK++                   + +  
Sbjct: 93  SLGEWDFIETVGAGSMGKVKLARNRQTREVCAIKIVNRATKIFLTKESKLMSHPTNHIIM 152

Query: 75  G----------IEREII----------IMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKG 114
                      +E+EI           + ++L HP++ RL++++  +N+ YM+ EY   G
Sbjct: 153 NEKDILDRQKRLEKEISRDRRTIREASLGQILYHPHICRLFEMYTLSNHFYMLFEYVSGG 212

Query: 115 ELFNLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFG 174
           +L + +++ G L E+ A  F RQI+  + Y HA  IVHRDLK ENI++    NIKI DFG
Sbjct: 213 QLLDYIIQHGSLKESHARNFARQILSALKYLHANNIVHRDLKIENIMISSNGNIKIIDFG 272

Query: 175 MAALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDG 234
           ++ L  + K L+T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ 
Sbjct: 273 LSNLYDKSKKLKTYCGSLYFAAPELLRANPYIGPEIDVWSFGVVLYVLVCGKVPFDDENS 332

Query: 235 NIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK-YPSI 293
           N+  L  K+++G    P    +S E   LL  +LVVDP KR    +++KH  + K Y SI
Sbjct: 333 NV--LHEKIKQGRVFYP--QFLSIEVISLLSTMLVVDPFKRATLDQVMKHHWMVKDYDSI 388

Query: 294 KDSKTIRNLP 303
            D+   + +P
Sbjct: 389 PDAHLPKRVP 398

>Kpol_1072.29 s1072 complement(61987..64668) [2682 bp, 893 aa] {ON}
           complement(61987..64668) [2682 nt, 894 aa]
          Length = 893

 Score =  201 bits (511), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 110/289 (38%), Positives = 162/289 (56%), Gaps = 26/289 (8%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAY------NESTNQQAAIKVIXXXXXXXXXXXXXXXXXT 68
           T GP+ +G TLG G  GKV+L +      N+  ++Q AIK+I                  
Sbjct: 40  TFGPYYIGSTLGEGEFGKVKLGWTRNPTSNQEVSKQVAIKLIRRDKIVKNSEKEIK---- 95

Query: 69  PDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPE 128
                  I REI  +K L HPN+++L +V + +  + +VLEYA  GE +  +  K  L E
Sbjct: 96  -------IFREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYRYIQRKRRLKE 148

Query: 129 NEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMA-ALETEDKLLET 187
               R F Q++ G++Y H+ G+VHRDLK EN+LLD   N+ I DFG       ++ L++T
Sbjct: 149 TAGCRLFTQLVSGVNYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFLKDNDLMKT 208

Query: 188 SCGSPHYAAPEIV-SGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGN-----IRNLLL 241
           SCGSP YAAPE+V S  PY   + D+WSCG+IL+A+L G LP+D++  N     I  L  
Sbjct: 209 SCGSPCYAAPELVISTKPYEARKADIWSCGIILYAMLAGYLPWDDDPQNPEGDDIARLYY 268

Query: 242 KVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
            + +   + P  + IS   +DLL ++LV DP KR+  R+I +H  L+ +
Sbjct: 269 FITRTSLKFP--EYISPIPRDLLRRLLVSDPRKRLNIRQIQQHEWLRPH 315

>Suva_16.169 Chr16 complement(292738..295314) [2577 bp, 858 aa] {ON}
           YPL141C (REAL)
          Length = 858

 Score =  200 bits (509), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 117/296 (39%), Positives = 166/296 (56%), Gaps = 30/296 (10%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAY-----NESTN-----QQAAIKVIXXXXXXXXXXXXXX 64
           T GP+ LG TLG G  GKV+L +     N ST+     +Q A+K+I              
Sbjct: 37  TFGPYILGSTLGEGEFGKVKLGWPKNFPNSSTSAFDFPKQVAVKLIKRDTISNDYKKEVK 96

Query: 65  XXXTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKG 124
                      I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + +K 
Sbjct: 97  -----------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKR 145

Query: 125 PLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMA-ALETEDK 183
            L E  A R F Q+I G+ Y H+ G+VHRDLK EN+LLD   N+ I DFG      + ++
Sbjct: 146 RLKETNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNE 205

Query: 184 LLETSCGSPHYAAPE-IVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGN-----IR 237
           L++TSCGSP YAAPE +VS  PY   + D+WSCGVIL+A+L G LP+D++  N     I 
Sbjct: 206 LMKTSCGSPCYAAPELVVSTKPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSDIG 265

Query: 238 NLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSI 293
            L   +     + P  D I    +DLL +ILV DP++RI  ++I KH  L+ + S 
Sbjct: 266 RLYNYICSTPLKFP--DYILPIPRDLLRRILVSDPKRRINLKQIEKHGWLKSHSSF 319

>TPHA0J00820 Chr10 (193408..197064) [3657 bp, 1218 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1218

 Score =  202 bits (514), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 105/291 (36%), Positives = 164/291 (56%), Gaps = 22/291 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           ++G W   ET+G GS GKV+LA +  TN+  AIK++                  P S   
Sbjct: 150 SLGDWDFLETVGAGSMGKVKLARHHKTNEVCAIKIV--NRATKSFLQKEASLPPPKSEEE 207

Query: 75  GIE----------------REIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFN 118
            +E                RE  + ++L HP++ RL+++   +N+ YM+ EY   G+L +
Sbjct: 208 ALERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEICTMSNHFYMLFEYVSGGQLLD 267

Query: 119 LLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL 178
            +++ G L E+ A +F R I   + Y H   IVHRDLK ENI++    +IKI DFG++ L
Sbjct: 268 YIIQHGSLREHHARKFTRGIASALQYLHGNNIVHRDLKIENIMISTSGDIKIIDFGLSNL 327

Query: 179 ETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRN 238
               K L T CGS ++AAPE++   PY G E D+WS GV+L+ L  G++PFD+E+ ++  
Sbjct: 328 YDSKKQLNTFCGSLYFAAPELLKANPYVGPEVDIWSFGVVLYVLACGKVPFDDENSSV-- 385

Query: 239 LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
           L  K+++G+ + P    +S E   LL K+LVVDP+KR   ++I+ HP + +
Sbjct: 386 LHEKIKQGKVDYP--QHLSIEVISLLSKMLVVDPKKRASLQQIVNHPWMTR 434

>TBLA0B03970 Chr2 complement(904167..907793) [3627 bp, 1208 aa] {ON}
           Anc_8.654 YPL141C
          Length = 1208

 Score =  201 bits (512), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 122/305 (40%), Positives = 171/305 (56%), Gaps = 38/305 (12%)

Query: 2   ISSNKGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTN------QQAAIKVIXXXXX 55
           I  NKGN   K  T GP+ +G TLG G  GKV+L + +++       +Q AIK+I     
Sbjct: 55  IPENKGNGRRKHITFGPYIVGSTLGEGEFGKVKLGWVKASPNDTQVPKQVAIKLIRR--- 111

Query: 56  XXXXXXXXXXXXTPDSLSYGIEREIII------MKLLNHPNVLRLYDVWETNNNLYMVLE 109
                         D++  G E+EI I      +K L HPN++RL +V + +  + +VLE
Sbjct: 112 --------------DAIVKGSEKEIKIYREINALKHLTHPNIVRLEEVLQNSKYIGIVLE 157

Query: 110 YAEKGELFNLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIK 169
           YA  GE +  + +K  L E+ A   F Q++ G+ Y H  G+VHRDLK EN+LLD   N+ 
Sbjct: 158 YASGGEFYKYIQKKRRLKESVASNLFSQLVSGVYYMHCKGLVHRDLKLENLLLDKYGNLI 217

Query: 170 IADFGMA-ALETEDKLLETSCGSPHYAAPEIV-SGLPYHGLETDVWSCGVILFALLTGRL 227
           I DFG         +L++TSCGSP YAAPE+V S  PY   + D+WSCG+ILFA+L G L
Sbjct: 218 ITDFGFVNEFSKFSELMKTSCGSPCYAAPELVISTRPYEARKADIWSCGIILFAMLAGYL 277

Query: 228 PFDEE----DGN-IRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREIL 282
           P+D++    DGN I  L   +     + P  + IS  A+DLL  IL+  P+KR   ++IL
Sbjct: 278 PWDDDPKNPDGNDIAKLYKYITTTPLKFP--EYISPMARDLLRNILIPYPQKRATLKQIL 335

Query: 283 KHPLL 287
           KH  L
Sbjct: 336 KHQWL 340

>KAFR0H02540 Chr8 complement(483399..485852) [2454 bp, 817 aa] {ON}
           Anc_8.654 YPL141C
          Length = 817

 Score =  199 bits (505), Expect = 5e-52,   Method: Compositional matrix adjust.
 Identities = 125/350 (35%), Positives = 184/350 (52%), Gaps = 60/350 (17%)

Query: 3   SSNKGNISVKGD----TIGPWKLGETLGLGSTGKVQLAYNESTN---------------- 42
           SSNK +I+ K      T GP+ +G T+G G  GKV+L +++S +                
Sbjct: 41  SSNKKDINPKQKRRYVTFGPYIIGSTIGQGEFGKVKLGWSKSISNKQSHSPSANGLGLYA 100

Query: 43  ---------QQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREIIIMKLLNHPNVLR 93
                    +Q AIK+I                         I REI  +K L HPN+++
Sbjct: 101 TPALPIEVPKQVAIKLIRRDTISKDPRREIK-----------IYREINALKQLTHPNIVK 149

Query: 94  LYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHR 153
           L +V + +  + +VLEYA  GE +  +  K  L E  A + F Q+I G++Y H+ G++HR
Sbjct: 150 LDEVLQNSKYIGIVLEYASGGEFYKYIQRKKRLKETIACKLFAQLISGVNYIHSKGLIHR 209

Query: 154 DLKPENILLDHKLNIKIADFGMA-ALETEDKLLETSCGSPHYAAPEIV-SGLPYHGLETD 211
           DLK ENILLD   N+ I DFG      T ++L++TSCGSP YAAPE+V S  PY   + D
Sbjct: 210 DLKLENILLDKNENLIITDFGFVNEFVTSNELMKTSCGSPCYAAPELVISSQPYEARKVD 269

Query: 212 VWSCGVILFALLTGRLPFDEE-----DGNIRNLLLKVQKGEFEMPGDDEISKEAQDLLYK 266
           +WSCG+ILFA+L G LP+D++       NI  L   +     + P  + I+   +DLL +
Sbjct: 270 IWSCGIILFAMLAGYLPWDDDPENPSGENIAKLYFYITTTPLKFP--EYITAIPRDLLRR 327

Query: 267 ILVVDPEKRIKSREILKH-------PLL----QKYPSIKDSKTIRNLPRE 305
           IL+ DP+KR+  R ILKH       P L    +++ +I  S++I  LP+ 
Sbjct: 328 ILIADPKKRVDLRYILKHQWLKPHTPFLSISPEEWDNISRSQSILRLPKH 377

>YPL141C Chr16 complement(283464..286061) [2598 bp, 865 aa] {ON}
           FRK1Protein kinase of unknown cellular role; similar to
           Kin4p; green fluorescent protein (GFP)-fusion protein
           localizes to the cytoplasm; interacts with rRNA
           transcription and ribosome biogenesis factors and the
           long chain fatty acyl-CoA synthetase Faa3
          Length = 865

 Score =  199 bits (506), Expect = 6e-52,   Method: Compositional matrix adjust.
 Identities = 120/302 (39%), Positives = 170/302 (56%), Gaps = 42/302 (13%)

Query: 15  TIGPWKLGETLGLGSTGKVQLA----YNESTN------QQAAIKVIXXXXXXXXXXXXXX 64
           T GP+ LG TLG G  GKV+L     ++ S+N      +Q AIK+I              
Sbjct: 37  TFGPYILGSTLGEGEFGKVKLGWPKNFSNSSNSTFDFPKQVAIKLIKR------------ 84

Query: 65  XXXTPDSLS------YGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFN 118
                DS+S        I REI  +K L+HPN+++L +V + +  + +VLEYA  GE + 
Sbjct: 85  -----DSISNDYRKEVKIYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYK 139

Query: 119 LLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMA-A 177
            + +K  L E  A R F Q+I G+ Y H+ G+VHRDLK EN+LLD   N+ I DFG    
Sbjct: 140 YIQKKRRLKEMNACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNE 199

Query: 178 LETEDKLLETSCGSPHYAAPEIV-SGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGN- 235
             + ++L++TSCGSP YAAPE+V S  PY   + D+WSCGVIL+A+L G LP+D++  N 
Sbjct: 200 FCSRNELMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAILAGYLPWDDDPNNP 259

Query: 236 ----IRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYP 291
               I  L   +     + P  D I    +DLL ++LV DP+KRI  ++I KH  L+ + 
Sbjct: 260 EGSDIGRLYNYINSTPLKFP--DYILPIPRDLLRRMLVSDPKKRINLKQIKKHEWLKPHS 317

Query: 292 SI 293
           S 
Sbjct: 318 SF 319

>KAFR0A03730 Chr1 (761946..764312) [2367 bp, 788 aa] {ON} Anc_8.654
           YPL141C
          Length = 788

 Score =  198 bits (503), Expect = 8e-52,   Method: Compositional matrix adjust.
 Identities = 117/291 (40%), Positives = 163/291 (56%), Gaps = 25/291 (8%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAY---NESTN--QQAAIKVIXXXXXXXXXXXXXXXXXTP 69
           T GP+ +G TLG G  GKV+L +   NEST+  +Q AIK+I                   
Sbjct: 30  TFGPYIVGSTLGKGEFGKVKLGWSRKNESTDISKQVAIKLIRRDSILQDREKEIK----- 84

Query: 70  DSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPEN 129
                 I REI  +K L HPN++RL +V + +  + +VLEYA  GE +  + +K  L E 
Sbjct: 85  ------IYREINALKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYIQKKRRLKEP 138

Query: 130 EAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMA-ALETEDKLLETS 188
            A + F Q++ G+ Y H+ G+VHRDLK EN+LLD   N+ I DFG        ++L++TS
Sbjct: 139 IACKLFAQLVSGVYYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFLQNNELMKTS 198

Query: 189 CGSPHYAAPE-IVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRN-----LLLK 242
           CGSP YAAPE +V+  PY   + DVWSCG+ILFA+L G LP+D++  N R      L   
Sbjct: 199 CGSPCYAAPELVVTSNPYKARKADVWSCGIILFAMLAGYLPWDDDPDNPRGDDIAKLYNY 258

Query: 243 VQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSI 293
           +     + P    IS   +DLL KILV +P +R+  REI  H  L+ + S 
Sbjct: 259 ITTSPLKFPS--YISAIPRDLLRKILVANPNQRLSLREIETHQWLKPHSSF 307

>NCAS0C01590 Chr3 (293327..295921) [2595 bp, 864 aa] {ON} Anc_8.654
          Length = 864

 Score =  198 bits (503), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 115/296 (38%), Positives = 165/296 (55%), Gaps = 30/296 (10%)

Query: 12  KGDTIGPWKLGETLGLGSTGKVQLAYNEST----------NQQAAIKVIXXXXXXXXXXX 61
           K  T GP+ +G TLG G  GKV+L + +++           +Q AIK+I           
Sbjct: 41  KHVTFGPYIIGSTLGEGEFGKVKLGWPKNSLPSSSSGIDVPKQVAIKLIRRDTISKD--- 97

Query: 62  XXXXXXTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLV 121
                    S    I REI  +K L HPN+++L +V + +  + +VLEYA  GE +  + 
Sbjct: 98  --------SSKEIKIYREINALKHLTHPNIVKLEEVLQNSKYIGIVLEYASGGEFYKYIQ 149

Query: 122 EKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAA-LET 180
            K  L E  A R F Q+I G+ Y H+ G+VHRDLK EN+LLD   N+ I DFG  +   +
Sbjct: 150 RKKRLKEGPACRLFAQLINGVHYIHSKGLVHRDLKLENLLLDKHENLIITDFGFVSEFYS 209

Query: 181 EDKLLETSCGSPHYAAPE-IVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGN---- 235
             +L++TSCGSP YAAPE +VS  PY   + D+WSCGVIL+A+L G LP+D++ GN    
Sbjct: 210 HGELMKTSCGSPCYAAPELVVSTKPYEAKKADIWSCGVILYAMLAGYLPWDDDAGNPDGD 269

Query: 236 -IRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
            I  L   + +   + P  D I+   +DLL +IL+ DP +RI  + I KH  L+ +
Sbjct: 270 DISRLYHYITQTPLKFP--DYINPIPRDLLRRILISDPRRRITIKYIEKHEWLKPH 323

>Ecym_4291 Chr4 complement(620549..623986) [3438 bp, 1145 aa] {ON}
           similar to Ashbya gossypii AGR058W
          Length = 1145

 Score =  199 bits (507), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 103/291 (35%), Positives = 162/291 (55%), Gaps = 20/291 (6%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           ++G W   ET+G GS GKV+LA +  TN+  AIK++                  P +   
Sbjct: 111 SLGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRATKSFIHKQQQQQLPPPSNEEE 170

Query: 75  GIE----------------REIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFN 118
            +E                RE  + ++L HP++ RL+++   +N+ YM+ EY   G+L +
Sbjct: 171 LMERRKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 230

Query: 119 LLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL 178
            +++ G L E  A +F R I   + Y H   IVHRDLK ENI++     I+I DFG++ L
Sbjct: 231 YIIQHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISSSGEIRIIDFGLSNL 290

Query: 179 ETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRN 238
               K L T CGS ++AAPE++   PY G E D+WS GV+L+ L+ G++PFD+E+ ++  
Sbjct: 291 YDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASV-- 348

Query: 239 LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
           L  K+++G+ E P    +S +   LL K+LVVDP KR   ++++ H  +QK
Sbjct: 349 LHEKIKQGKVEYP--QHLSIDVISLLSKMLVVDPLKRATLKQVVNHQWMQK 397

>Smik_4.367 Chr4 (655941..659141) [3201 bp, 1066 aa] {ON} YDR122W
           (REAL)
          Length = 1066

 Score =  199 bits (506), Expect = 2e-51,   Method: Compositional matrix adjust.
 Identities = 103/286 (36%), Positives = 165/286 (57%), Gaps = 22/286 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           ++G W+  ET+G GS GKV+LA +  TN+  A+K++                  P +   
Sbjct: 114 SLGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLP--PPKNEQD 171

Query: 75  GIER----------------EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFN 118
            +ER                E  + ++L HP++ RL+++   +N+ YM+ EY   G+L +
Sbjct: 172 VLERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLD 231

Query: 119 LLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL 178
            +++ G + E++A +F R I   + Y HA  IVHRDLK ENI++     IKI DFG++ L
Sbjct: 232 YIIQHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNL 291

Query: 179 ETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRN 238
               K L T CGS ++AAPE++   PY G E DVWS GV+LF L+ G++PFD+E+ ++  
Sbjct: 292 YDSRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV-- 349

Query: 239 LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKH 284
           L  K+++G+ E P    +S E   LL K+LVVDP++R   +++++H
Sbjct: 350 LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 393

>CAGL0J03872g Chr10 (368472..370457) [1986 bp, 661 aa] {ON} similar
           to uniprot|Q01919 Saccharomyces cerevisiae YOR233w KIN4
           ser/thr protein kinase or and similar to uniprot|Q03002
           Saccharomyces cerevisiae YPL141c
          Length = 661

 Score =  194 bits (492), Expect = 3e-51,   Method: Compositional matrix adjust.
 Identities = 112/293 (38%), Positives = 161/293 (54%), Gaps = 30/293 (10%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNE----------STNQQAAIKVIXXXXXXXXXXXXXX 64
           T GP+ +G TLG G  GKV+L +            + ++Q AIK+I              
Sbjct: 40  TFGPYIVGSTLGEGEFGKVKLGWTRTPSTGPEQRPAVSKQVAIKLIRRDTIVKNSEKEIK 99

Query: 65  XXXTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKG 124
                      I REI  +K L HPNV+RL +V + +  + +VLEYA  GE +  +  K 
Sbjct: 100 -----------IYREINALKHLTHPNVVRLEEVLQNSKYIGIVLEYASGGEFYKYIQRKR 148

Query: 125 PLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMA-ALETEDK 183
            L E+ A R F Q+I G++Y H+  +VHRDLK EN+LLD   N+ I DFG       +++
Sbjct: 149 RLKESTACRLFAQLISGVTYMHSKNLVHRDLKLENLLLDKNENLVITDFGFVNEFLPDNE 208

Query: 184 LLETSCGSPHYAAPEIV-SGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGN-----IR 237
            ++TSCGSP YAAPE+V S  PY   + DVWSCG+IL+A+L G LP+D++  N     I 
Sbjct: 209 YMKTSCGSPCYAAPELVISTRPYVARKADVWSCGIILYAMLAGYLPWDDDSTNPEGDDIG 268

Query: 238 NLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
            L   + +   + P  + I+   +DLL KILV DP KR+  + I +H  L+ +
Sbjct: 269 KLYQYITRTPLKFP--EYITPIPRDLLRKILVPDPNKRVNMQYIHRHEWLKPH 319

>AGR058W Chr7 (823626..826841) [3216 bp, 1071 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YLR096W (KIN2) and
           YDR122W (KIN1)
          Length = 1071

 Score =  198 bits (504), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 102/291 (35%), Positives = 162/291 (55%), Gaps = 20/291 (6%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           ++G W   ET+G GS GKV+LA +  TN+  AIK++                  P +   
Sbjct: 50  SLGDWDFLETVGAGSMGKVKLAKHRYTNELCAIKIVNRATKSFMHKQQLQGLPPPATEEE 109

Query: 75  GIE----------------REIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFN 118
            +E                RE  + ++L HP++ RL+++   +N+ YM+ EY   G+L +
Sbjct: 110 LLERRKKLEKEVSRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 169

Query: 119 LLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL 178
            +++ G L E  A +F R I   + Y H   IVHRDLK ENI++     I+I DFG++ +
Sbjct: 170 YIIQHGSLRERHARKFARGIASALQYLHLNNIVHRDLKIENIMISSSGEIRIIDFGLSNM 229

Query: 179 ETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRN 238
               K L T CGS ++AAPE++   PY G E D+WS GV+L+ L+ G++PFD+E+ ++  
Sbjct: 230 YDPKKQLHTFCGSLYFAAPELLKAHPYTGPEVDIWSFGVVLYVLVCGKVPFDDENASV-- 287

Query: 239 LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
           L  K+++G+ E P    +S +   LL K+LVVDP KR   ++++ H  +QK
Sbjct: 288 LHEKIKQGKVEYP--QHLSIDVISLLSKMLVVDPYKRATLKQVVHHQWMQK 336

>KNAG0G02110 Chr7 (477260..480838) [3579 bp, 1192 aa] {ON} Anc_8.279
           YLR096W
          Length = 1192

 Score =  199 bits (505), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 109/306 (35%), Positives = 170/306 (55%), Gaps = 23/306 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
            +G W   ET+G GS GKV+LA +  TN+  AIK++                  P S   
Sbjct: 105 ALGDWDFLETVGAGSMGKVKLAKHHHTNEICAIKIVNRATKAFLHKEQNLP--PPKSEQE 162

Query: 75  GIER----------------EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFN 118
            ++R                E  + ++L HP++ RL+++   +N+ YM+ EY   G+L +
Sbjct: 163 ILQRQKRLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 222

Query: 119 LLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL 178
            +++ G L E+ A +F R I   + Y HA  IVHRDLK ENI++     IKI DFG++ +
Sbjct: 223 YIIQHGSLREHHARKFARGIGSALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNV 282

Query: 179 ETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRN 238
               K L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E  ++  
Sbjct: 283 YDPRKQLHTFCGSLYFAAPELLKARPYLGPEVDVWSFGVVLYVLVCGKVPFDDEVSSV-- 340

Query: 239 LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK-YPSIKDSK 297
           L  K+++G  E P  + +S E   LL K+LVVDPE+R   +++++HP + + Y  I  S 
Sbjct: 341 LHEKIKQGNVEYP--NHLSIEVLSLLSKMLVVDPERRASLKQVIEHPWMNRGYDYITPSY 398

Query: 298 TIRNLP 303
             + +P
Sbjct: 399 LPKRIP 404

>Kpol_1012.6 s1012 (11581..13467) [1887 bp, 628 aa] {ON}
           (11581..13467) [1887 nt, 629 aa]
          Length = 628

 Score =  193 bits (490), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 114/294 (38%), Positives = 164/294 (55%), Gaps = 28/294 (9%)

Query: 12  KGDTIGPWKLGETLGLGSTGKVQLAYNE--------STNQQAAIKVIXXXXXXXXXXXXX 63
           K  T GP+ LG T+G G  GKV+  ++         +  +Q AIK+I             
Sbjct: 48  KQPTFGPYYLGSTIGEGEFGKVKSGWSRKPQNDNGLTIGKQVAIKLIRRDTLAEKKDQEL 107

Query: 64  XXXXTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEK 123
                       + REI  +KLL+HPN+++L DV + +  + +VLEYA  GE +  L  K
Sbjct: 108 K-----------VYREINALKLLSHPNIVKLEDVLQNSKYIGIVLEYASGGEFYKYLQRK 156

Query: 124 GPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMA-ALETED 182
             L E  A   F Q+I G++Y H+ G+VHRDLK EN+LLD   N+ I DFG    + T +
Sbjct: 157 KRLKEPLACSTFAQLISGVAYIHSKGLVHRDLKLENLLLDKHSNLVITDFGFVNEISTNN 216

Query: 183 KLLETSCGSPHYAAPEIV-SGLPYHGLETDVWSCGVILFALLTGRLPFDEE----DG-NI 236
           KL++T CGSP YAAPE+V S  PY   + D+WS GVIL+A+L G LP+D++    DG NI
Sbjct: 217 KLMKTPCGSPCYAAPELVLSTKPYDARKADIWSAGVILYAMLAGYLPWDDDPENPDGSNI 276

Query: 237 RNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
             L   + K   + P  D I   A+DL+ KILV+ P+ R+   ++ +H  L+ +
Sbjct: 277 MRLYEYITKNNLKFP--DYIEPLARDLIRKILVIQPKSRLNIVQVQQHEWLKPH 328

>Skud_16.140 Chr16 complement(255090..257687) [2598 bp, 865 aa] {ON}
           YPL141C (REAL)
          Length = 865

 Score =  197 bits (500), Expect = 4e-51,   Method: Compositional matrix adjust.
 Identities = 114/293 (38%), Positives = 162/293 (55%), Gaps = 30/293 (10%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAY-----NESTN-----QQAAIKVIXXXXXXXXXXXXXX 64
           T GP+ LG TLG G  GKV+L +     N S       +Q A+K+I              
Sbjct: 37  TFGPYILGSTLGEGEFGKVKLGWPKNFSNSSATTFEFPKQVAVKLIKRDTISNNYKKEVK 96

Query: 65  XXXTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKG 124
                      I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + +K 
Sbjct: 97  -----------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYKYIQKKR 145

Query: 125 PLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMA-ALETEDK 183
            L E  A R F Q++ G+ Y H+ G+VHRDLK EN+LLD   N+ I DFG      + ++
Sbjct: 146 RLKETNACRLFSQLVSGVYYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNE 205

Query: 184 LLETSCGSPHYAAPEIV-SGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGN-----IR 237
           L++TSCGSP YAAPE+V S  PY   + D+WSCGVIL+A+L G LP+D++  N     I 
Sbjct: 206 LMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDSNNPEGSDIG 265

Query: 238 NLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
            L   +     + P  D I    +DLL +ILV DP+KR+  ++I KH  L  +
Sbjct: 266 RLYNYINSTPLKFP--DYILPIPRDLLRRILVPDPKKRMNLKQIKKHEWLNSH 316

>NCAS0B03740 Chr2 complement(668231..671380) [3150 bp, 1049 aa] {ON}
           Anc_8.279
          Length = 1049

 Score =  197 bits (502), Expect = 5e-51,   Method: Compositional matrix adjust.
 Identities = 108/289 (37%), Positives = 161/289 (55%), Gaps = 23/289 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXX---XXXXXXXXXXXXTPDS 71
           ++G W   ET+G GS GKV+LA N  TN+  AIK++                     P S
Sbjct: 67  SLGDWDFVETVGAGSMGKVKLAKNRRTNEVCAIKIVNRATKIFLSKEYAAKHNGYTIPLS 126

Query: 72  LSYGIER----------------EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGE 115
               IER                E  + ++L HP++ RLY++   +N+ YM+ EY   G+
Sbjct: 127 EKEVIERQKNLEKEASRDKRTVREASLGQILYHPHICRLYEMHTLSNHFYMLFEYVSGGQ 186

Query: 116 LFNLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGM 175
           L + +++ G L E+ A  F RQI   + Y H+  IVHRDLK ENI++    NIK+ DFG+
Sbjct: 187 LLDYIIQHGSLKESRARTFTRQICSALKYLHSHNIVHRDLKIENIMISKDGNIKLIDFGL 246

Query: 176 AALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGN 235
           + L  +   L+T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ N
Sbjct: 247 SNLYDKCNKLKTYCGSLYFAAPELLKATPYIGPEIDVWSFGVVLYVLVCGKVPFDDENSN 306

Query: 236 IRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKH 284
           +  L  K+++G+   P    +S E   LL K+LVVDP KR    +++ H
Sbjct: 307 V--LHEKIKQGKVFYP--QFLSIEVISLLSKMLVVDPFKRATLDQVMNH 351

>SAKL0H16632g Chr8 complement(1461613..1464801) [3189 bp, 1062 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1062

 Score =  197 bits (502), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 104/291 (35%), Positives = 162/291 (55%), Gaps = 22/291 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           ++G W   ET+G GS GKV+LA +  T++  AIK++                  P S   
Sbjct: 75  SLGDWDFLETVGAGSMGKVKLARHRYTSEICAIKIVNRAAKSFVHKQQQMT--PPKSEQE 132

Query: 75  GIER----------------EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFN 118
            +ER                E  + ++L HP++ RL+++   +N+ YM+ EY   G+L +
Sbjct: 133 ALERKRKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 192

Query: 119 LLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL 178
            +++ G L E  A +F R I   + Y H   IVHRDLK ENI++     IKI DFG++ +
Sbjct: 193 YIIQHGSLRERHARKFARGIASALQYLHMNNIVHRDLKIENIMISTSGEIKIIDFGLSNM 252

Query: 179 ETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRN 238
               K L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ ++  
Sbjct: 253 YDPKKQLHTFCGSLYFAAPELLKAHPYIGPEVDVWSFGVVLYVLVCGKVPFDDENASV-- 310

Query: 239 LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
           L  K+++G+ E P    +S E   LL K+LVVDP KR   ++++ H  +Q+
Sbjct: 311 LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPSKRATLKQVVSHQWMQR 359

>Suva_2.283 Chr2 (489490..492759) [3270 bp, 1089 aa] {ON} YDR122W
           (REAL)
          Length = 1089

 Score =  197 bits (502), Expect = 7e-51,   Method: Compositional matrix adjust.
 Identities = 103/286 (36%), Positives = 165/286 (57%), Gaps = 22/286 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           ++G W+  ET+G GS GKV+LA +  TN+  A+K++                  P +   
Sbjct: 127 SLGDWEFVETVGAGSMGKVKLAKHHYTNEVCAVKIVNRATKAFLHKEQMLP--PPKNEQD 184

Query: 75  GIER----------------EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFN 118
            +ER                E  + ++L HP++ RL+++   +N+ YM+ EY   G+L +
Sbjct: 185 VLERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLD 244

Query: 119 LLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL 178
            +++ G + E++A +F R I   + Y HA  IVHRDLK ENI++     IKI DFG++ L
Sbjct: 245 YIIQHGSIREHQARKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNL 304

Query: 179 ETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRN 238
               K L T CGS ++AAPE++   PY G E DVWS GV+LF L+ G++PFD+E+ ++  
Sbjct: 305 YDSRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV-- 362

Query: 239 LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKH 284
           L  K+++G+ E P    +S E   LL K+LVVDP++R   +++++H
Sbjct: 363 LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 406

>NDAI0B02070 Chr2 (514024..517800) [3777 bp, 1258 aa] {ON} 
          Length = 1258

 Score =  197 bits (502), Expect = 9e-51,   Method: Compositional matrix adjust.
 Identities = 101/289 (34%), Positives = 163/289 (56%), Gaps = 18/289 (6%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPD---- 70
           ++G W   ET+G GS GKV+LA +  T +  AIK++                   +    
Sbjct: 160 SLGDWDFLETVGAGSMGKVKLAKHHQTQEICAIKIVNRATKAFLHKEQSMPPPKNEQEIA 219

Query: 71  ----------SLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLL 120
                     S      RE  + ++L HP++ RL+++   +N+ YM+ EY   G+L + +
Sbjct: 220 ERQKRLEKEISRDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 279

Query: 121 VEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALET 180
           ++ G L E+ A +F R I   + Y H   IVHRDLK ENI++ +   IKI DFG++ +  
Sbjct: 280 IQHGSLREHHARKFARGIASALQYLHLNNIVHRDLKIENIMISNSGEIKIIDFGLSNVFD 339

Query: 181 EDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLL 240
             K L T CGS ++AAPE++   PY G E DVWS G++L+ L+ G++PFD+E+ ++  L 
Sbjct: 340 NRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGIVLYVLVCGKVPFDDENSSV--LH 397

Query: 241 LKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
            K+++G+ E P  + +S E   LL K++VVDP KR   R++++HP + +
Sbjct: 398 EKIRQGKVEYP--NHLSIEVISLLSKMIVVDPAKRASLRQVVEHPWMTR 444

>CAGL0M11396g Chr13 (1122109..1125687) [3579 bp, 1192 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096w KIN2 ser/thr protein kinase
          Length = 1192

 Score =  197 bits (501), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 102/289 (35%), Positives = 163/289 (56%), Gaps = 18/289 (6%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDS--- 71
           ++G W   ET+G GS GKV+LA +  T +  AIK++                   +    
Sbjct: 104 SLGDWDFLETVGAGSMGKVKLAKHRRTGEVCAIKIVNRATKAFLHKEQNSPPPVNNQEIM 163

Query: 72  -----LSYGIER------EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLL 120
                L   I R      E  + ++  HP++ RL+++   +N+ YM+ EY   G+L + +
Sbjct: 164 ERQKKLEKEISRDKRAIREASLGQIFYHPHICRLFEMCTMSNHFYMLFEYVAGGQLLDYI 223

Query: 121 VEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALET 180
           ++ G L E+ A +F R +   + Y HA  IVHRDLK ENI++ +   IKI DFG++ +  
Sbjct: 224 IQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNVYD 283

Query: 181 EDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLL 240
             K L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 284 TRKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LH 341

Query: 241 LKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
            K+++G+ E P    +S E   LL K+LVVDP +R   +++++HP + K
Sbjct: 342 EKIKRGKVEYP--QHLSIEVMSLLSKMLVVDPSRRASLKQVVEHPWMTK 388

>NDAI0E01290 Chr5 complement(255593..257782) [2190 bp, 729 aa] {ON}
           Anc_8.654
          Length = 729

 Score =  193 bits (491), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 113/293 (38%), Positives = 160/293 (54%), Gaps = 28/293 (9%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYN--------ESTNQQAAIKVIXXXXXXXXXXXXXXXXX 67
            G + LG TLG G  GKV+L ++        +S ++Q AIK+I                 
Sbjct: 43  FGNYILGATLGEGEFGKVKLGWSTASPTASLDSNSKQIAIKLIRRDYVKKGSDKEIK--- 99

Query: 68  TPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLP 127
                   I REI  +KLL HPN++RL +V + +  + +VLE+A  GE +  L  K  L 
Sbjct: 100 --------IYREINALKLLTHPNIVRLEEVLQNSKYIGIVLEFASGGEFYKYLQRKRRLK 151

Query: 128 ENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMA-ALETEDKLLE 186
           E  A + F Q+I G++Y H+ G+VHRDLK EN+LLD   N+ I DFG        ++L++
Sbjct: 152 EPHACQLFAQLISGVTYMHSKGLVHRDLKLENLLLDKNENLIITDFGFVNEFFGSNELMK 211

Query: 187 TSCGSPHYAAPEIV-SGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGN-----IRNLL 240
            SCGSP YAAPE+V S  PY   + D+WSCG+IL+A+L G LP+D++  N     I  L 
Sbjct: 212 RSCGSPCYAAPELVLSTEPYRARKVDIWSCGIILYAMLAGYLPWDDDSQNPNGDDIGKLY 271

Query: 241 LKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSI 293
             + K   + P    IS  A+DL+ KIL  +P +RI    I KH  L+ + S 
Sbjct: 272 QYITKTALKFPA--YISPLARDLIRKILTANPSRRISISYICKHDWLKPHASF 322

>Smik_15.417 Chr15 (725513..727933) [2421 bp, 806 aa] {ON} YOR233W
           (REAL)
          Length = 806

 Score =  194 bits (493), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 110/291 (37%), Positives = 162/291 (55%), Gaps = 25/291 (8%)

Query: 12  KGDTIGPWKLGETLGLGSTGKVQLAYNESTN-----QQAAIKVIXXXXXXXXXXXXXXXX 66
           K  T GP+ +G TLG G  GKV+L + ++++     +Q AIK+I                
Sbjct: 39  KHATFGPYIIGSTLGEGEFGKVKLGWTKASSPTEVPKQVAIKLIRRDTIKKDADKEVK-- 96

Query: 67  XTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPL 126
                    I REI  +K L HPN++ L +V + +  + +VLE+   GE +  +  K  L
Sbjct: 97  ---------IYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRL 147

Query: 127 PENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMA-ALETEDKLL 185
            E+ A R F Q+I G++Y H  G+VHRDLK EN+LLD   N+ I DFG       +++L+
Sbjct: 148 KESSACRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFKDNELM 207

Query: 186 ETSCGSPHYAAPE-IVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGN-----IRNL 239
            TSCGSP YAAPE +VS  PY   + DVWSCGVIL+A+L G LP+D++  N     I  L
Sbjct: 208 NTSCGSPCYAAPELVVSTKPYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARL 267

Query: 240 LLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
              + +   + P  + I+   +DLL +ILV +P +R+  R I +H  L+ +
Sbjct: 268 YQYITQTPLKFP--EYITPVPRDLLRRILVPNPRRRVSLRSIERHEWLKPH 316

>Ecym_8339 Chr8 (684113..686875) [2763 bp, 920 aa] {ON} similar to
           Ashbya gossypii ACR119W
          Length = 920

 Score =  195 bits (496), Expect = 1e-50,   Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 158/286 (55%), Gaps = 23/286 (8%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQA----AIKVIXXXXXXXXXXXXXXXXXTPD 70
           T GP+ +G TLG G  GKV+L ++ S  ++     AIK++                    
Sbjct: 61  TFGPYIVGPTLGEGEFGKVKLGWSNSKPEEGSKNVAIKLVRRDTIPKHSEKEVK------ 114

Query: 71  SLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENE 130
                I REI  +K LNHPN++RL +V + +  + +VL+YA  GE +  + +K  L E  
Sbjct: 115 -----IYREINALKHLNHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPP 169

Query: 131 AIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCG 190
           A R F Q+I G+ Y H  G+ HRDLK EN+LLD   N+ I DFG      ++ L++TSCG
Sbjct: 170 ACRLFAQLISGVYYMHHKGLAHRDLKLENLLLDEHENLMITDFGFVNEFHKNDLMKTSCG 229

Query: 191 SPHYAAPE-IVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGN-----IRNLLLKVQ 244
           SP YAAPE +V+  PY   + DVWSCGVIL+A+L G LP+D++  N     I  L   + 
Sbjct: 230 SPCYAAPELVVTARPYEARKADVWSCGVILYAMLAGYLPWDDDPENPEGDDIAKLYHYIT 289

Query: 245 KGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
           K   + P  + I    +DLL +ILV +P+ R+   EI  H  L+ +
Sbjct: 290 KSALKFP--EYIKPLPRDLLRRILVSNPDTRLSVMEIKNHEWLRPH 333

>Skud_4.383 Chr4 (666354..669551) [3198 bp, 1065 aa] {ON} YDR122W
           (REAL)
          Length = 1065

 Score =  196 bits (498), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 103/286 (36%), Positives = 165/286 (57%), Gaps = 22/286 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           ++G W+  ET+G GS GKV+LA +  TN+  A+K++                  P +   
Sbjct: 114 SLGDWEFIETVGAGSMGKVKLARHRRTNEVCAVKIVNRATKAFLHKEQMLP--PPKNEQD 171

Query: 75  GIER----------------EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFN 118
            +ER                E  + ++L HP++ RL+++   +N+ YM+ EY   G+L +
Sbjct: 172 VLERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLD 231

Query: 119 LLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL 178
            +++ G + E++A +F R I   + Y HA  IVHRDLK ENI++     IKI DFG++ L
Sbjct: 232 YIIQHGSIREHQAKKFARGIASALMYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNL 291

Query: 179 ETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRN 238
               K L T CGS ++AAPE++   PY G E DVWS GV+LF L+ G++PFD+E+ ++  
Sbjct: 292 YDSRKQLYTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV-- 349

Query: 239 LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKH 284
           L  K+++G+ E P    +S E   LL K+LVVDP++R   +++++H
Sbjct: 350 LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 393

>NCAS0B01470 Chr2 (241003..243186) [2184 bp, 727 aa] {ON} Anc_8.654
          Length = 727

 Score =  193 bits (490), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 112/297 (37%), Positives = 165/297 (55%), Gaps = 41/297 (13%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNEST---------NQQAAIKVIXXXXXXXXXXXXXXXX 66
            GP+ +G TLG G  GKV++ ++ ++         ++Q AIK+I                
Sbjct: 35  FGPYIVGATLGEGEFGKVKMGWSTTSSSSGKITEDSKQVAIKLIRR-------------- 80

Query: 67  XTPDSLSYGIEREIII------MKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLL 120
              D +  G E+E+ I      +K L HPN++RL +V + +  + +VLEYA  GE +  +
Sbjct: 81  ---DFIKKGSEKEMKIFREINSLKHLTHPNIVRLEEVLQNSKYIGIVLEYASGGEFYKYV 137

Query: 121 VEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMA-ALE 179
             K  L E  A R F Q+I G+SY H+ GIVHRDLK EN+LLD   N+ I DFG      
Sbjct: 138 QRKRRLKEATACRLFAQLISGVSYMHSKGIVHRDLKLENLLLDKHENLIITDFGFVNEFY 197

Query: 180 TEDKLLETSCGSPHYAAPEIV-SGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGN--- 235
            +++L++TSCGSP YAAPE+V +  PY   + D+WSCG+IL+ +L G LP+D++  N   
Sbjct: 198 ADNELMKTSCGSPCYAAPELVITTEPYKARKADIWSCGIILYGMLAGYLPWDDDKQNPNG 257

Query: 236 --IRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
             I  L   + K   + P  + I+   +DLL  ILV +P +R+ SR I KH  L  +
Sbjct: 258 EDIVRLYHYITKTPLKFP--EYITPLPRDLLRHILVSNPVRRMSSRHIKKHEWLSPH 312

>YDR122W Chr4 (694700..697894) [3195 bp, 1064 aa] {ON}
           KIN1Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1064

 Score =  196 bits (498), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 102/286 (35%), Positives = 165/286 (57%), Gaps = 22/286 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           ++G W+  ET+G GS GKV+LA +  TN+  A+K++                  P +   
Sbjct: 116 SLGDWEFVETVGAGSMGKVKLAKHRYTNEVCAVKIVNRATKAFLHKEQMLP--PPKNEQD 173

Query: 75  GIER----------------EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFN 118
            +ER                E  + ++L HP++ RL+++   +N+ YM+ EY   G+L +
Sbjct: 174 VLERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTLSNHFYMLFEYVSGGQLLD 233

Query: 119 LLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL 178
            +++ G + E++A +F R I   + Y HA  IVHRDLK ENI++     IKI DFG++ +
Sbjct: 234 YIIQHGSIREHQARKFARGIASALIYLHANNIVHRDLKIENIMISDSSEIKIIDFGLSNI 293

Query: 179 ETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRN 238
               K L T CGS ++AAPE++   PY G E DVWS GV+LF L+ G++PFD+E+ ++  
Sbjct: 294 YDSRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLFVLVCGKVPFDDENSSV-- 351

Query: 239 LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKH 284
           L  K+++G+ E P    +S E   LL K+LVVDP++R   +++++H
Sbjct: 352 LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPKRRATLKQVVEH 395

>Smik_6.339 Chr6 (538177..540774) [2598 bp, 865 aa] {ON} YPL141C
           (REAL)
          Length = 865

 Score =  194 bits (494), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 114/293 (38%), Positives = 165/293 (56%), Gaps = 30/293 (10%)

Query: 15  TIGPWKLGETLGLGSTGKVQL----AYNESTN------QQAAIKVIXXXXXXXXXXXXXX 64
           T GP+ LG TLG G  GKV+L    ++  S+N      +Q A+K+I              
Sbjct: 37  TFGPYILGSTLGEGEFGKVKLGWPKSFPSSSNATLEFPKQVAVKLIKRDTISNDYKKEVK 96

Query: 65  XXXTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKG 124
                      I REI  +K L+HPN+++L +V + +  + +VLEYA  GE +  + ++ 
Sbjct: 97  -----------IYREINALKHLSHPNIVKLEEVLQNSRYIGIVLEYACGGEFYRYIQKRR 145

Query: 125 PLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMA-ALETEDK 183
            L E  A R F Q+I G+ Y H+ G+VHRDLK EN+LLD   N+ I DFG      + ++
Sbjct: 146 RLKEINACRLFSQLISGVHYIHSKGLVHRDLKLENLLLDKNENLVITDFGFVNEFCSRNE 205

Query: 184 LLETSCGSPHYAAPEIV-SGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGN-----IR 237
           L++TSCGSP YAAPE+V S  PY   + D+WSCGVIL+A+L G LP+D++  N     I 
Sbjct: 206 LMKTSCGSPCYAAPELVISAEPYEARKADIWSCGVILYAMLAGYLPWDDDPNNPEGSDIG 265

Query: 238 NLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
            L   +     + P  D I    +DLL +ILV DP++RI  ++I KH  L+ +
Sbjct: 266 RLYNYISLTPLKFP--DYILPIPRDLLRRILVSDPKRRINLKQIKKHEWLKPH 316

>Kpol_1066.46 s1066 (82874..86551) [3678 bp, 1225 aa] {ON}
           (82874..86551) [3678 nt, 1226 aa]
          Length = 1225

 Score =  196 bits (499), Expect = 2e-50,   Method: Compositional matrix adjust.
 Identities = 104/284 (36%), Positives = 161/284 (56%), Gaps = 18/284 (6%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPD---- 70
           ++G W   ET+G GS GKV+LA +  TN+  AIK++                   D    
Sbjct: 141 SLGDWNFLETVGAGSMGKVKLAKHHRTNEICAIKIVNRATKAFLHKEQSLPAPANDQEIM 200

Query: 71  ----SLSYGIE------REIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLL 120
               +L   I       RE  + ++L HP++ RL+++   +N+ YM+ EY   G+L + +
Sbjct: 201 ERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 260

Query: 121 VEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALET 180
           ++ G L E+ A RF R I   + Y HA  IVHRDLK ENI++     IK+ DFG++ L  
Sbjct: 261 IQHGSLREHHARRFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKLIDFGLSNLYD 320

Query: 181 EDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLL 240
             K L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 321 NRKQLHTFCGSLYFAAPELLKANPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LH 378

Query: 241 LKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKH 284
            K+++G+ E      +S E   LL K+LVVDP++R   ++++ H
Sbjct: 379 EKIKQGKVEY--SQHLSIEVISLLSKMLVVDPKRRASLKQVVDH 420

>TBLA0C04600 Chr3 (1112043..1115990) [3948 bp, 1315 aa] {ON}
           Anc_8.279 YLR096W
          Length = 1315

 Score =  196 bits (498), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 104/286 (36%), Positives = 163/286 (56%), Gaps = 22/286 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           ++G W   ET+G GS GKV+LA +  TN+  AIKV+                  P +   
Sbjct: 179 SLGDWDFLETVGAGSMGKVKLAKHHYTNEICAIKVVNRATKGFLHKEQTLP--PPQTEQE 236

Query: 75  GIER----------------EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFN 118
            +ER                E  + ++L HP++ RL+++   +N+ YM+ EY   G+L +
Sbjct: 237 ILERQKNLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 296

Query: 119 LLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL 178
            +++ G L E+ A +F R I   + Y H+  IVHRDLK ENI++     IKI DFG++ L
Sbjct: 297 YIIQHGSLREHHARKFARGIASALQYLHSNNIVHRDLKIENIMISTSGEIKIIDFGLSNL 356

Query: 179 ETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRN 238
               + L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ ++  
Sbjct: 357 YDTTRQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV-- 414

Query: 239 LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKH 284
           L  K+++G+ + P    +S E   LL K+LVVDP+KR   R++++H
Sbjct: 415 LHEKIKQGKVDYP--QHLSIEVISLLSKMLVVDPKKRATLRQVVEH 458

>NCAS0B05090 Chr2 (946126..949758) [3633 bp, 1210 aa] {ON} 
          Length = 1210

 Score =  196 bits (497), Expect = 3e-50,   Method: Compositional matrix adjust.
 Identities = 104/296 (35%), Positives = 167/296 (56%), Gaps = 25/296 (8%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           ++G W   ET+G GS GKV+LA +  T +  AIK++                  P +   
Sbjct: 158 SLGDWDFLETVGAGSMGKVKLARHHQTKEICAIKIVNRAMKAFLHKEQSMP--PPRTEQE 215

Query: 75  GIER----------------EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFN 118
            +ER                E  + ++L HP++ RL+++   +N+ YM+ EY   G+L +
Sbjct: 216 VLERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 275

Query: 119 LLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL 178
            +++ G L E+ A +F R I   + Y HA  IVHRDLK ENI++     IKI DFG++ +
Sbjct: 276 YIIQHGSLREHHARKFARGIASALEYIHANNIVHRDLKIENIMISTSGEIKIIDFGLSNV 335

Query: 179 ETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRN 238
               K L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ ++  
Sbjct: 336 FDRKKQLHTFCGSLYFAAPELLKAHPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV-- 393

Query: 239 LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK---YP 291
           L  K+++G+ + P  + +S E   LL K+LVVDP +R   +++++HP + +   YP
Sbjct: 394 LHEKIKQGKVDYP--NHLSIEVISLLSKMLVVDPLRRASLKQVVEHPWMTRGYDYP 447

>TPHA0D01140 Chr4 (238656..240524) [1869 bp, 622 aa] {ON} Anc_8.654
           YPL141C
          Length = 622

 Score =  190 bits (482), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 113/303 (37%), Positives = 167/303 (55%), Gaps = 50/303 (16%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTN------------------QQAAIKVIXXXXXXX 57
            G + LG+TLG G  GKV+L Y  + N                  +Q AIK+I       
Sbjct: 56  FGLYTLGQTLGEGEFGKVKLGYINNDNIDTLNSSGSKLGNYSHMPKQVAIKLIRR----- 110

Query: 58  XXXXXXXXXXTPDSLSYGIE------REIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYA 111
                       D+LS   E      REI  +K+L HPN+++L +V + +  + +VLEYA
Sbjct: 111 ------------DTLSASKESEIKLYREINALKMLTHPNIVKLEEVLQNSKYIGIVLEYA 158

Query: 112 EKGELFNLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIA 171
             GE +  +  K  L E++A   F Q+I G+SY H+ G+VHRDLK EN+LLD   N+ I 
Sbjct: 159 SGGEFYKYIKFKKRLKESKACTIFAQLISGVSYIHSKGLVHRDLKLENLLLDKAGNLLIT 218

Query: 172 DFGMAALETE-DKLLETSCGSPHYAAPEIVSGL-PYHGLETDVWSCGVILFALLTGRLPF 229
           DFG     T+ +KL+ T CGSP YAAPE+V+ + PY+  + D+WSCGVIL+A+L G LP+
Sbjct: 219 DFGFVNEVTKTNKLMHTPCGSPCYAAPELVTSVEPYNARKADIWSCGVILYAMLAGYLPW 278

Query: 230 DEEDGNIRN-----LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKH 284
           D++  NI       L   ++    + P  + I+   +DLL ++L +DP KR+  + IL+H
Sbjct: 279 DDDPKNINGTDIVKLYKYIENQPLKFP--EYINMVPRDLLRRMLEIDPAKRMSMKHILQH 336

Query: 285 PLL 287
             +
Sbjct: 337 AWI 339

>KAFR0B02800 Chr2 (571295..574582) [3288 bp, 1095 aa] {ON} Anc_8.279
           YLR096W
          Length = 1095

 Score =  195 bits (495), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 103/289 (35%), Positives = 165/289 (57%), Gaps = 22/289 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           ++G W   ET+G GS GKV+LA +  TN+  AIK++                  P + + 
Sbjct: 97  SLGDWDFLETVGAGSMGKVKLARHHQTNEICAIKIVNRATKAYLHKEQSLA--PPKNENE 154

Query: 75  GIER----------------EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFN 118
            +ER                E  + ++L HP++ RL+++   +N+ YM+ EY   G+L +
Sbjct: 155 MLERQKKLEKEISRDKRTIREASLGQVLYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 214

Query: 119 LLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL 178
            +++ G L E+ A +F R +   + Y HA  IVHRDLK ENI++     IKI DFG++ +
Sbjct: 215 YIIQHGSLREHHARKFARGVASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNV 274

Query: 179 ETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRN 238
               K L T CGS ++AAPE++   PY G E D+WS GV+L+ L+ G++PFD+E+ ++  
Sbjct: 275 FDTRKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVLYVLVCGKVPFDDENSSV-- 332

Query: 239 LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
           L  K+++G+ E P  + +S E   LL K+LVVDP KR    ++++HP +
Sbjct: 333 LHEKIKQGKVEYP--NHLSIEVISLLSKMLVVDPLKRANLTKVIEHPWM 379

>KLLA0F19536g Chr6 (1808263..1811577) [3315 bp, 1104 aa] {ON}
           similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1104

 Score =  194 bits (493), Expect = 8e-50,   Method: Compositional matrix adjust.
 Identities = 104/291 (35%), Positives = 161/291 (55%), Gaps = 22/291 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           ++G W   ET+G GS GKV+LA +  TN+  AIK++                  P +   
Sbjct: 94  SLGDWDFLETVGAGSMGKVKLAKHRLTNEVCAIKIVNRAAKSYMHKQNQLP--PPKTEEE 151

Query: 75  GIER----------------EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFN 118
            +ER                E  + ++L HP++ RL+++   +N+ YM+ EY   G+L +
Sbjct: 152 LMERKKKLEKELSRDRRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 211

Query: 119 LLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL 178
            +++ G L E  A +F R I   + Y H   IVHRDLK ENI++     IKI DFG++ L
Sbjct: 212 YIIQHGSLRERHARKFVRGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLSNL 271

Query: 179 ETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRN 238
               K L T CGS ++AAPE++   PY G E D+WS GV+++ L+ G++PFD+E+ ++  
Sbjct: 272 YDNKKQLHTFCGSLYFAAPELLKANPYIGPEVDIWSFGVVIYVLVCGKVPFDDENASV-- 329

Query: 239 LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
           L  K++KG+ E P    +S E   LL K+LVVDP KR   +++  H  +Q+
Sbjct: 330 LHEKIKKGKVEYP--QHLSIECISLLSKMLVVDPLKRASLKQVCNHQWMQR 378

>TDEL0F04060 Chr6 (749896..753276) [3381 bp, 1126 aa] {ON} Anc_8.279
           YLR096W
          Length = 1126

 Score =  194 bits (492), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 102/284 (35%), Positives = 160/284 (56%), Gaps = 18/284 (6%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPD---- 70
           ++G W   ET+G GS GKV+LA +  T +  AIK++                   +    
Sbjct: 74  SLGEWDFLETVGAGSMGKVKLAKHRYTKEVCAIKIVNRATNAFLHKEQSLPPPKKEEEIL 133

Query: 71  ----------SLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLL 120
                     S      RE  + ++L HP++ RL+++   +N+ YM+ EY   G+L + +
Sbjct: 134 ERQKKLEKEISRDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLDYI 193

Query: 121 VEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALET 180
           ++ G L E+ A +F R I   + Y HA  IVHRDLK ENI++     IKI DFG++ L  
Sbjct: 194 IQHGSLREHHARKFTRGIASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNLFD 253

Query: 181 EDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLL 240
           + K L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ ++  L 
Sbjct: 254 KSKQLHTFCGSLYFAAPELLKASPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV--LH 311

Query: 241 LKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKH 284
            K+++G+ E P    +S E   LL K+LVVDP +R   +++++H
Sbjct: 312 EKIKQGKVEYP--QHLSIEVISLLSKMLVVDPHRRASLKQVVEH 353

>Skud_15.399 Chr15 (714789..717212) [2424 bp, 807 aa] {ON} YOR233W
           (REAL)
          Length = 807

 Score =  191 bits (486), Expect = 1e-49,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 160/291 (54%), Gaps = 25/291 (8%)

Query: 12  KGDTIGPWKLGETLGLGSTGKVQLAYNESTN-----QQAAIKVIXXXXXXXXXXXXXXXX 66
           K  T GP+ +G TLG G  GKV+L + ++ +     +Q AIK+I                
Sbjct: 39  KHATFGPYIVGSTLGEGEFGKVKLGWTKAFSPNEVPKQVAIKLIRRDSIKKDADKEVK-- 96

Query: 67  XTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPL 126
                    I REI  +K L HPN++ L +V + +  + +VLE+   GE +  +  K  L
Sbjct: 97  ---------IYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRL 147

Query: 127 PENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETED-KLL 185
            E+ A R F Q+I G+ Y H+ G+VHRDLK EN+LLD   N+ I DFG      ED +L+
Sbjct: 148 KESSACRLFAQLISGVDYMHSKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNELM 207

Query: 186 ETSCGSPHYAAPE-IVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGN-----IRNL 239
            TSCGSP YAAPE +VS   Y   + DVWSCGVIL+A+L G LP+D++  N     I  L
Sbjct: 208 RTSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARL 267

Query: 240 LLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
              + +   + P  + I+   +DLL +ILV +P +R+  R I +H  L+ +
Sbjct: 268 YQYITQTPLKFP--EYITPVPRDLLRRILVPNPRRRVSVRAIQRHEWLKPH 316

>KLTH0G13288g Chr7 complement(1139058..1142486) [3429 bp, 1142 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1142

 Score =  193 bits (491), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 104/291 (35%), Positives = 162/291 (55%), Gaps = 22/291 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           ++G W   ET+G GS GKV+LA +  T++  AIK++                  P +   
Sbjct: 180 SLGDWDFLETVGAGSMGKVKLAKHRLTHEVCAIKIVNRATKALIHKESQQP--PPRTQEE 237

Query: 75  GIEREIIIMK----------------LLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFN 118
            +ERE  + K                +L HP++ RL+++   +N+ YM+ EY   G+L +
Sbjct: 238 VLERERKLEKEISRDKRTIRESSLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 297

Query: 119 LLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL 178
            +++ G L E  A +F R I   + Y H   IVHRDLK ENI++     IKI DFG++ +
Sbjct: 298 YIIQHGSLRERSARKFARGIASALQYLHLNNIVHRDLKIENIMISTSGEIKIIDFGLSNM 357

Query: 179 ETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRN 238
               K L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ ++  
Sbjct: 358 FNPKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLYVLVCGKVPFDDENSSV-- 415

Query: 239 LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
           L  K+++G+ E P    +S E   LL K+LVVDP KR   ++++ H  +Q+
Sbjct: 416 LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPSKRATLKQVVNHQWMQR 464

>Suva_8.284 Chr8 (514891..517317) [2427 bp, 808 aa] {ON} YOR233W
           (REAL)
          Length = 808

 Score =  191 bits (485), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 110/291 (37%), Positives = 162/291 (55%), Gaps = 25/291 (8%)

Query: 12  KGDTIGPWKLGETLGLGSTGKVQLAYNESTN-----QQAAIKVIXXXXXXXXXXXXXXXX 66
           K  T GP+ +G TLG G  GKV+L ++++++     +Q AIK+I                
Sbjct: 39  KHATFGPYIVGSTLGEGEFGKVKLGWSKASSPNEVPKQVAIKLIRRDTIKKDADKEVK-- 96

Query: 67  XTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPL 126
                    I REI  +K L HPN++ L +V + +  + +VLE+   GE +  +  K  L
Sbjct: 97  ---------IYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRL 147

Query: 127 PENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETED-KLL 185
            E+ A R F Q+I G++Y H  G+VHRDLK EN+L+D   N+ I DFG      ED +L+
Sbjct: 148 KESSACRLFAQLISGVNYMHTKGLVHRDLKLENLLMDKHENLVITDFGFVNEFFEDNELM 207

Query: 186 ETSCGSPHYAAPE-IVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGN-----IRNL 239
            TSCGSP YAAPE +VS   Y   + DVWSCGVIL+A+L G LP+D++  N     I  L
Sbjct: 208 RTSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARL 267

Query: 240 LLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
              + +   + P  + I+   +DLL +ILV +P +R+  R I +H  L+ +
Sbjct: 268 YQYITQTPLKFP--EYITPIPRDLLRRILVPNPRRRVSLRAIQRHEWLKPH 316

>ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL141C and YOR233W
           (KIN4)
          Length = 931

 Score =  192 bits (487), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 159/286 (55%), Gaps = 23/286 (8%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNEST----NQQAAIKVIXXXXXXXXXXXXXXXXXTPD 70
           T GP+ +G TLG G  GKV+L ++++     ++  AIK+I                    
Sbjct: 41  TFGPYIIGPTLGEGEFGKVKLGWSKARLDGDSRNVAIKLIRRDTVPKNSEKEIK------ 94

Query: 71  SLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENE 130
                I RE+  +KLL+HPN++RL +V + +  + +VL+YA  GE +  + +K  L E  
Sbjct: 95  -----IYRELNALKLLSHPNIVRLEEVLQNSKYIGIVLQYASGGEFYKYIQKKRRLKEPP 149

Query: 131 AIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCG 190
           A R F Q+I G+ Y H  G+ HRDLK EN+LLD   N+ I DFG      ++ L+ TSCG
Sbjct: 150 ACRLFAQLISGVHYIHYKGLAHRDLKLENLLLDEHENLIITDFGFVNEFHKNDLMRTSCG 209

Query: 191 SPHYAAPE-IVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGN-----IRNLLLKVQ 244
           SP YAAPE +VS  PY   + DVWSCGVIL+A+L G LP+D++  N     I  L   + 
Sbjct: 210 SPCYAAPELVVSSKPYSAQKADVWSCGVILYAMLAGYLPWDDDPENPEGEDIAKLYQYIT 269

Query: 245 KGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
               + P  + I    +DLL +ILV +PE R+   +I +H  LQ +
Sbjct: 270 HTSLKFP--EYIKPIPRDLLKRILVSNPEVRLTVADIEQHAWLQPH 313

>Skud_12.164 Chr12 (315700..319182) [3483 bp, 1160 aa] {ON} YLR096W
           (REAL)
          Length = 1160

 Score =  193 bits (490), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 164/291 (56%), Gaps = 22/291 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           ++G W+  ET+G GS GKV+L  +  T +   IK++                 +P + + 
Sbjct: 102 SLGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRASKAYLHKQHTLP--SPKNENE 159

Query: 75  GIER----------------EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFN 118
            +ER                E  + ++L HP++ RL+++   +N+ YM+ EY   G+L +
Sbjct: 160 ILERQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 219

Query: 119 LLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL 178
            +++ G L E+ A +F R I   + Y HA  IVHRDLK ENI++     IKI DFG++ +
Sbjct: 220 YIIQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNI 279

Query: 179 ETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRN 238
               K L T CGS ++AAPE++   PY G E D+WS G++L+ L+ G++PFD+E+ +I  
Sbjct: 280 FDYRKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI-- 337

Query: 239 LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
           L  K++KG+ + P    +S EA  LL +++V+DP KR   + ++ HP + +
Sbjct: 338 LHEKIKKGKVDYPS--HLSIEAISLLTRMIVIDPLKRATLKNVVDHPWMNR 386

>CAGL0B01925g Chr2 (176316..179150) [2835 bp, 944 aa] {ON} similar
           to uniprot|P13185 Saccharomyces cerevisiae YDR122w KIN1
           or uniprot|P13186 Saccharomyces cerevisiae YLR096w KIN2
          Length = 944

 Score =  192 bits (487), Expect = 2e-49,   Method: Compositional matrix adjust.
 Identities = 106/289 (36%), Positives = 163/289 (56%), Gaps = 18/289 (6%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDS--- 71
           ++  W   ET+G GS GKV+LA N+++N+  AIK++                   ++   
Sbjct: 63  SLSGWDFMETVGAGSMGKVKLAKNKNSNEVCAIKIVHRATKAYMHKAQQLPPPADENEAK 122

Query: 72  -----LSYGIER------EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLL 120
                L+  I R      E  + ++L HPNV +LY++   +N+ YM  E+   G+L + +
Sbjct: 123 ERQKRLNKEISRDKRTVREASLGQILFHPNVCKLYEMQTLSNHYYMFFEFISGGQLLDYI 182

Query: 121 VEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALET 180
           ++ G L EN A +  R I+  + Y HA  IVHRDLK ENI+L     IK+ DFG++ +  
Sbjct: 183 IQHGSLKENHARKVSRGILSALQYLHANNIVHRDLKIENIMLSKTGEIKLIDFGLSNMYD 242

Query: 181 EDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLL 240
             K L+T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E  N   L 
Sbjct: 243 PRKSLQTFCGSLYFAAPELLKAHPYLGPEVDVWSFGVVLYVLVCGKVPFDDE--NSSALH 300

Query: 241 LKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
            K++KG+   P    +S +   LL KILVVDP+KR   ++++ H  + K
Sbjct: 301 EKIKKGKVTYP--QFLSIDVISLLSKILVVDPQKRATLQQVVNHQWMLK 347

>YLR096W Chr12 (332590..336033) [3444 bp, 1147 aa] {ON}
           KIN2Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin1p
          Length = 1147

 Score =  192 bits (488), Expect = 4e-49,   Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 164/291 (56%), Gaps = 22/291 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           ++G W+  ET+G GS GKV+L  +  T +   IK++                 +P + S 
Sbjct: 95  SLGDWEFLETVGAGSMGKVKLVKHRQTKEICVIKIVNRASKAYLHKQHSLP--SPKNESE 152

Query: 75  GIER----------------EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFN 118
            +ER                E  + ++L HP++ RL+++   +N+ YM+ EY   G+L +
Sbjct: 153 ILERQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 212

Query: 119 LLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL 178
            +++ G L E+ A +F R I   + Y HA  IVHRDLK ENI++     IKI DFG++ +
Sbjct: 213 YIIQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISSSGEIKIIDFGLSNI 272

Query: 179 ETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRN 238
               K L T CGS ++AAPE++   PY G E D+WS G++L+ L+ G++PFD+E+ +I  
Sbjct: 273 FDYRKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI-- 330

Query: 239 LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
           L  K++KG+ + P    +S E   LL +++VVDP +R   + +++HP + +
Sbjct: 331 LHEKIKKGKVDYPS--HLSIEVISLLTRMIVVDPLRRATLKNVVEHPWMNR 379

>Smik_12.155 Chr12 (312480..315968) [3489 bp, 1162 aa] {ON} YLR096W
           (REAL)
          Length = 1162

 Score =  192 bits (487), Expect = 5e-49,   Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 164/291 (56%), Gaps = 22/291 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           ++G W+  ET+G GS GKV+L  +  T +   IK++                 +P + + 
Sbjct: 103 SLGDWEFLETVGAGSMGKVKLVKHRQTKEVCVIKIVNRASKAYLHKQHSLP--SPKNENE 160

Query: 75  GIER----------------EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFN 118
            +ER                E  + ++L HP++ RL+++   +N+ YM+ EY   G+L +
Sbjct: 161 VLERQKRLEKEIARDKRTIREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 220

Query: 119 LLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL 178
            +++ G L E+ A +F R I   + Y H+  IVHRDLK ENI++     IKI DFG++ +
Sbjct: 221 YIIQHGSLKEHHARKFARGIASALQYLHSNNIVHRDLKIENIMISSSGEIKIIDFGLSNI 280

Query: 179 ETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRN 238
               K L T CGS ++AAPE++   PY G E D+WS G++L+ L+ G++PFD+E+ +I  
Sbjct: 281 FDYRKQLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI-- 338

Query: 239 LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
           L  K++KG+ + P    +S EA  LL K++VVDP +R   + ++ HP + +
Sbjct: 339 LHEKIKKGKVDYPS--HLSIEAISLLTKMIVVDPLRRATLKTVVDHPWMNR 387

>ZYRO0D06776g Chr4 complement(583027..586641) [3615 bp, 1204 aa]
           {ON} similar to uniprot|P13186 Saccharomyces cerevisiae
           YLR096W KIN2 Serine/threonine protein kinase involved in
           regulation of exocytosis localizes to the cytoplasmic
           face of the plasma membrane closely related to Kin1p and
           to YDR122W uniprot|P13185 Saccharomyces cerevisiae
           YDR122W KIN1 Serine/threonine protein kinase involved in
           regulation of exocytosis; localizes to the cytoplasmic
           face of the plasma membrane; closely related to Kin2p
          Length = 1204

 Score =  192 bits (487), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 102/286 (35%), Positives = 159/286 (55%), Gaps = 22/286 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
            +G W   ET+G GS GKV++A +  TN+  AIK+I                  P +   
Sbjct: 136 ALGDWDFLETVGAGSMGKVKIAKHHYTNEICAIKIINRATKAFLHKEQQLP--PPQNEQE 193

Query: 75  GIER----------------EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFN 118
            +ER                E  + + L HP++ RL+++   +N+ YM+ EY   G+L +
Sbjct: 194 ALERQKKLEKEISRDKRTIREASLGQALYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 253

Query: 119 LLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL 178
            +++ G L E+ A +F R I   + Y HA  IVHRDLK ENI++     IKI DFG++ +
Sbjct: 254 YIIQHGSLREHHARKFARGIASALQYLHANNIVHRDLKIENIMISTSGEIKIIDFGLSNM 313

Query: 179 ETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRN 238
                 L T CGS ++AAPE++   PY G E DVWS GV+L+ L+ G++PFD+E+ ++  
Sbjct: 314 FDPRTQLHTFCGSLYFAAPELLKASPYVGPEVDVWSFGVVLYVLVCGKVPFDDENSSV-- 371

Query: 239 LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKH 284
           L  K+++G+ + P    +S E   LL K+LVVDP KR   +++++H
Sbjct: 372 LHEKIKQGKVDYP--QHLSIEVISLLSKMLVVDPRKRASLKQVVEH 415

>KNAG0A03040 Chr1 complement(372150..374084) [1935 bp, 644 aa] {ON}
           Anc_8.654 YPL141C
          Length = 644

 Score =  186 bits (473), Expect = 8e-49,   Method: Compositional matrix adjust.
 Identities = 109/291 (37%), Positives = 155/291 (53%), Gaps = 31/291 (10%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAY-----------NESTNQQAAIKVIXXXXXXXXXXXXX 63
           T GP+ +G TLG G  GKV++ +           ++ T +Q AIK+I             
Sbjct: 46  TFGPYIVGSTLGEGEFGKVKMGWTRPVTDGNVGPSQRTPRQVAIKLIRRDTIVRNSDKET 105

Query: 64  XXXXTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEK 123
                       I REI  +K L HPN++ L ++ + +  + +VLEYA  GE +  +  K
Sbjct: 106 K-----------IYREINALKHLTHPNIIVLEEILQNSKYIGIVLEYASGGEFYKYIQRK 154

Query: 124 GPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMA-ALETED 182
             L E  A R F Q++ G+ Y H+ G+VHRDLK EN+LLD   N+ I DFG       E+
Sbjct: 155 RRLKEVNASRLFSQLVSGVHYMHSKGLVHRDLKLENLLLDKNENLMITDFGFVNEFSNEN 214

Query: 183 KLLETSCGSPHYAAPE-IVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGN-----I 236
            L++TSCGSP YAAPE +VS   Y G++ D+WSCGVIL+A+L G LP+D++  N     I
Sbjct: 215 VLMKTSCGSPCYAAPELVVSREAYVGVKVDIWSCGVILYAMLAGYLPWDDDPSNPNGDDI 274

Query: 237 RNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
             L   +     + P  D ++   +DLL +ILV DP +R     I  H  L
Sbjct: 275 SKLYSYITATPLKFP--DYVNPLPRDLLRRILVADPRRRYTLGHIENHEWL 323

>YOR233W Chr15 (775846..778248) [2403 bp, 800 aa] {ON}
           KIN4Serine/threonine protein kinase that inhibits the
           mitotic exit network (MEN) when the spindle position
           checkpoint is activated; localized asymmetrically to
           mother cell cortex, spindle pole body and bud neck
          Length = 800

 Score =  189 bits (479), Expect = 9e-49,   Method: Compositional matrix adjust.
 Identities = 111/291 (38%), Positives = 162/291 (55%), Gaps = 25/291 (8%)

Query: 12  KGDTIGPWKLGETLGLGSTGKVQLAYNESTN-----QQAAIKVIXXXXXXXXXXXXXXXX 66
           K  T GP+ +G TLG G  GKV+L + ++++     +Q AIK+I                
Sbjct: 39  KHATFGPYIIGSTLGEGEFGKVKLGWTKASSSNEVPKQVAIKLIRRDTIKKDADKEIK-- 96

Query: 67  XTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPL 126
                    I REI  +K L HPN++ L +V + +  + +VLE+   GE +  +  K  L
Sbjct: 97  ---------IYREINALKHLTHPNIIYLEEVLQNSKYIGIVLEFVSGGEFYKYIQRKRRL 147

Query: 127 PENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETED-KLL 185
            E+ A R F Q+I G++Y H  G+VHRDLK EN+LLD   N+ I DFG      ED +L+
Sbjct: 148 KESSACRLFAQLISGVNYMHYKGLVHRDLKLENLLLDKHENLVITDFGFVNEFFEDNELM 207

Query: 186 ETSCGSPHYAAPE-IVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGN-----IRNL 239
           +TSCGSP YAAPE +VS   Y   + DVWSCGVIL+A+L G LP+D++  N     I  L
Sbjct: 208 KTSCGSPCYAAPELVVSTKAYEARKADVWSCGVILYAMLAGYLPWDDDHENPTGDDIARL 267

Query: 240 LLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
              + +   + P  + I+   +DLL +ILV +P +RI  + I +H  L+ +
Sbjct: 268 YKYITQTPLKFP--EYITPIPRDLLRRILVPNPRRRINLQTIKRHVWLKPH 316

>Suva_10.180 Chr10 (337364..340843) [3480 bp, 1159 aa] {ON} YLR096W
           (REAL)
          Length = 1159

 Score =  190 bits (483), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 99/291 (34%), Positives = 163/291 (56%), Gaps = 22/291 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           ++G W+  ET+G GS GKV+L  +  T +   IK++                  P + + 
Sbjct: 103 SLGDWEFLETVGAGSMGKVKLVKHCQTKEVCVIKIVNRASKAFLHKQHSLP--PPKNENE 160

Query: 75  GIER----------------EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFN 118
            +ER                E  + ++L HP++ RL+++   +N+ YM+ EY   G+L +
Sbjct: 161 LLERQKRLEKEIARDKRTVREASLGQILYHPHICRLFEMCTMSNHFYMLFEYVSGGQLLD 220

Query: 119 LLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL 178
            +++ G L E+ A +F R I   + Y HA  IVHRDLK ENI++ +   IKI DFG++ +
Sbjct: 221 YIIQHGSLKEHHARKFARGIASALQYLHANNIVHRDLKIENIMISNSGEIKIIDFGLSNI 280

Query: 179 ETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRN 238
               K L T CGS ++AAPE++   PY G E D+WS G++L+ L+ G++PFD+E+ +I  
Sbjct: 281 FDSKKKLHTFCGSLYFAAPELLKAQPYTGPEVDIWSFGIVLYVLVCGKVPFDDENSSI-- 338

Query: 239 LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
           L  K++KG+ + P    +S +A  LL +++VVDP KR   + +  HP + +
Sbjct: 339 LHEKIKKGKVDYPS--HLSIDAVSLLTRMIVVDPLKRATLKNVTDHPWMNR 387

>CAGL0M02299g Chr13 (273725..276406) [2682 bp, 893 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150w
          Length = 893

 Score =  189 bits (479), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 105/280 (37%), Positives = 146/280 (52%), Gaps = 26/280 (9%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           +G +K+ + +G GS GKV LA +  T Q+  +K                   T D     
Sbjct: 39  VGNYKIQKQIGEGSFGKVYLATHRPTKQKVVLK-------------------TGDKSDPN 79

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           + RE+   +  ++P + +LY+V  T   ++M LEY    EL++ L+ K  LP  E    F
Sbjct: 80  VVREVFYHRQFDYPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSKSRLPTLECAELF 139

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            QI   + Y H L  VHRDLK EN+LLD   N K+ DFG         +LET CG+  Y 
Sbjct: 140 AQITGAVHYAHTLNCVHRDLKLENVLLDKNGNAKLTDFGFTRESMTKAVLETVCGTTVYM 199

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           APE++   PY G + D+WS GVIL+ LL G LPFDE+D      LL  QK   + P  DE
Sbjct: 200 APEMIQHKPYDGFKVDIWSLGVILYTLLCGCLPFDEDDD-----LLTKQKIINDTPVIDE 254

Query: 256 --ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSI 293
                EAQ+L+ ++L  DP +R  +  IL HP LQ Y ++
Sbjct: 255 RITIPEAQNLIEQLLSKDPTERPNTSAILLHPFLQPYGTL 294

>TBLA0C01750 Chr3 (412762..415707) [2946 bp, 981 aa] {ON} Anc_8.654
           YPL141C
          Length = 981

 Score =  187 bits (474), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 111/289 (38%), Positives = 158/289 (54%), Gaps = 26/289 (8%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQ-------QAAIKVIXXXXXXXXXXXXXXXXXT 68
            GP+ L  TLG G  GKV+L +++++ Q       Q AIK+I                  
Sbjct: 81  FGPYILSSTLGEGEFGKVKLGWSKASTQASNEIPKQVAIKLIKRSSILPKGSNKEIK--- 137

Query: 69  PDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPE 128
                  + REI  +K L HPN+++L DV + +  + +VLEYA  GE +  +  K  L E
Sbjct: 138 -------VYREINALKQLCHPNIVKLDDVLQNSKYIGIVLEYASGGEFYKYIQRKKRLKE 190

Query: 129 NEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMA-ALETEDKLLET 187
             A + F Q+I G+ Y H+ G+VHRDLK EN+LLD   N+ I DFG        ++L+ T
Sbjct: 191 INASKLFSQLISGVHYMHSKGLVHRDLKLENLLLDKHENLIITDFGFVNEFFQTNELMLT 250

Query: 188 SCGSPHYAAPEIV-SGLPYHGLETDVWSCGVILFALLTGRLPFDEE----DGN-IRNLLL 241
            CGSP YAAPE+V S  PY   + D+WSCG+IL+A+L G LP+D++    DGN I  L  
Sbjct: 251 PCGSPCYAAPELVISKHPYEARKADLWSCGIILYAMLAGYLPWDDDIKNPDGNDIARLYY 310

Query: 242 KVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
            +     + P  + I    +DLL KILV + +KRI  R I+ H  L+ +
Sbjct: 311 YITTTPLKFP--EYIQPLPRDLLRKILVPNYKKRINMRRIINHEWLKPH 357

>KNAG0H03140 Chr8 complement(589553..592363) [2811 bp, 936 aa] {ON}
           Anc_8.279 YLR096W
          Length = 936

 Score =  182 bits (462), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 102/286 (35%), Positives = 155/286 (54%), Gaps = 22/286 (7%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           ++G W    T+G GS GKV+LA +   +   A+K++                  P S + 
Sbjct: 114 SLGDWDFQTTVGAGSMGKVKLARHRYDDTVCAVKIV--NRATKTFLYRQQSAPAPQSKAD 171

Query: 75  GIEREIIIMK----------------LLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFN 118
             ERE ++ K                +L+H N+ +LY +   +N+ YM+ EY   G+L +
Sbjct: 172 IKERERLLAKEIARDTRTVREASLGQVLSHQNICQLYQMCTMSNHFYMMFEYVSGGQLLD 231

Query: 119 LLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAAL 178
            +++ G L E  A  F R I  G++Y HA  +VHRDLK ENI+L     IKI DFG++ L
Sbjct: 232 YIIQHGSLREPLARSFARAIASGLAYLHANNVVHRDLKIENIMLTAAGEIKIIDFGLSNL 291

Query: 179 ETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRN 238
                 L T CGS ++AAPE++   PY G E D+WS GVIL+ L+ G++PFD+E+ N   
Sbjct: 292 FDPRAKLTTYCGSLYFAAPELLRAKPYIGPEIDIWSFGVILYVLVVGKVPFDDENSNA-- 349

Query: 239 LLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKH 284
           L  K+++G+   P    +S E   LL K+L V+P++R   +EI+ H
Sbjct: 350 LHEKIKRGKVSYPA--TLSIECISLLTKMLTVNPKRRATLKEIVTH 393

>KLLA0D07348g Chr4 (626999..629728) [2730 bp, 909 aa] {ON} similar
           to uniprot|Q03002 Saccharomyces cerevisiae YPL141C
           Hypothetical ORF
          Length = 909

 Score =  182 bits (461), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 110/286 (38%), Positives = 156/286 (54%), Gaps = 23/286 (8%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQA---AIKVIXXXXXXXXXXXXXXXXXTPDS 71
           T GP+ +G TLG G  GKV+L +++S + ++   AIK+I                     
Sbjct: 52  TFGPYIIGPTLGEGEFGKVKLGWSKSNSDESKNVAIKLIRRDTIPKNSEKEVK------- 104

Query: 72  LSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEA 131
               I REI  +K L HPN++ L +V + +  + +VL YA  GE +  + +K  L E  A
Sbjct: 105 ----IYREINALKHLAHPNIVTLEEVLQNSKYIGIVLHYASGGEFYKYIQKKRRLKEPAA 160

Query: 132 IRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMA-ALETEDKLLETSCG 190
            R F Q+I G+ Y H  G+ HRDLK EN+LLD   N+ I DFG      + + L++TSCG
Sbjct: 161 CRLFAQLISGVHYMHHKGLAHRDLKLENLLLDEHENLIITDFGFVNEFSSRNDLMKTSCG 220

Query: 191 SPHYAAPE-IVSGLPYHGLETDVWSCGVILFALLTGRL-----PFDEEDGNIRNLLLKVQ 244
           SP YAAPE +V+   Y   + DVWSCGVIL+A+L G L     P + +  +I  L   + 
Sbjct: 221 SPCYAAPELVVTTKAYEARKADVWSCGVILYAMLAGYLPWDDDPDNPDGDDIAKLYNYIT 280

Query: 245 KGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
           K   + P  + I+   +D+L +ILV DP KRI    ILKH  LQ +
Sbjct: 281 KTSLKFP--EYINPIPRDILRRILVSDPSKRITVELILKHQWLQPH 324

>SAKL0H06754g Chr8 (594995..597649) [2655 bp, 884 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 884

 Score =  179 bits (455), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 97/277 (35%), Positives = 150/277 (54%), Gaps = 22/277 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           IG +K+ + +G GS GKV LA +  T+Q+  +K                   T +     
Sbjct: 34  IGNYKIVKLIGEGSFGKVYLANHRLTHQKVVLK-------------------TGNKNDPN 74

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           + RE+   +  + P++ +LY+V  T + ++M LEY    EL+  L+ +  +   E+ + F
Sbjct: 75  VVREVFYHRQFDFPHITKLYEVIVTESKVWMALEYCPGKELYEYLLMQHRISLEESGKLF 134

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            QI+  + Y H+L  VHRDLK ENILLD K   KI DFG         +LET CG+  Y 
Sbjct: 135 AQIVSAVYYAHSLQCVHRDLKLENILLDKKGRAKITDFGFTRECATKTMLETVCGTTVYM 194

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           APE++    Y G + D+WS GVIL+ ++ G +PFDEED       +  ++  +    DD 
Sbjct: 195 APELIERKSYDGFKIDIWSLGVILYTMIHGTMPFDEEDETKTKWKIINEEPFY---NDDV 251

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPS 292
           +SK+A+DL+ ++L  DP +R +  ++L HP LQ Y S
Sbjct: 252 VSKDAKDLISQLLCKDPSQRPQLSQVLAHPFLQPYGS 288

>ZYRO0F07194g Chr6 complement(581438..584254) [2817 bp, 938 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W Hypothetical ORF
          Length = 938

 Score =  179 bits (454), Expect = 2e-45,   Method: Compositional matrix adjust.
 Identities = 98/290 (33%), Positives = 151/290 (52%), Gaps = 22/290 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           +G +K+ + +G GS GKV LA ++ T+++  +K                   T D     
Sbjct: 34  VGNYKILKQIGEGSFGKVYLASHKPTHRKVVLK-------------------TSDKSDPN 74

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           + RE+   +  + P + +LY+V  T   ++M LEY    EL+  L+    +P +E  + F
Sbjct: 75  LVREVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGRELYEHLLMLHRIPLDECAKLF 134

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            QI+  + Y H+L  VHRDLK ENILLD   N K+ DFG          LET CG+  Y 
Sbjct: 135 AQIVSAVHYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECVSKSSLETICGTTVYM 194

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           APE++    Y G + D+WS GVIL+ ++ G +PFDE+D       +     +F    D+ 
Sbjct: 195 APELIQRQAYDGFKIDIWSLGVILYTMINGTMPFDEDDETKTKWKI---VNDFPNFNDNF 251

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPRE 305
           +S EA+DL+ ++L   P +R    +IL HP LQ Y  I  S+T + + R+
Sbjct: 252 VSHEAKDLIKRLLAKCPSERPTMEQILSHPFLQPYGQIMLSRTEKIIKRQ 301

>NDAI0E02390 Chr5 complement(496256..498907) [2652 bp, 883 aa] {ON}
           Anc_8.668
          Length = 883

 Score =  177 bits (450), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 104/296 (35%), Positives = 155/296 (52%), Gaps = 34/296 (11%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           +G +K+ + +G GS GKV LA +  T+ +  +K                   T +     
Sbjct: 35  VGNYKILDQIGEGSFGKVYLASHRLTHCKVVLK-------------------TSNKSDPN 75

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           I RE+   +  ++P + +LY+V  T + ++M  EY    +L++ ++    +P +  I  F
Sbjct: 76  IVREVFYHRQFDYPYITQLYEVIVTESKVWMAQEYCPGKDLYDHVLSLQRVPSSACIELF 135

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            QI+  + Y H+L  VHRDLK ENILLD   N K+ DFG          LET CG+  Y 
Sbjct: 136 TQIVGAVYYAHSLNCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTSLETICGTTVYM 195

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEF----EMP 251
           APE++    Y G + D+WS GVIL+ +L G +PFDE+D           K E+    EMP
Sbjct: 196 APELIKRESYDGFKIDIWSLGVILYTMLNGSMPFDEDDET---------KTEWKIMNEMP 246

Query: 252 --GDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPRE 305
              D  +S++A+DLL K+L  DP +R   +EIL HP LQ Y S+   KT R L ++
Sbjct: 247 VFNDTILSEDAKDLLIKLLSKDPNERPSMQEILHHPFLQPYGSLLLEKTDRLLRKQ 302

>KNAG0J01670 Chr10 complement(304021..307050) [3030 bp, 1009 aa]
           {ON} 
          Length = 1009

 Score =  177 bits (448), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 117/387 (30%), Positives = 197/387 (50%), Gaps = 35/387 (9%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           +G +K+ E +G GS GKV LA +  T+++  IK                    P+     
Sbjct: 43  VGNYKILEQIGEGSFGKVYLAMHRPTHRKVVIK--------------SSVKNDPN----- 83

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           I RE+   +   +  + +LY++  T + ++M LEY    EL++ +++   +P  E I+ F
Sbjct: 84  IVREVFYHRQFEYHYITKLYEIIVTESKVWMALEYCPGRELYDHVLQMKRIPAEECIQLF 143

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            QI+  + Y H+L  VHRDLK ENILLD   N K+ DFG      E   LET CG+  Y 
Sbjct: 144 SQIVGAVYYAHSLNCVHRDLKLENILLDKDGNAKLTDFGFTRECMEKVNLETICGTTVYM 203

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           APE+    PY G + D+WS GVIL+ +L+G +PFDE+D       +  ++ E+       
Sbjct: 204 APELTERKPYDGFKIDIWSLGVILYTMLSGSMPFDEDDEAKTKWKIINEEPEY---NSKF 260

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDTYLNPLIGN 315
           ++ E +DL+ K+L  D   R   REIL+H  LQ Y +   ++T   + R+        G 
Sbjct: 261 MTAEGEDLVRKLLQKDSNLRPSVREILQHEFLQPYGTTVLTQTDNLIARQRK------GA 314

Query: 316 DGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKVDSEQEALKN 375
               + +++ +L+ L     G +   I + + +   ++   L+ LL    ++ E++  K 
Sbjct: 315 TNFHSKLERRVLKRLNRC--GFDTQSIKQSVIKKKCDSLAGLWCLL----LEKEKKYQKR 368

Query: 376 SQIKKRQSIIS-NNNLKSGNINTTTPQ 401
            Q+++ +SI+S    + S +I+TT+ Q
Sbjct: 369 KQLRRSKSILSVGKKVISNSISTTSDQ 395

>NCAS0C01670 Chr3 complement(306682..309372) [2691 bp, 896 aa] {ON}
           Anc_8.668
          Length = 896

 Score =  176 bits (446), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 91/277 (32%), Positives = 147/277 (53%), Gaps = 22/277 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           +G +K+ + +G GS GKV LA +  T+ +  +K                   + D     
Sbjct: 35  VGNYKILDQIGEGSFGKVYLAQHRPTHTKVVLK-------------------SSDKNDPN 75

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           I RE+   +  ++P + +LY+V  T   ++M LEY    EL++ ++    +P +E ++ F
Sbjct: 76  IVREVFYHRQFDYPYITKLYEVIITETKVWMALEYCPGKELYDRVLSMHRVPTDECVQLF 135

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            QI+ G+ Y H+L  VHRDLK ENILLD   + K+ DFG          LET CG+  Y 
Sbjct: 136 AQIVGGVHYAHSLNCVHRDLKLENILLDKSGDAKLTDFGFTRECMTKTTLETICGTTVYM 195

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           APE++    Y G + D+WS GVIL+ ++ G +PFDE+D       +  Q  +     ++ 
Sbjct: 196 APELIERKSYDGFKIDIWSLGVILYTMINGSMPFDEDDETKTEWKIVHQTPQL---NENI 252

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPS 292
           ++ +A+DL+ ++L  +P  R    +ILKHP LQ + S
Sbjct: 253 VTADAKDLILRLLAKNPNDRPTVEQILKHPFLQPFGS 289

>TBLA0B03860 Chr2 (887855..890821) [2967 bp, 988 aa] {ON} Anc_8.668
           YPL150W
          Length = 988

 Score =  175 bits (444), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 101/280 (36%), Positives = 145/280 (51%), Gaps = 26/280 (9%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           +G +++   +G GS GKV LA++  T+++  +K                    P+     
Sbjct: 34  VGNYRILRQIGEGSFGKVYLAHHLPTHRKVVLK--------------SSAKSDPN----- 74

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           + RE+   +    P + +LY++  T   ++M LEY    EL+  L+    +P +E  R F
Sbjct: 75  VVREVFYHRQFEFPYITKLYEIIVTETKVWMALEYCPGKELYEHLLRLHRIPVDECSRLF 134

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            QI   M Y H+L  VHRDLK ENILLD   N K+ DFG         +LET CG+  Y 
Sbjct: 135 AQISGAMYYAHSLNCVHRDLKLENILLDKVGNAKLTDFGFTRECASKNILETICGTTVYM 194

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           APE++    Y G + DVWS GVIL+ LL G +PFDEE    +N   K+     EMP  D 
Sbjct: 195 APELIKRERYDGFKIDVWSLGVILYTLLNGFMPFDEEQQ--KNTEWKIVN---EMPSFDS 249

Query: 256 --ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSI 293
             +  +A DLL K+L  DP  R   +E+L+HP LQ Y ++
Sbjct: 250 TLLGPDAVDLLSKLLAKDPIDRPSMKEVLEHPYLQPYGNV 289

>Ecym_2405 Chr2 (788655..791222) [2568 bp, 855 aa] {ON} similar to
           Ashbya gossypii ACR133C
          Length = 855

 Score =  170 bits (430), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 97/280 (34%), Positives = 149/280 (53%), Gaps = 26/280 (9%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           +G +K+ + +G GS GKV LA ++ T+Q+  +K                   T +     
Sbjct: 34  VGNYKILKQVGEGSFGKVYLANHKLTHQKVVLK-------------------TGEKKDPN 74

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           + RE+   +  + P + +LY+V  T + ++M LEY    EL++ L++K  +P +E  + F
Sbjct: 75  VVREVFYHRQFDFPFITKLYEVIVTESKVWMALEYCPGNELYDYLLQKQRIPLDETSKLF 134

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            QI+  + Y H+L  VHRDLK ENILLD +    + DFG          LET CG+  Y 
Sbjct: 135 AQIVGAVFYAHSLQCVHRDLKLENILLDKQGYAMLTDFGFTRECATKTQLETICGTTVYM 194

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG--D 253
           APE++    Y G + D WS G+IL+ +L G +PFDEED  +    LK+     EMP   D
Sbjct: 195 APELIKRESYDGYKVDTWSLGIILYTMLHGFMPFDEEDPTLTG--LKIMN---EMPPIVD 249

Query: 254 DEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSI 293
              +  A+DL+ K+L   P +R    ++L+HP LQ Y +I
Sbjct: 250 AYTNVHAKDLILKLLRKTPSERPSLNKVLEHPFLQPYGTI 289

>KLLA0F11319g Chr6 (1042436..1044967) [2532 bp, 843 aa] {ON} similar
           to uniprot|Q12152 Saccharomyces cerevisiae YPL150W
           Hypothetical ORF
          Length = 843

 Score =  169 bits (429), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 105/335 (31%), Positives = 168/335 (50%), Gaps = 44/335 (13%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           IG +K+ + +G GS GKV LA +  T+Q+  +K                   T +     
Sbjct: 34  IGNYKISKFIGEGSFGKVYLATHRLTHQKVVLK-------------------TGNKRDPN 74

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           + RE+   +  + P + +LY+V  T + ++MVLEY    EL+  L+++  L   E+ + F
Sbjct: 75  VVREVFYHRQFDFPYITKLYEVIVTESRVWMVLEYCSGHELYEHLLKEQRLSLEESKKLF 134

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            QI   + Y H L  VHRDLK EN+LLD   + K+ DFG          LET CG+  Y 
Sbjct: 135 SQIASAVYYAHELKCVHRDLKLENVLLDGNGHAKLTDFGFTREMATRSQLETICGTTVYM 194

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           APE++    Y G + D+WS G+IL+ ++ G +PFDE+D +I+   LK+   E +    + 
Sbjct: 195 APELIERKCYDGFKVDIWSLGIILYTMINGYMPFDEDD-DIKT-KLKIVNDELDF-NQEW 251

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDTYLNPLIGN 315
           IS +A DL+  +L  +P +RI   ++L HP LQ +  +   KT +           L+  
Sbjct: 252 ISDDAIDLIQGMLRKNPNERISLAQVLSHPFLQPWGVVAKEKTDK----------VLLKQ 301

Query: 316 DGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPG 350
            GG             V +H ++E  + K+L++ G
Sbjct: 302 RGGH------------VHFHSKHEKRLLKRLKQCG 324

>TDEL0A06140 Chr1 complement(1074016..1076601) [2586 bp, 861 aa]
           {ON} Anc_8.668 YPL150W
          Length = 861

 Score =  169 bits (427), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 95/278 (34%), Positives = 146/278 (52%), Gaps = 28/278 (10%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           +G +K+ + +G GS GKV LA ++ T+++  +K                   T D     
Sbjct: 34  VGNYKIMKQIGEGSFGKVYLASHKPTHRKVVLK-------------------TSDKNDPN 74

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           + RE+   +  ++  + RLY+V  T   ++M LEY    EL+  L+    +  +E  R F
Sbjct: 75  VVREVFYHRQFDYLYITRLYEVIVTETKVWMALEYCPGKELYEHLLALKRISLDECSRLF 134

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            QI+  + Y H+L  VHRDLK ENILLD K N K+ DFG          L+T CG+  Y 
Sbjct: 135 AQIVGAIYYAHSLNCVHRDLKLENILLDKKGNAKLTDFGFTRECVSKSQLDTICGTTVYM 194

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEED-GNIRNLLLKVQKGEFEMP--G 252
           APE+     Y G + D+W+ GVIL+ ++ G +PFDE+D    +  ++       EMP   
Sbjct: 195 APELTERKSYDGFKIDIWALGVILYTMINGSMPFDEDDEAKTKWKIVN------EMPEIN 248

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
           +D +S +A+DL+ ++L  DP +R    +IL HP LQ Y
Sbjct: 249 EDLVSPDAKDLIEQLLAKDPNERPSIEKILTHPFLQPY 286

>TPHA0G01630 Chr7 (336511..339126) [2616 bp, 871 aa] {ON} Anc_8.668
           YPL150W
          Length = 871

 Score =  168 bits (426), Expect = 5e-42,   Method: Compositional matrix adjust.
 Identities = 93/275 (33%), Positives = 146/275 (53%), Gaps = 22/275 (8%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           +G +K+ + +G GS GKV LA +  T+++  +K                    P+     
Sbjct: 34  VGNYKILKQVGEGSFGKVYLAIHRPTHRKVVLK--------------SSSKTDPN----- 74

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           + RE+   +  +HP + +LY++  T   ++M LEY    EL++ L+    +P +E  R F
Sbjct: 75  VVREVFYHRQFDHPYITKLYEIIITETKVWMSLEYCPGKELYDYLLVMRRIPLDECSRLF 134

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            QI+  + Y H+L  VHRDLK ENILLD + N K+ADFG          LET CG+  Y 
Sbjct: 135 AQIVGAVYYAHSLNCVHRDLKLENILLDMQGNAKLADFGFTRECATKNQLETICGTTVYM 194

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           APE++    Y G + D+WS GVIL+ L+ G +PFDEED       +  ++ ++    +  
Sbjct: 195 APELLRRDTYDGFKIDIWSLGVILYTLINGSMPFDEEDETRTEWKIINEEPDY---NEKI 251

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
            +  + +L+  +L+ DP+KR    EILKH  L+ Y
Sbjct: 252 FNANSIELIKSLLIKDPKKRPSMTEILKHKFLEPY 286

>ACR133C Chr3 complement(581468..584023) [2556 bp, 851 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL150W
          Length = 851

 Score =  168 bits (425), Expect = 6e-42,   Method: Compositional matrix adjust.
 Identities = 95/280 (33%), Positives = 147/280 (52%), Gaps = 26/280 (9%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           +G +++ + +G GS GKV LA ++ T+Q+  +K                    P+     
Sbjct: 34  VGNYRIVKQVGEGSFGKVYLATHKLTHQKVVLKT--------------GAKSDPN----- 74

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           + RE+   +   +P + +LY+V  T   ++M LEY    EL++ L+ K  +P +E  R F
Sbjct: 75  VVREVFYHRQFEYPFITKLYEVIVTETRVWMALEYCPGNELYDYLLLKQRIPLDETRRLF 134

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            QI+  + Y H+L  VHRDLK ENILLD      + DFG          LET CG+  Y 
Sbjct: 135 AQIVSAVFYAHSLQCVHRDLKLENILLDKNGYAMLTDFGFTRECATKTQLETVCGTTVYM 194

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPG--D 253
           APE++    Y G + D WS G+IL+ +L G +PFDE+D  +R  L    K   E P   D
Sbjct: 195 APELIKREAYDGYKVDTWSLGIILYTMLHGYMPFDEDD-TVRTGL----KIMHEEPAVLD 249

Query: 254 DEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSI 293
           +  S +A+DL+ ++L  +  +R    E+L+HP LQ Y ++
Sbjct: 250 EYTSPQAKDLIVRLLDKNAAQRPNLNEVLQHPFLQPYGAL 289

>KLTH0D11044g Chr4 complement(901388..903937) [2550 bp, 849 aa] {ON}
           similar to uniprot|Q12152 Saccharomyces cerevisiae
           YPL150W
          Length = 849

 Score =  167 bits (424), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 95/290 (32%), Positives = 153/290 (52%), Gaps = 22/290 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           +G +++ + +G GS GKV LA +  T+Q+  +K+                   P+     
Sbjct: 34  VGNYRILKIVGEGSFGKVYLASHRLTHQKVVLKM--------------GSKNDPN----- 74

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           + RE+   +  ++  + +LY+V  T N+++M LEY    EL+  L+ K  +P +E    F
Sbjct: 75  VVREVFYHRQFDYVYITKLYEVIVTENSVWMALEYCPGKELYEYLLIKKRIPLDECSHLF 134

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            QI+  + Y H++  VHRDLK ENILLD K   K+ DFG         +LET CG+  Y 
Sbjct: 135 SQIVGAVFYAHSMKCVHRDLKLENILLDKKGQAKLTDFGFTRECATKGILETVCGTTVYM 194

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           APE++   PY G + D WS G+IL+ ++ G +PFDEED +I+     V    F    D+ 
Sbjct: 195 APELIERKPYEGYKIDTWSLGIILYTMIHGAMPFDEED-DIKTKYRIVNNEPFY--DDNF 251

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPRE 305
           I    +DL+ ++L  DP +R    ++L+HP +  + S    KT + + R+
Sbjct: 252 IDANGKDLIMQLLQKDPSQRPSLTQVLQHPFMFPHGSSILEKTDKTIKRQ 301

>Kpol_1072.19 s1072 (44906..47596) [2691 bp, 896 aa] {ON}
           (44906..47596) [2691 nt, 897 aa]
          Length = 896

 Score =  167 bits (423), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 91/277 (32%), Positives = 146/277 (52%), Gaps = 26/277 (9%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           +G +K+ + +G GS GKV LA ++ T+++  +K                   + D     
Sbjct: 36  VGNYKILKQIGEGSFGKVYLALHKPTHKKVVLK-------------------SSDKTDPN 76

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           + REI   +  + P + +LY+V  T   ++MV+EY    EL++ L+ K  +  +E+ R F
Sbjct: 77  VVREIFYHRQFDFPYITKLYEVIITETKVWMVIEYCPNKELYDYLLSKKRISLDESARIF 136

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            QI+  + Y H+L  VHRDLK ENILLD   N K+ DFG     +++  LET CG+  Y 
Sbjct: 137 AQIVGAVYYAHSLSCVHRDLKLENILLDKDNNAKLTDFGFTRDFSKNTQLETICGTTVYM 196

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFE--MPGD 253
           APE++    Y G + D+W+ G++L+ ++ G +PFDE+D     L +     +++     D
Sbjct: 197 APELLRREKYDGYKIDIWALGILLYTIINGTMPFDEDDPKKTELKIISASPDYDNKYFND 256

Query: 254 DEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
           D I     DL+ ++L  DP  R    +IL HP L  Y
Sbjct: 257 DSI-----DLVNRLLSKDPSMRPTIEQILMHPFLASY 288

>KNAG0D01090 Chr4 complement(183319..184437) [1119 bp, 372 aa] {ON} 
          Length = 372

 Score =  159 bits (401), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 94/296 (31%), Positives = 152/296 (51%), Gaps = 27/296 (9%)

Query: 2   ISSNKGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXX 61
           + S   N+ +K  T   + +G  LG G  GKV    ++ +    A+KV+           
Sbjct: 96  LDSFNSNLRIKSFTKDDFDIGLKLGKGKFGKVFCVRHKESGFICALKVMQKT-------- 147

Query: 62  XXXXXXTPDSLSYGIEREII----IMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELF 117
                   D L Y +ER+ I    I   LNHPN+ +LY  +     +Y+++EY   GEL+
Sbjct: 148 --------DILQYKLERQFIREVEIQSSLNHPNIAKLYGYFHDEKRVYLIMEYMLYGELY 199

Query: 118 NLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAA 177
             L   GP     A  +  QI   + Y H   I+HRD+KPENIL+     +K+ DFG + 
Sbjct: 200 KTLEIHGPFENAVATNYVYQIASAILYLHQRHIIHRDIKPENILIGPHNQLKLTDFGWSI 259

Query: 178 LETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIR 237
           +  +     T CG+  Y +PEIV    Y     D+W+ G++ + LL G  PF+E   N +
Sbjct: 260 INPKGLRRRTFCGTIDYLSPEIVDYKEYDH-NVDIWALGIVAYELLVGSPPFEE---NTK 315

Query: 238 NLLL-KVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPS 292
           +L   ++++G+   P   +++ EA+D + +ILV++P+KR+  +EI+ HP + KY S
Sbjct: 316 DLTYERIRRGDIVFP--KQVTPEARDFIERILVLEPKKRMTLKEIMSHPWILKYKS 369

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score =  167 bits (422), Expect = 2e-41,   Method: Compositional matrix adjust.
 Identities = 92/276 (33%), Positives = 145/276 (52%), Gaps = 24/276 (8%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           +G +K+ + +G GS GKV LA +  T+Q+  +K+                   P+     
Sbjct: 34  VGNYKILKIVGEGSFGKVYLASHCLTHQKVVLKM--------------GSKNDPN----- 74

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           + RE+   +  ++ ++ +LY+V  T N ++M LEY    EL+  L+ K  +P  E    F
Sbjct: 75  VVREVFYHRQFDYSHITKLYEVIVTENYVWMALEYCPGKELYEYLLAKKHIPLEECSELF 134

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            QI+  + Y H++  VHRDLK ENILLD K + K+ DFG         +LET CG+  Y 
Sbjct: 135 SQIVGAVYYAHSMKCVHRDLKLENILLDKKGHAKLTDFGFTRECATKGILETICGTTVYM 194

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGD-D 254
           APE++   PY G + D WS G+IL+ ++ G +PFDE D     +  K +   +    D D
Sbjct: 195 APELIERKPYEGYKIDTWSLGIILYTMIHGTMPFDEVD----EVKTKYKIVHYNPTYDND 250

Query: 255 EISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY 290
            I    ++L+ ++L  DP +R    ++L+HP LQ Y
Sbjct: 251 YIDSNGKELISQLLEKDPNQRPSLTQVLQHPFLQPY 286

>Kwal_56.23717 s56 complement(674222..676798) [2577 bp, 858 aa] {ON}
           YDR122W (KIN1) - Serine/threonine protein kinase [contig
           174] PARTIAL
          Length = 858

 Score =  165 bits (418), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 79/189 (41%), Positives = 118/189 (62%), Gaps = 4/189 (2%)

Query: 101 NNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENI 160
           +N+ YM+ EY   G+L + +++ G L E  A +F R I   + Y H   IVHRDLK ENI
Sbjct: 5   SNHFYMLFEYVSGGQLLDYIIQHGSLRERSARKFARGIASALQYLHMNNIVHRDLKIENI 64

Query: 161 LLDHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILF 220
           ++     IKI DFG++ +    K L T CGS ++AAPE++   PY G E DVWS GV+LF
Sbjct: 65  MISTSGEIKIIDFGLSNMYNPKKQLHTFCGSLYFAAPELLKACPYTGPEVDVWSFGVVLF 124

Query: 221 ALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSRE 280
            L+ G++PFD+E+ ++  L  K+++G+ E P    +S E   LL K+LVVDP KR   ++
Sbjct: 125 VLVCGKVPFDDENSSV--LHEKIKQGKVEYP--QHLSIEVISLLSKMLVVDPTKRASLKQ 180

Query: 281 ILKHPLLQK 289
           ++ H  +Q+
Sbjct: 181 VVNHQWMQR 189

>Suva_16.160 Chr16 (277393..280149) [2757 bp, 918 aa] {ON} YPL150W
           (REAL)
          Length = 918

 Score =  166 bits (419), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 98/292 (33%), Positives = 149/292 (51%), Gaps = 26/292 (8%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           +G +K+ + +G GS GKV LA +  T+++  +K                   T D     
Sbjct: 38  VGNYKILKQVGEGSFGKVYLALHRPTHRKVCLK-------------------TSDKNDPN 78

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           I RE+   +  + P + +LY+V  T   ++M LEY    EL++ L+    +   E    F
Sbjct: 79  IVREVFYHRQFDFPYITKLYEVIVTETKVWMALEYCPGKELYDHLLSLHRISLLECAELF 138

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            QI   + Y H++  VHRDLK ENILLD   N K+ DFG          LET CG+  Y 
Sbjct: 139 AQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVYM 198

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           APE++    Y G + D+WS GVIL+ L+TG LPFD++D  ++     V     E P  D 
Sbjct: 199 APELIERRTYDGFKIDIWSLGVILYTLITGSLPFDDDD-EVKTKWKIVN----EEPNYDS 253

Query: 256 --ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPRE 305
             I  +A+DL+ ++L  +P++R    ++L H  LQ Y S+   +T + L R+
Sbjct: 254 TLIPDDAKDLISRLLAKNPKERPSLPQVLHHQFLQPYGSVVLDQTEKTLSRQ 305

>YPL150W Chr16 (268188..270893) [2706 bp, 901 aa] {ON} Protein
           kinase of unknown cellular role; binds
           phosphatidylinositols and cardiolipin in a large-scale
           study
          Length = 901

 Score =  165 bits (418), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 95/290 (32%), Positives = 151/290 (52%), Gaps = 22/290 (7%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           +G +K+ + +G GS GKV LA +  T+++  +K                   T D     
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRKVCLK-------------------TSDKNDPN 78

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           I RE+   +  + P + +LY+V  T + ++M LEY    EL++ L+    +   E    F
Sbjct: 79  IVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRISLLECGELF 138

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            QI   + Y H++  VHRDLK ENILLD   N K+ DFG          LET CG+  Y 
Sbjct: 139 AQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVYM 198

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           APE++    Y G + D+WS GVIL+ L+TG LPFD++D       +  ++ +++      
Sbjct: 199 APELIERRTYDGFKIDIWSLGVILYTLITGYLPFDDDDEAKTKWKIVNEEPKYDA---KV 255

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPRE 305
           I  +A+DL+ ++L  +P +R    ++L+HP LQ Y S+   +T + L R+
Sbjct: 256 IPDDARDLISRLLAKNPGERPSLSQVLRHPFLQPYGSVVLDQTQKILCRQ 305

>Skud_16.132 Chr16 (239797..242571) [2775 bp, 924 aa] {ON} YPL150W
           (REAL)
          Length = 924

 Score =  164 bits (415), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 96/293 (32%), Positives = 151/293 (51%), Gaps = 28/293 (9%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           +G +K+ + +G GS GKV LA +  T+++  +K                   T D     
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRKVCLK-------------------TSDKNDPN 78

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           I RE+   +  + P + +LY+V  T + ++M LEY    EL++ L+    +   E    F
Sbjct: 79  IVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLHRISLLECGELF 138

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            QI   + Y H++  VHRDLK ENILLD   N K+ DFG          LET CG+  Y 
Sbjct: 139 AQISGAVYYAHSMHCVHRDLKLENILLDKNGNAKLTDFGFTRECMTKTTLETVCGTTVYM 198

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFE---MPG 252
           APE++    Y G + D WS GVIL+ L+TG LPFD++D       +  ++ +++   +P 
Sbjct: 199 APELIGRKTYDGFKIDTWSLGVILYTLITGSLPFDDDDEAKTKWKIVNEEPKYDPKLIPD 258

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPRE 305
           D      A+DL+ ++L  +P +R    ++L+HP LQ Y S+   +T + L R+
Sbjct: 259 D------AKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSVVLDQTEKILCRQ 305

>Smik_6.347 Chr6 complement(553316..556069) [2754 bp, 917 aa] {ON}
           YPL150W (REAL)
          Length = 917

 Score =  163 bits (413), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 100/292 (34%), Positives = 151/292 (51%), Gaps = 26/292 (8%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           +G +K+ + +G GS GKV LA +  T+++  +K                   T D     
Sbjct: 38  VGNYKILKQIGEGSFGKVYLALHRPTHRKVCLK-------------------TSDKNDPN 78

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           I RE+   +  + P + +LY+V  T + ++M LEY    EL++ L+    L   E    F
Sbjct: 79  IVREVFYHRQFDFPYITKLYEVIVTESKVWMALEYCPGKELYDHLLSLRRLSLLECGELF 138

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            QI   + Y H++  VHRDLK ENILLD   N K+ DFG          LET CG+  Y 
Sbjct: 139 AQISGAVYYAHSMHCVHRDLKLENILLDRNGNAKLTDFGFTRECMTKTTLETVCGTTVYM 198

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           APE++    Y G + D+WS GVIL+ L+TG LPFD++D  ++     V     E P  D 
Sbjct: 199 APELIERKTYDGFKIDIWSLGVILYTLITGYLPFDDDD-EVKTKWKIVN----EEPKYDS 253

Query: 256 --ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPRE 305
             I  +A+DL+ ++L  +P +R    ++L+HP LQ Y S+   +T + L R+
Sbjct: 254 KFIPDDAKDLISRLLAKNPGERPSLPQVLRHPFLQPYGSVVLDQTEKILCRQ 305

>KLLA0F11143g Chr6 complement(1026129..1028570) [2442 bp, 813 aa]
           {ON} similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 813

 Score =  162 bits (409), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 89/277 (32%), Positives = 153/277 (55%), Gaps = 30/277 (10%)

Query: 25  LGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREIIIMK 84
           +G G+   V+ A   ST +  A+K+I                        G++RE+ +++
Sbjct: 198 VGQGAFATVKKAVERSTGKTFAVKIIHKRKVMDKFD--------------GVKRELDVLQ 243

Query: 85  LLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGMSY 144
            LNHP +++L D +E N+N YM++E+   G+L + +   G + E+      RQ++  + Y
Sbjct: 244 KLNHPRIVKLKDFFEDNDNYYMLMEFVSGGDLMDFVAAHGTVGEDAGREITRQVLEAVKY 303

Query: 145 CHALGIVHRDLKPENILL--DHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSG 202
            H  GI HRDLKP+NI++  D  + IKI DFG+A ++ ++  L T CG+  Y APE++ G
Sbjct: 304 MHDQGISHRDLKPDNIMIEQDDPVLIKITDFGLAKVQNQNTFLNTFCGTLAYVAPEVIDG 363

Query: 203 LP---------YHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEF-EMP- 251
                      Y  L  D+WS G +++ +LTG LPF  +  N   L  ++++G + E P 
Sbjct: 364 KNAEDKTNRDLYSSL-VDMWSIGCLVYVILTGHLPFSGQSQN--ELFKQIKRGSYHEGPL 420

Query: 252 GDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQ 288
            D  IS+EA++ +  +L VDP++R+ + + L+HP ++
Sbjct: 421 KDYRISEEARNFIDCLLNVDPKERMNAGKALQHPWMK 457

>NDAI0G05300 Chr7 (1289208..1290521) [1314 bp, 437 aa] {ON}
           Anc_1.374
          Length = 437

 Score =  155 bits (391), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 98/299 (32%), Positives = 155/299 (51%), Gaps = 26/299 (8%)

Query: 21  LGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREI 80
            G+TLG G+ G V+ A   +T +  A+K++                         +  E+
Sbjct: 54  FGKTLGAGTFGVVRQARKLTTGEDVAVKILLKKALKGNNVQLQM-----------LYDEL 102

Query: 81  IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIII 140
            I++ L+HPN++   D +E+ +  Y+V + A  GELF+ +++KG   E +A+    Q+I 
Sbjct: 103 AILQKLHHPNIVAFKDWFESKDKFYIVTQLATGGELFDRIIKKGKFSEVDAVSIMVQLIS 162

Query: 141 GMSYCHALGIVHRDLKPENIL-LDHKLN--IKIADFGMAA-LETEDKLLETSCGSPHYAA 196
            +SY H+  IVHRDLKPEN+L LD+  N  + IADFG+A  L++ D L+    GS  Y A
Sbjct: 163 AVSYIHSQNIVHRDLKPENVLYLDNSDNSQLVIADFGIAKELKSNDDLIFKGAGSLGYVA 222

Query: 197 PEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPGDD 254
           PE+++    HG   D+WS GVI + LL+G   F  E  +G +          +F  P  D
Sbjct: 223 PEVLTR-EGHGKPCDIWSLGVITYTLLSGYSAFIAESVEGFLEECTRSTYPVKFHSPYWD 281

Query: 255 EISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK--------YPSIKDSKTIRNLPRE 305
            IS+EA+D + + L +DP  R  + E+L+ P +           P +K   T+R   R+
Sbjct: 282 NISQEAKDFILRALTIDPNDRPTAEELLQDPWITNKNISTTDILPDVKKGFTLRKKLRD 340

>NCAS0A08880 Chr1 (1756271..1757539) [1269 bp, 422 aa] {ON}
           Anc_1.374
          Length = 422

 Score =  154 bits (390), Expect = 1e-39,   Method: Compositional matrix adjust.
 Identities = 98/299 (32%), Positives = 155/299 (51%), Gaps = 26/299 (8%)

Query: 21  LGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREI 80
            G+TLG G+ G V+ A   S+ +  A+K++                   D     +  E+
Sbjct: 40  FGKTLGAGTFGVVRQARQLSSQEDVAVKILLKNALKGN-----------DVQLQMLYDEL 88

Query: 81  IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIII 140
            I++ L+HPN++   D +E+ +  Y+V + A  GELF+ +++KG   E +A+    Q++ 
Sbjct: 89  SILQRLHHPNIVAFKDWFESRDKFYIVTQLATGGELFDRIIKKGKFTEVDAVNIMVQLLD 148

Query: 141 GMSYCHALGIVHRDLKPENIL-LD--HKLNIKIADFGMAA-LETEDKLLETSCGSPHYAA 196
            + Y H+  IVHRDLKPEN+L LD   +  + IADFG+A  L++ D L+    GS  Y A
Sbjct: 149 AVKYIHSQNIVHRDLKPENVLYLDPSDESQLVIADFGIAKELKSNDDLIFKGAGSLGYVA 208

Query: 197 PEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPGDD 254
           PE+++    HG   D+WS GVI + LL+G  PF  E  +G +          +F  P  D
Sbjct: 209 PEVLTK-EGHGKPCDIWSLGVITYTLLSGYSPFIAESVEGFLEECTRSRYPVQFHKPYWD 267

Query: 255 EISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK--------YPSIKDSKTIRNLPRE 305
            IS EA+D + K L +DPE+R  + E++  P +           P +K   T+R   R+
Sbjct: 268 SISDEAKDFILKALTIDPEERPSAEELMNDPWITSKHINTTNILPDVKKGFTLRKKLRD 326

>NCAS0D00630 Chr4 complement(107310..108593) [1284 bp, 427 aa] {ON}
           Anc_1.374
          Length = 427

 Score =  154 bits (389), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 98/291 (33%), Positives = 160/291 (54%), Gaps = 29/291 (9%)

Query: 19  WKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIER 78
           ++ G+TLG GS G V+ A  +S N++ AIK++                         +  
Sbjct: 27  YEFGKTLGAGSFGVVREATKKSNNEEVAIKILLKKALEGNQVQLQM-----------LYD 75

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           E+ I+K L+HPN++   + +ET++ +Y+V + A  GELF+ +++KG   E++A++   QI
Sbjct: 76  ELTILKKLHHPNIVEFKNWFETDDKIYIVTQLATGGELFDRIIKKGRFSEDDAVKILIQI 135

Query: 139 IIGMSYCHALGIVHRDLKPENIL-LDHKLN--IKIADFGMA-ALETEDKLLETSCGSPHY 194
           +  + Y H+  IVHRDLKPEN+L L  K +  + IADFG+A  L+  ++L+  + GS  Y
Sbjct: 136 LSAVEYIHSRDIVHRDLKPENLLYLTEKEDSELVIADFGIAKELKKGEQLIFKAAGSLGY 195

Query: 195 AAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE----FEM 250
            APE+++ +  HG   D+WS GVI + LL+G   F  E   +   L +   G+    F  
Sbjct: 196 VAPEVLT-VDGHGKPCDIWSIGVITYTLLSGYAAFVAE--TVEGFLDECTSGDYPVKFHK 252

Query: 251 PGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRN 301
           P  D IS +A++ + K L ++P+KR  + E+L  P +        SK  RN
Sbjct: 253 PYWDNISDDAKNFILKALDLNPQKRPTATELLDDPWIT-------SKVCRN 296

>Smik_6.350 Chr6 (559997..562465) [2469 bp, 822 aa] {ON} YPL153C
           (REAL)
          Length = 822

 Score =  159 bits (403), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 91/289 (31%), Positives = 152/289 (52%), Gaps = 36/289 (12%)

Query: 21  LGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREI 80
           + E +G G+   V+ A   +T +  A+K+I                        G+ RE+
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMD--------------GVTREL 245

Query: 81  IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIII 140
            +++ LNHP ++RL   +E  ++ YMV+E+   G+L + +   G + E+      RQI+ 
Sbjct: 246 EVLQKLNHPRIVRLKGFYEDADSYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILT 305

Query: 141 GMSYCHALGIVHRDLKPENILL--DHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPE 198
            + Y H++GI HRDLKP+NIL+  D  + +KI DFG+A ++     ++T CG+  Y APE
Sbjct: 306 AVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPE 365

Query: 199 IVSGL-------------PYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQ 244
           ++ G               Y  L  D+WS G +++ +LTG LPF    G+ ++ L K + 
Sbjct: 366 VIRGKDSSASPDEYEERNEYSSL-VDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIG 421

Query: 245 KGEF-EMPGDD-EISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYP 291
           +G + E P  D  IS+EA+D +  +L VDP  R+ + + L HP ++  P
Sbjct: 422 RGSYHEGPLKDFRISEEARDFIDSLLQVDPSNRLTAAKALDHPWIKMGP 470

>Kwal_56.22476 s56 complement(145039..147132) [2094 bp, 697 aa] {ON}
           YMR001C (CDC5) - protein kinase which functions at the
           G(sub)2/M boundary [contig 185] FULL
          Length = 697

 Score =  158 bits (399), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 87/229 (37%), Positives = 137/229 (59%), Gaps = 7/229 (3%)

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           EI I K + H N+++  D +E + N+Y++LE    G L +LL  +  L E E +RFF   
Sbjct: 126 EIQIHKSMRHTNIVQFVDCFEDDTNVYILLEICPNGSLMDLLKRRKMLTEPE-VRFFTTQ 184

Query: 139 IIG-MSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLE-TSCGSPHYAA 196
           I+G + Y H+  ++HRDLK  NI  D   N+K+ DFG+AA+   D+  + T CG+P+Y A
Sbjct: 185 IVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKVGDFGLAAVLANDRERKYTVCGTPNYIA 244

Query: 197 PEIVSGLPY-HGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           PE+++G    H  E D+WSCGV+++ALL G+ PF  ++ NI  +  +++ G+F  P D  
Sbjct: 245 PEVLTGKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDFVFPKDKF 302

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK-YPSIKDSKTIRNLP 303
           IS EA  L+  IL +DP +R    EI+ +   +  +PS  D+  + + P
Sbjct: 303 ISPEALVLIKDILSIDPLERPSLDEIIDYVWFRGLFPSRIDASVLTSAP 351

>KNAG0I01480 Chr9 (287733..289055) [1323 bp, 440 aa] {ON} Anc_1.374
           YFR014C
          Length = 440

 Score =  153 bits (386), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 95/277 (34%), Positives = 149/277 (53%), Gaps = 22/277 (7%)

Query: 19  WKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIER 78
           ++ G+T+G G+ G V+ A   ST ++ A+K+I                   D     +  
Sbjct: 41  YEFGKTMGAGTFGVVRKATKISTGEEVAVKIILKKALEGN-----------DIQLQMLYD 89

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           E+ I++ L HPN++     +E+ + +Y+V + A  GELF+ ++++G   E +A+    QI
Sbjct: 90  ELAILQQLKHPNIVEFKAWFESKDKIYIVTQLATGGELFDTILKRGKFTELDAVDIVVQI 149

Query: 139 IIGMSYCHALGIVHRDLKPENILL---DHKLNIKIADFGMAA-LETEDKLLETSCGSPHY 194
           +  + Y H+  +VHRDLKPENIL      K  I IADFG+A  LE E  L+  + GS  Y
Sbjct: 150 LKAVEYIHSQNVVHRDLKPENILYVDESEKSQIVIADFGIAKRLEGEGDLIFKAAGSLGY 209

Query: 195 AAPEIV--SGLPYHGLETDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEM 250
            APE++  SG   HG   D+WS G+I + LL G  PF  E  DG +  ++   +   F  
Sbjct: 210 VAPEVLLNSG---HGKPCDIWSVGIIAYTLLCGYSPFVAEDVDGFLDEIVENEEPIAFHS 266

Query: 251 PGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
           P  DEIS EA+  + + + +DP +R  + E+LK P +
Sbjct: 267 PYWDEISNEAKQFILRAVTIDPFQRPTATELLKDPWI 303

>KNAG0J01700 Chr10 (309962..312424) [2463 bp, 820 aa] {ON} 
          Length = 820

 Score =  158 bits (400), Expect = 6e-39,   Method: Compositional matrix adjust.
 Identities = 88/283 (31%), Positives = 149/283 (52%), Gaps = 33/283 (11%)

Query: 23  ETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREIII 82
           E +G G+   V+ A   +T +  A+K+I                        G+ RE+ +
Sbjct: 206 EVVGQGAFATVKKAIETATGRTYAVKIINKRKVMGNLD--------------GVTRELTV 251

Query: 83  MKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGM 142
           ++ L+HP+++ L   +E  +N YMV+E+   G+L + +   GP+ E+      RQI+  +
Sbjct: 252 LQKLDHPSIVTLKGFYEDKDNYYMVMEFVSGGDLMDFVAAHGPVGEDAGREITRQILEAV 311

Query: 143 SYCHALGIVHRDLKPENILL--DHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 200
            Y H++GI HRDLKP+NIL+  D  + +KI DFG+A ++     + T CG+  Y APE+V
Sbjct: 312 KYIHSVGISHRDLKPDNILIKQDDPVLVKITDFGLAKMQEHGAFMNTFCGTLAYVAPEVV 371

Query: 201 SG--------LP-----YHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE 247
           +G        +P     ++    D+WS G +++ +LTG LPF       + L  ++ K  
Sbjct: 372 NGRQQTSEPAVPKGERSHYSSLVDMWSMGCLVYVILTGHLPF--SGSTPQQLYEQIGKAS 429

Query: 248 F-EMP-GDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQ 288
           + E+P  D  IS +A+D +  +L VDP  R+ +   L+HP +Q
Sbjct: 430 YHEVPLKDCRISDQARDFIDCLLQVDPNNRLSAARALEHPWIQ 472

>KLTH0C10912g Chr3 (898372..900465) [2094 bp, 697 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 697

 Score =  157 bits (397), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 86/229 (37%), Positives = 137/229 (59%), Gaps = 7/229 (3%)

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           EI I K + H N+++  D +E + N+Y++LE    G L +LL  +  L E E +RFF   
Sbjct: 126 EIQIHKSMRHFNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKRRKVLTEPE-VRFFTTQ 184

Query: 139 IIG-MSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLE-TSCGSPHYAA 196
           I+G + Y H+  ++HRDLK  NI  D   N+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 185 IVGAVKYMHSRRVIHRDLKLGNIFFDKHYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 244

Query: 197 PEIVSGLPY-HGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           PE+++G    H  E D+WSCGV+++ALL G+ PF  ++ NI  +  +++ G++  P D  
Sbjct: 245 PEVLTGKHTGHSYEVDIWSCGVMIYALLIGKPPFQAKEVNI--IYERIKCGDYVFPRDKC 302

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK-YPSIKDSKTIRNLP 303
           IS+EA  L+  IL +DP +R    EI+ +   +  +P   D+  + + P
Sbjct: 303 ISQEALTLIRDILSIDPLERPSLDEIIDYVWFRGIFPPRIDASVLSSAP 351

>CAGL0F04741g Chr6 (478256..479584) [1329 bp, 442 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016c CMK2
           Ca2+/calmodulin-dependent ser/thr protein kinase type II
          Length = 442

 Score =  152 bits (385), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 96/299 (32%), Positives = 151/299 (50%), Gaps = 26/299 (8%)

Query: 21  LGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREI 80
            G+TLG G+ G V+ A    TN+  A+K++                   D     +  E+
Sbjct: 47  FGKTLGAGTFGVVRQARYSPTNEDVAVKILLKKALKGN-----------DVQLQMLYDEL 95

Query: 81  IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIII 140
            I+++L HPN++   D +E+ +  Y+V + A  GELF+ ++ KG   E +A+    QI+ 
Sbjct: 96  SILQMLKHPNIVEFKDWFESKDKFYIVTQLAVGGELFDRILAKGKFTERDAVSITMQILS 155

Query: 141 GMSYCHALGIVHRDLKPENILLDHKLN---IKIADFGMA-ALETEDKLLETSCGSPHYAA 196
            + Y H+  +VHRDLKPEN+L   K +   + IADFG+A  L+  D L+  + GS  Y A
Sbjct: 156 AVDYMHSKNVVHRDLKPENVLYIDKSDDSQLVIADFGIAKQLQDNDDLIFKAAGSLGYVA 215

Query: 197 PEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPGDD 254
           PE+++    HG   D+WS GVI++ LL G   F  E  DG +           F  P  D
Sbjct: 216 PEVLTN-NGHGKPCDIWSIGVIVYTLLCGYSAFVAETVDGFLEECTQNKYPVTFHKPYWD 274

Query: 255 EISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK--------YPSIKDSKTIRNLPRE 305
            IS EA++ + + L +DP +R  + E++K P +          YP I+    +R   R+
Sbjct: 275 NISDEAKNFILRALTLDPAERPTAAELMKDPWITNTRPETANIYPEIRKGFDLRKKLRD 333

>CAGL0L07326g Chr12 (810529..812049) [1521 bp, 506 aa] {ON} similar
           to uniprot|P39009 Saccharomyces cerevisiae YDL101c DUN1
           protein kinase
          Length = 506

 Score =  154 bits (388), Expect = 7e-39,   Method: Compositional matrix adjust.
 Identities = 99/310 (31%), Positives = 152/310 (49%), Gaps = 40/310 (12%)

Query: 19  WKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIER 78
           + LG+ LG G    V+ A N++T +  A+K+                           E 
Sbjct: 193 YLLGKDLGSGHYAIVKEAKNKTTGETVAVKIFHPQQNDDQKKNKQFR-----------EE 241

Query: 79  EIIIMKLLNHPNVLRLYD-----VWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIR 133
             I+MK+ +HPN++ L D     + +T    Y+VLE  + GELF+ +V+K  LP+ E+  
Sbjct: 242 TTILMKI-HHPNIVNLLDSFVEPISKTQIQKYLVLEKIDDGELFDRIVKKTSLPQEESKA 300

Query: 134 FFRQIIIGMSYCHALGIVHRDLKPENILLDHK-------------------LNIKIADFG 174
            F+QI+ G+ Y H+  I+HRD+KPENILL+ +                   + +KIADFG
Sbjct: 301 IFKQILTGLKYLHSQNIIHRDIKPENILLNIRRRQSPDERQLGPWDEDEIDIQVKIADFG 360

Query: 175 MAALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDG 234
           +A    E +   T CG+P Y APE++    Y   + D+WS GVIL+  L G  PF ++ G
Sbjct: 361 LAKFTGEMQFTNTLCGTPSYVAPEVLVKKGYTS-KVDLWSAGVILYVCLCGFPPFSDQLG 419

Query: 235 --NIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPS 292
             +++  ++   K  F  P  DEI   A  L+  +LV+DPE R        HP L     
Sbjct: 420 PPSLKEQIMSA-KYAFYSPYWDEIDDAALHLISNLLVLDPENRYDVDAAAAHPWLDSVSH 478

Query: 293 IKDSKTIRNL 302
           +  S  ++ L
Sbjct: 479 LDVSHNLKRL 488

>YFR014C Chr6 complement(172537..173877) [1341 bp, 446 aa] {ON}
           CMK1Calmodulin-dependent protein kinase; may play a role
           in stress response, many Ca++/calmodulin dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk2p and mammalian Cam Kinase
           II
          Length = 446

 Score =  152 bits (385), Expect = 8e-39,   Method: Compositional matrix adjust.
 Identities = 90/275 (32%), Positives = 149/275 (54%), Gaps = 22/275 (8%)

Query: 21  LGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREI 80
            G+TLG G+ G V+ A N  T +  A+K++                         +  E+
Sbjct: 39  FGKTLGAGTFGVVRQAKNTETGEDVAVKILIKKALKGNKVQLE-----------ALYDEL 87

Query: 81  IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIII 140
            I++ L+HPN++   D +E+ +  Y++ + A+ GELF+ +++KG   E +A+R   +I+ 
Sbjct: 88  DILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEEDAVRILVEILS 147

Query: 141 GMSYCHALGIVHRDLKPENILLDHKLN---IKIADFGMAA-LETEDKLLETSCGSPHYAA 196
            + Y H+  IVHRDLKPEN+L   K +   + +ADFG+A  L+++++LL    GS  Y A
Sbjct: 148 AVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELLYKPAGSLGYVA 207

Query: 197 PEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE----FEMPG 252
           PE+++    HG   D+WS GVI + LL G   F  E   +++ L +   GE    F  P 
Sbjct: 208 PEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFRAE--RVQDFLDECTTGEYPVKFHRPY 264

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
            D +S +A+  + K L +DP KR  + E+L+ P +
Sbjct: 265 WDSVSNKAKQFILKALNLDPSKRPTAAELLEDPWI 299

>AAR009W Chr1 (358947..360308) [1362 bp, 453 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL016C (CMK2) and
           YFR014C (CMK1)
          Length = 453

 Score =  152 bits (384), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 89/268 (33%), Positives = 143/268 (53%), Gaps = 20/268 (7%)

Query: 21  LGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREI 80
            G+TLG G+ G V+ A N   NQ  AIK++                         +  E+
Sbjct: 58  FGKTLGAGAFGVVRQARNSKQNQNVAIKILLKRALKGNELQM-------------LYDEL 104

Query: 81  IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIII 140
            I++ L+HPN+++  D +E+    Y+V + A  GELF+ +++KG   E +A++   Q++ 
Sbjct: 105 SILQKLDHPNIVKFKDWFESREKFYIVTQLATGGELFDRILKKGKFTETDAVKIVVQMLT 164

Query: 141 GMSYCHALGIVHRDLKPENIL-LD--HKLNIKIADFGMA-ALETEDKLLETSCGSPHYAA 196
            + Y H+  +VHRDLKPEN+L LD   +  + I+DFG+A  L +E +L+  + GS  Y A
Sbjct: 165 AVEYMHSQNVVHRDLKPENVLYLDPSDESQLVISDFGIAKQLSSESQLIHRAAGSMGYVA 224

Query: 197 PEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPGDD 254
           PE+++    HG   D+WS GVI + LL G  PF  E  +G +  +        F  P  +
Sbjct: 225 PEVLT-TSGHGKPCDIWSLGVITYTLLCGYSPFIAESTEGFLEEVFSGSDPVTFHSPYWN 283

Query: 255 EISKEAQDLLYKILVVDPEKRIKSREIL 282
            ISKEA+  + + L + P +R  + E+L
Sbjct: 284 NISKEAKQFILRALTLTPARRPTAAELL 311

>YPL153C Chr16 complement(261727..264192) [2466 bp, 821 aa] {ON}
           RAD53Protein kinase, required for cell-cycle arrest in
           response to DNA damage; activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p; also interacts with ARS1 and
           plays a role in initiation of DNA replication
          Length = 821

 Score =  157 bits (397), Expect = 1e-38,   Method: Compositional matrix adjust.
 Identities = 91/289 (31%), Positives = 150/289 (51%), Gaps = 36/289 (12%)

Query: 21  LGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREI 80
           + E +G G+   V+ A   +T +  A+K+I                        G+ RE+
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMD--------------GVTREL 245

Query: 81  IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIII 140
            +++ LNHP ++RL   +E   + YMV+E+   G+L + +   G + E+      RQI+ 
Sbjct: 246 EVLQKLNHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILT 305

Query: 141 GMSYCHALGIVHRDLKPENILL--DHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPE 198
            + Y H++GI HRDLKP+NIL+  D  + +KI DFG+A ++     ++T CG+  Y APE
Sbjct: 306 AIKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPE 365

Query: 199 IVSGL-------------PYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQ 244
           ++ G               Y  L  D+WS G +++ +LTG LPF    G+ ++ L K + 
Sbjct: 366 VIRGKDTSVSPDEYEERNEYSSL-VDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIG 421

Query: 245 KGEF-EMPGDD-EISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYP 291
           +G + E P  D  IS+EA+D +  +L VDP  R  + + L HP ++  P
Sbjct: 422 RGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRSTAAKALNHPWIKMSP 470

>Skud_16.129 Chr16 complement(233341..235824) [2484 bp, 827 aa] {ON}
           YPL153C (REAL)
          Length = 827

 Score =  157 bits (397), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 91/289 (31%), Positives = 151/289 (52%), Gaps = 36/289 (12%)

Query: 21  LGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREI 80
           + E +G G+   V+ A   +T +  A+K+I                        G+ RE+
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMD--------------GVTREL 245

Query: 81  IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIII 140
            +++ LNHP ++RL   +E   + YMV+E+   G+L + +   G + E+      RQI+ 
Sbjct: 246 EVLQKLNHPRIVRLKGFYEDAESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILA 305

Query: 141 GMSYCHALGIVHRDLKPENILL--DHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPE 198
            + Y H++GI HRDLKP+NIL+  D  + +KI DFG+A ++     ++T CG+  Y APE
Sbjct: 306 AVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPE 365

Query: 199 IVSGL-------------PYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQ 244
           ++ G               Y  L  D+WS G +++ +LTG LPF    G+ ++ L K + 
Sbjct: 366 VIRGKDSSVSPDECEERNEYSSL-VDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIG 421

Query: 245 KGEF-EMPGDD-EISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYP 291
           +G + E P  D  IS+EA+D +  +L VDP  R+ + + L HP ++  P
Sbjct: 422 RGSYHEGPLKDFRISEEARDFIDLLLQVDPNNRLTAAKALDHPWIKMNP 470

>TDEL0B06320 Chr2 (1118534..1119868) [1335 bp, 444 aa] {ON}
           Anc_1.374 YFR014C
          Length = 444

 Score =  151 bits (382), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 94/287 (32%), Positives = 155/287 (54%), Gaps = 26/287 (9%)

Query: 19  WKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIER 78
           +  G+TLG G+ G V+ A   ST +  A+K++                         +  
Sbjct: 40  YVFGKTLGAGTFGVVRQARKISTRENVAVKILLKKALKGNDVQLQL-----------LYD 88

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           E+ I++ L+HPN+++  D +E+ +  Y+V + A  GELF+ ++ KG   E +A++   QI
Sbjct: 89  ELKILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILSKGKFTEIDAVKIVTQI 148

Query: 139 IIGMSYCHALGIVHRDLKPENILLDHKLN---IKIADFGMAA-LETEDKLLETSCGSPHY 194
           +  + Y H+  IVHRDLKPENIL     +   + +ADFG+A  L++ D+L+  + GS  Y
Sbjct: 149 LSAVQYIHSKNIVHRDLKPENILYIDPSDDSPLVLADFGIAKELKSGDELIFKAAGSLGY 208

Query: 195 AAPEIV--SGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKG----EF 248
            APE++  SG   HG   D+WS GV+ + LL+G  PF  E  ++   L +  +G    +F
Sbjct: 209 VAPEVLTTSG---HGKPCDIWSLGVVTYTLLSGYSPFIAE--SVEGFLEECTEGSKPVKF 263

Query: 249 EMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKD 295
             P  D IS +A++ + + LV+ P KR  + E+L+ P +    S K+
Sbjct: 264 HKPYWDGISDDAKNFILRALVLSPSKRPTATELLEDPWITCCTSCKN 310

>Suva_16.157 Chr16 complement(270891..273389) [2499 bp, 832 aa] {ON}
           YPL153C (REAL)
          Length = 832

 Score =  157 bits (396), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 91/294 (30%), Positives = 153/294 (52%), Gaps = 36/294 (12%)

Query: 21  LGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREI 80
           + E +G G+   V+ A   +T +  A+K+I                        G+ RE+
Sbjct: 200 IDEVVGQGAFATVKKAIERTTGKTFAVKIISKRKVIGNMD--------------GVTREL 245

Query: 81  IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIII 140
            +++ L+HP ++RL   +E   + YMV+E+   G+L + +   G + E+      RQI+ 
Sbjct: 246 EVLQKLHHPRIVRLKGFYEDTESYYMVMEFVSGGDLMDFVAAHGAVGEDAGREISRQILE 305

Query: 141 GMSYCHALGIVHRDLKPENILL--DHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPE 198
            + Y H++GI HRDLKP+NIL+  D  + +KI DFG+A ++     ++T CG+  Y APE
Sbjct: 306 AVKYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPE 365

Query: 199 IVSGL-------------PYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQ 244
           ++ G               Y  L  D+WS G +++ +LTG LPF    G+ ++ L K + 
Sbjct: 366 VIRGKDSSVSPDEYEERNEYSSL-VDMWSMGCLVYVILTGHLPF---SGSTQDQLYKQIG 421

Query: 245 KGEF-EMPGDD-EISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDS 296
           +G + E P  D  IS+EA+D +  +L VDP  R+ + + L HP ++  P +  S
Sbjct: 422 RGSYHEGPLKDFRISEEARDFIDSLLQVDPNNRLTAAKALCHPWIKMNPLVSQS 475

>Ecym_3035 Chr3 complement(70391..72613) [2223 bp, 740 aa] {ON}
           similar to Ashbya gossypii ACL006W
          Length = 740

 Score =  155 bits (393), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 129/209 (61%), Gaps = 6/209 (2%)

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFR-Q 137
           EI I K + HPN+++  D +E + N+Y++LE    G L +LL ++  L E E +RFF  Q
Sbjct: 120 EIQIHKSMRHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE-VRFFTTQ 178

Query: 138 IIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLE-TSCGSPHYAA 196
           I+  + Y H+  I+HRDLK  NI  D   N+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 179 IVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIA 238

Query: 197 PEIVSGLPY-HGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           PE+++G    H  E DVWS GV+++ALL G+ PF  ++ N   +  +++  +F  P D  
Sbjct: 239 PEVLTGKHTGHSFEVDVWSIGVMIYALLIGKPPFQAKEVN--TIYERIKVCDFNFPRDKP 296

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKH 284
           IS EA+ L+  IL +DP +R    EI+++
Sbjct: 297 ISSEAKVLIKDILSLDPLERPSLTEIMEY 325

>ACL006W Chr3 (344395..346521) [2127 bp, 708 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR001C (CDC5)
          Length = 708

 Score =  155 bits (392), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 83/209 (39%), Positives = 129/209 (61%), Gaps = 6/209 (2%)

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFR-Q 137
           EI I K + HPN+++  D +E + N+Y++LE    G L +LL ++  L E E +RFF  Q
Sbjct: 120 EIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSLMDLLKQRKQLTEPE-VRFFTTQ 178

Query: 138 IIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLE-TSCGSPHYAA 196
           I+  + Y H+  I+HRDLK  NI  D   N+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 179 IVGAIKYMHSRRIIHRDLKLGNIFFDKHFNLKIGDFGLAAVLANDRERKYTICGTPNYIA 238

Query: 197 PEIVSGLPY-HGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           PE+++G    H  E D+WS GV+++ALL G+ PF  ++ N   +  +++  +F  P D  
Sbjct: 239 PEVLTGKHTGHSFEVDIWSIGVMIYALLIGKPPFQAKEVN--TIYERIKVCDFSFPKDKP 296

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKH 284
           IS EA+ L+  IL +DP +R    EI+++
Sbjct: 297 ISSEAKVLIKDILSLDPLERPSLAEIMEY 325

>NCAS0D02100 Chr4 (385878..388058) [2181 bp, 726 aa] {ON} Anc_6.31
          Length = 726

 Score =  155 bits (392), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 80/207 (38%), Positives = 126/207 (60%), Gaps = 6/207 (2%)

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           EI I K + HPN++   D +E + N+Y++LE    G L +L+ ++  L E E +RFF   
Sbjct: 139 EIQIHKSMKHPNIVHFVDCFEDDTNVYILLEICSNGSLMDLMKKRKTLTEPE-VRFFTTQ 197

Query: 139 IIG-MSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLE-TSCGSPHYAA 196
           I G + Y H+  ++HRDLK  NI  D   N+K+ DFG+AA+   ++  + T CG+P+Y A
Sbjct: 198 ICGAVKYMHSRRVIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANNRERKYTVCGTPNYIA 257

Query: 197 PEIVSG-LPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           PE++ G    H  E D+WS GV+++ALL G+ PF  +D N+  +  +++  ++  P D  
Sbjct: 258 PEVLMGKHAGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYDRIKACQYGYPKDKY 315

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREIL 282
           +S EA+ L+  IL VDP +R   REI+
Sbjct: 316 VSSEAKTLIADILCVDPVERPSIREII 342

>TBLA0B00490 Chr2 complement(94755..97118) [2364 bp, 787 aa] {ON}
           Anc_6.31 YMR001C
          Length = 787

 Score =  156 bits (394), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 87/237 (36%), Positives = 136/237 (57%), Gaps = 7/237 (2%)

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFR-Q 137
           EI I K + H N+++  D +E + N+Y++L     G L  LL ++  L E E +RFF  Q
Sbjct: 189 EIQIHKSMKHQNIVQFVDCFEDHINVYILLGMCPNGSLMELLKKRKILTEPE-VRFFTVQ 247

Query: 138 IIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLE-TSCGSPHYAA 196
           I   + Y H+  ++HRDLK  NI  D   N+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 248 ICGAIKYMHSRRVIHRDLKLGNIFFDENYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 307

Query: 197 PEIVSG-LPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           PE++ G    H  E D+WS GV++FALL G+ PF  +D N   +  +++  E+  P +  
Sbjct: 308 PEVLLGKHSGHSYEVDIWSIGVMIFALLIGKPPFQAKDVN--TIYSRIKNSEYTFPINKS 365

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQ-KYPSIKDSKTIRNLPREDTYLNP 311
           IS+EA+ L+  IL+ DP  R    EI+++   +  +PS+  +     +P  D +L P
Sbjct: 366 ISQEAKTLIQDILINDPIARPSINEIMEYVWFRGTFPSMTSNTVFTEIPEYDQFLTP 422

>TPHA0O01120 Chr15 complement(217462..218751) [1290 bp, 429 aa] {ON}
           Anc_1.374 YFR014C
          Length = 429

 Score =  150 bits (379), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 87/273 (31%), Positives = 144/273 (52%), Gaps = 18/273 (6%)

Query: 21  LGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREI 80
            G+TLG GS G V+ A   ST +  A+K++                         +  E+
Sbjct: 40  FGKTLGAGSFGVVRQARRISTGEDVAVKILLKKALQGNEVHLQM-----------LYDEL 88

Query: 81  IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIII 140
            I++ L+HP+++   D +E+ +  Y+V + A  GELF+ ++ +G   EN+A++   Q++ 
Sbjct: 89  SILQRLHHPHIVAFKDWFESKDKFYIVTQLATGGELFDRILARGKFTENDAVKIIYQLLD 148

Query: 141 GMSYCHALGIVHRDLKPENILL---DHKLNIKIADFGMA-ALETEDKLLETSCGSPHYAA 196
            + Y H+  +VHRDLKPENIL        ++ IADFG+A  L+  D ++  + GS  Y A
Sbjct: 149 AVKYIHSQNVVHRDLKPENILYVNNSDNSDLVIADFGIAKQLKNNDDMIFKAAGSLGYVA 208

Query: 197 PEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPGDD 254
           PE+++ +  HG   D+WS GVI + LL+G   F  E  +G +           F  P  D
Sbjct: 209 PEVLT-VNGHGKACDIWSLGVITYTLLSGYSAFIAESVEGFLEECTSSTYPVTFHRPYWD 267

Query: 255 EISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
           +IS EA+  +   L ++PE+R  + ++L HP +
Sbjct: 268 KISDEAKKFILSALTIEPEERPTAEQLLSHPWI 300

>KLTH0H11396g Chr8 complement(973355..974668) [1314 bp, 437 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and to
           YFR014C uniprot|P27466 Saccharomyces cerevisiae YFR014C
           CMK1 Calmodulin-dependent protein kinase
          Length = 437

 Score =  150 bits (379), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 92/275 (33%), Positives = 143/275 (52%), Gaps = 22/275 (8%)

Query: 21  LGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREI 80
            G TLG GS G V+ A   ST +  A+K++                         +  E+
Sbjct: 48  FGRTLGAGSFGVVRQARKLSTGENVAVKILLKKALKGKDVQLQM-----------LYDEL 96

Query: 81  IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIII 140
            I++ L+HPN+++  D +E+ +  Y+V + A  GELF+ +++KG   E +A+R   QI+ 
Sbjct: 97  SILQKLDHPNIVKFKDWFESKDKFYIVTQLAMGGELFDRILKKGKFTEKDAVRIVYQILK 156

Query: 141 GMSYCHALGIVHRDLKPENIL-LDHKLN--IKIADFGMAA-LETEDKLLETSCGSPHYAA 196
            + Y H+  IVHRDLKPEN+L L  K +  + + DFG+A  L  ED+L+  + GS  Y A
Sbjct: 157 AVEYLHSRNIVHRDLKPENLLYLAEKDDSPLVLGDFGIAKELNNEDELIHKAAGSMGYVA 216

Query: 197 PEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE----FEMPG 252
           PE+++    HG   D+WS GV+ + LL G  PF  E  ++   L +   G     F  P 
Sbjct: 217 PEVLT-TSGHGKPCDIWSLGVVTYTLLCGYSPFVAE--SVEGFLEECTSGRYPVTFHKPY 273

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
              IS +A+D + + L V P  R  + E+L H  +
Sbjct: 274 WSSISDDAKDFILQALTVTPRYRPSATELLNHKWI 308

>Smik_7.319 Chr7 complement(534132..535472) [1341 bp, 446 aa] {ON}
           YFR014C (REAL)
          Length = 446

 Score =  150 bits (379), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 88/277 (31%), Positives = 150/277 (54%), Gaps = 22/277 (7%)

Query: 19  WKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIER 78
           +  G+TLG G+ G V+ A N  T +  A+K++                         +  
Sbjct: 37  YVFGKTLGAGTFGVVRQARNTETGEDVAVKILIKKALKGNKIQLE-----------ALYD 85

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           E+ I++ L+HPN++   D +E+ +  Y++ + A+ GELF+ +++KG   E +A+R   +I
Sbjct: 86  ELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILVEI 145

Query: 139 IIGMSYCHALGIVHRDLKPENILLDHKLN---IKIADFGMAA-LETEDKLLETSCGSPHY 194
           +  + Y H+  IVHRDLKPEN+L   K +   + +ADFG+A  L+++++L+    GS  Y
Sbjct: 146 LSAVKYMHSQNIVHRDLKPENLLYIDKSDESPLVVADFGIAKRLKSDEELIYKPAGSLGY 205

Query: 195 AAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE----FEM 250
            APE+++    HG   D+WS GVI + LL G   F  E   +++ L +   GE    F  
Sbjct: 206 VAPEVLTQ-DGHGKPCDIWSLGVITYTLLCGYSAFKAE--RVQDFLDECTTGEYPVRFHR 262

Query: 251 PGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
           P  D +S +A+  + K L +DP KR  + ++L+ P +
Sbjct: 263 PYWDSVSDKAKQFILKALNLDPSKRPTAAQLLEDPWI 299

>KAFR0H02430 Chr8 complement(464446..466800) [2355 bp, 784 aa] {ON}
           Anc_8.676 YPL153C
          Length = 784

 Score =  155 bits (392), Expect = 5e-38,   Method: Compositional matrix adjust.
 Identities = 89/281 (31%), Positives = 146/281 (51%), Gaps = 32/281 (11%)

Query: 23  ETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREIII 82
           E +G G+   V+ A   +T +  A+K+I                        G+ RE+ +
Sbjct: 191 EVVGQGAFATVKKAVERTTGKTYAVKIINKRKVMGNLD--------------GVTRELEV 236

Query: 83  MKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGM 142
           +K LNHP ++ L   +E N + YMV+E+   G+L + +   G + E+      RQI+  +
Sbjct: 237 LKRLNHPRIVSLKGFYEDNESYYMVMEFVSGGDLMDFVAAHGAVGEDAGKEISRQILEAV 296

Query: 143 SYCHALGIVHRDLKPENILL--DHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 200
            Y H++GI HRDLKP+NIL+  D  + +KI DFG+A ++     ++T CG+  Y APE++
Sbjct: 297 KYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVI 356

Query: 201 SGLPYHGLE----------TDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQKGEF- 248
                +  E           D+WS G +++ +LTG LPF    G+ +  L K + +G + 
Sbjct: 357 GSSSKYNEEDEERNEYSSLVDMWSMGCLVYVILTGHLPF---SGSTQEQLYKQISRGSYH 413

Query: 249 EMP-GDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQ 288
           E P  D  IS EA+D +  +L VDP  R+ +   L+HP ++
Sbjct: 414 EGPLKDYRISDEARDFIDSLLQVDPSNRLTAARALEHPWIK 454

>NDAI0H03520 Chr8 (860096..861472) [1377 bp, 458 aa] {ON} 
          Length = 458

 Score =  150 bits (379), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 90/271 (33%), Positives = 153/271 (56%), Gaps = 18/271 (6%)

Query: 19  WKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIER 78
           ++ G+TLG GS G V+ A   S+N++ A+K++                         + +
Sbjct: 31  YEFGKTLGAGSFGIVRQAKRISSNEEVAVKILLKQALRENAIQLRM-----------LYQ 79

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           E+ I+K L+H N++   + +ET++ LY+V + A  GELF+ ++ +G   E++A++   QI
Sbjct: 80  ELSILKKLHHRNIVEFKNWFETDDKLYIVTQLATGGELFDRIIMEGKFTEDDAVKIIVQI 139

Query: 139 IIGMSYCHALGIVHRDLKPENILL---DHKLNIKIADFGMA-ALETEDKLLETSCGSPHY 194
           +  + Y H+  IVHRDLKPEN+L    +    + IADFG+A  L++ ++L+  + GS  Y
Sbjct: 140 LSAVEYIHSKNIVHRDLKPENLLYLTKEKDSQLVIADFGIAKELKSGEELIFKAAGSLGY 199

Query: 195 AAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPG 252
            APE+++ +  HG   D+WS GVI + LL G   F  E  +G +   +   Q  +F+ P 
Sbjct: 200 VAPEVLT-VNGHGKPCDIWSLGVITYTLLCGYSAFKAETVEGFLDECIANDQPVQFQKPY 258

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILK 283
            D IS+ A++ + K L + PE+R  + E+LK
Sbjct: 259 WDNISQSAKNFILKCLDLTPEQRPTATELLK 289

>SAKL0D07656g Chr4 complement(627469..628767) [1299 bp, 432 aa] {ON}
           similar to uniprot|P22517 Saccharomyces cerevisiae
           YOL016C CMK2 Calmodulin-dependent protein kinase and
           uniprot|P27466 Saccharomyces cerevisiae YFR014C CMK1
          Length = 432

 Score =  149 bits (377), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 92/270 (34%), Positives = 146/270 (54%), Gaps = 22/270 (8%)

Query: 21  LGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREI 80
            G+TLG GS G V+ A   ST    A+K++                   D     +  E+
Sbjct: 48  FGKTLGAGSFGVVRQARKISTGDNVAVKILLKKALKGN-----------DVQLQMLYDEL 96

Query: 81  IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIII 140
           +I++ LNHPN+++  D +E+    Y+V + A  GELF+ +++KG   E +A++   QI+ 
Sbjct: 97  MILQKLNHPNIVKFKDWFESKEKFYIVTQLATGGELFDRILQKGKFTEVDAVKIVVQILK 156

Query: 141 GMSYCHALGIVHRDLKPENIL-LDHKLN--IKIADFGMAA-LETEDKLLETSCGSPHYAA 196
            + Y H+  IVHRDLKPEN+L LD   N  + + DFG+A  L+ +  L+  + GS  Y A
Sbjct: 157 AVEYLHSRNIVHRDLKPENLLYLDKSDNSQLVLGDFGIAKELKNDGDLIHKAAGSMGYVA 216

Query: 197 PEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE----FEMPG 252
           PE+++    HG   D+WS GVI + LL G  PF  E  ++   L +   G+    F  P 
Sbjct: 217 PEVLTS-NGHGKPCDIWSIGVITYTLLCGYSPFIAE--SVDGFLEECTSGQYPVTFHKPY 273

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREIL 282
            + ISKEA+  + ++L + P+KR  + ++L
Sbjct: 274 WNNISKEAKLFILRVLTISPKKRPTATDLL 303

>Kwal_0.96 s0 complement(46082..47365) [1284 bp, 427 aa] {ON}
           YOL016C (CMK2) - Calmodulin-dependent protein kinase
           [contig 76] FULL
          Length = 427

 Score =  149 bits (377), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 95/291 (32%), Positives = 150/291 (51%), Gaps = 26/291 (8%)

Query: 21  LGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREI 80
            G+TLG GS G V+ A   S+ +  AIK++                         +  E+
Sbjct: 48  FGKTLGAGSFGVVRQARQVSSGENVAIKILLKKALKGKDVELQM-----------LYDEL 96

Query: 81  IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIII 140
            I++ L+HPN+++  D +E+ +  Y+V + A  GELF+ ++++G   E +A+R   QI+ 
Sbjct: 97  SILQKLDHPNIVKFKDWFESKDKFYIVTQLATGGELFDRILKQGKFTEEDAVRIVYQILK 156

Query: 141 GMSYCHALGIVHRDLKPENILL-----DHKLNIKIADFGMAA-LETEDKLLETSCGSPHY 194
            + Y H+  IVHRDLKPEN+L      D +L   + DFG+A  L+ +D+L+  + GS  Y
Sbjct: 157 AVEYLHSRNIVHRDLKPENLLYLTEAADSQL--VLGDFGIAKELKNDDELIHKAAGSMGY 214

Query: 195 AAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPG 252
            APE+V+    HG   D+WS GV+ + LL G  PF  E  +G +    +      F  P 
Sbjct: 215 VAPEVVT-TSGHGKPCDIWSLGVVTYTLLCGYSPFVAESVEGFLEECTIGRTPVTFHKPY 273

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLP 303
              IS EA+D + + L V+P  R  + E+L+   +      K +KT   LP
Sbjct: 274 WSNISNEAKDFILRALTVNPHDRPTATELLQDAWIIS----KTTKTANLLP 320

>Kpol_1069.13 s1069 complement(27223..28506) [1284 bp, 427 aa] {ON}
           complement(27223..28506) [1284 nt, 428 aa]
          Length = 427

 Score =  149 bits (377), Expect = 6e-38,   Method: Compositional matrix adjust.
 Identities = 91/277 (32%), Positives = 149/277 (53%), Gaps = 22/277 (7%)

Query: 19  WKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIER 78
           +  G+TLG GS G V+ A   ST +  A+K++                         +  
Sbjct: 38  YVFGKTLGAGSFGVVRQARRISTGENVAVKILLKKALKGNCVQIEM-----------LYD 86

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           E+ I++ L+HPN++     +E+ +  Y+  + A  GELF+ ++ +G   E +A+R   Q+
Sbjct: 87  ELSILQKLHHPNIVDFKAWFESKDKFYIATQLATGGELFDRILARGKFTEVDAVRIIVQL 146

Query: 139 IIGMSYCHALGIVHRDLKPENILLDHKLN---IKIADFGMA-ALETEDKLLETSCGSPHY 194
           + G+ Y H+  IVHRDLKPEN+L   K +   + IADFG+A  L++ D L+  + GS  Y
Sbjct: 147 LQGIKYIHSKDIVHRDLKPENVLYIDKSDDSPLVIADFGIAKQLKSGDDLIFKAAGSLGY 206

Query: 195 AAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKG----EFEM 250
            APE+++ +  HG   D+WS GVI + LL G  PF  E  ++   L +   G    +F  
Sbjct: 207 VAPEVLT-VNGHGKPCDIWSLGVITYTLLCGYSPFIAE--SVEGFLDECTSGKYPVKFHR 263

Query: 251 PGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
           P  D IS EA++ + + L+++P KR  + E+L+ P +
Sbjct: 264 PYWDTISDEAKEFILRALILEPSKRPTASELLEDPWI 300

>Suva_6.78 Chr6 (135988..137325) [1338 bp, 445 aa] {ON} YFR014C
           (REAL)
          Length = 445

 Score =  149 bits (377), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 89/275 (32%), Positives = 150/275 (54%), Gaps = 22/275 (8%)

Query: 21  LGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREI 80
            G+TLG G+ G V+ A N  T +  A+K++                         +  E+
Sbjct: 39  FGKTLGAGTFGVVRQARNSETGEDVAVKILIKKALKGNKIQLE-----------ALYDEL 87

Query: 81  IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIII 140
            I++ L+HPN++   D +E+N+  Y++ + A+ GELF+ +++KG   E +A+R   +I+ 
Sbjct: 88  DILQRLHHPNIVAFKDWFESNDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILVEILS 147

Query: 141 GMSYCHALGIVHRDLKPENILLDHKLN---IKIADFGMAA-LETEDKLLETSCGSPHYAA 196
            + Y H+  IVHRDLKPEN+L   K +   + IADFG+A  L+++++L+  + GS  Y A
Sbjct: 148 AVKYMHSQNIVHRDLKPENLLYIDKSDESPLVIADFGIAKRLKSDEELIYKAAGSLGYVA 207

Query: 197 PEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE----FEMPG 252
           PE+++    HG   D+WS GVI + LL G   F  E   + + L +   G+    F  P 
Sbjct: 208 PEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFKAE--RVLDFLDECTTGKYPVTFHRPY 264

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
            D +S +A+  + K L ++P KR  + E+L+ P +
Sbjct: 265 WDSVSDKAKRFILKALDLNPAKRPTAAELLEDPWI 299

>NDAI0E02110 Chr5 complement(430989..433700) [2712 bp, 903 aa] {ON} 
          Length = 903

 Score =  155 bits (392), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 91/287 (31%), Positives = 149/287 (51%), Gaps = 38/287 (13%)

Query: 23  ETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREIII 82
           E +G G+   V+ A   ST +  A+K+I                        G+ RE+ +
Sbjct: 206 EVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGSNMD-------------GVSRELEV 252

Query: 83  MKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGM 142
           ++ L+HP ++RL   +E + N YM++E+   G+L + +   G + E+      RQI+  +
Sbjct: 253 LQRLDHPRIVRLKGFYEDHENYYMLMEFVSGGDLMDFVAAHGAVGEDAGREISRQILEAI 312

Query: 143 SYCHALGIVHRDLKPENILL--DHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 200
            Y H++GI HRDLKP+NIL+  D  + +KI DFG+A ++     ++T CG+  Y APEI+
Sbjct: 313 KYIHSMGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQDNGTFMKTFCGTLAYVAPEII 372

Query: 201 SGL----------------PYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-V 243
           SG                  Y  L  D+WS G +++ +LTG LPF    G+ +  L K +
Sbjct: 373 SGKNDGELRENADANSERNEYSSL-VDMWSMGCLVYVILTGHLPF---SGSTQKQLYKQI 428

Query: 244 QKGEF-EMPGDD-EISKEAQDLLYKILVVDPEKRIKSREILKHPLLQ 288
            +G + E P  D  IS EA+D +  +L V P  R+ + + L+HP ++
Sbjct: 429 SRGSYHEGPLKDFRISDEARDFIDSLLQVKPNDRLTAEKALEHPWIK 475

>Ecym_1275 Chr1 complement(560481..561836) [1356 bp, 451 aa] {ON}
           similar to Ashbya gossypii AAR009W
          Length = 451

 Score =  150 bits (378), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 91/274 (33%), Positives = 151/274 (55%), Gaps = 30/274 (10%)

Query: 21  LGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREI 80
            G+TLG G+ G V+ A N + ++  A+K++                   D L+  +  E+
Sbjct: 56  FGKTLGAGAFGVVRQARNSNNDEDVAVKILLKRALKG------------DELNM-LYDEL 102

Query: 81  IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIII 140
           +I++ L+HP++++  D +E+ +  Y+V + A  GELF+ +++KG   E +A++   Q++ 
Sbjct: 103 MILQKLDHPHIVKFKDWFESKDKFYIVTQLATGGELFDRILKKGRFTETDAVKIVVQMLE 162

Query: 141 GMSYCHALGIVHRDLKPENILLDHKLN------IKIADFGMA-ALETEDKLLETSCGSPH 193
            + Y H+  +VHRDLKPEN+L    LN      + I+DFG+A  L +ED L+  + GS  
Sbjct: 163 AIEYMHSKNVVHRDLKPENVLY---LNPSDDSELVISDFGIAKQLSSEDHLIHRAAGSMG 219

Query: 194 YAAPEIV--SGLPYHGLETDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFE 249
           Y APE++  SG   HG   D+WS GVI + LL G  PF  E  +G +  +        F 
Sbjct: 220 YVAPEVLTTSG---HGKPCDIWSLGVITYTLLCGYSPFVAESSEGFLEEVTRSKYPVTFH 276

Query: 250 MPGDDEISKEAQDLLYKILVVDPEKRIKSREILK 283
            P  + IS EA++ + K L +DP +R  + E+L+
Sbjct: 277 KPYWNSISVEAKEFILKALTLDPSERPTATELLQ 310

>KAFR0C04480 Chr3 (894906..896213) [1308 bp, 435 aa] {ON} Anc_1.374
           YFR014C
          Length = 435

 Score =  149 bits (376), Expect = 8e-38,   Method: Compositional matrix adjust.
 Identities = 90/275 (32%), Positives = 147/275 (53%), Gaps = 22/275 (8%)

Query: 21  LGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREI 80
            G+TLG G+ G V+ A   STN+  A+K++                         +  E+
Sbjct: 34  FGKTLGAGTFGVVRQARKLSTNEDVAVKILLKKALEGNSVQLQM-----------LYDEL 82

Query: 81  IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIII 140
            I++ LNHPN++   D +ET    ++V + A  GELF+ +V+KG   E +AI+   QI+ 
Sbjct: 83  SILQRLNHPNIVEFKDWFETKEKFFIVTQLATGGELFDRIVKKGKFTEEDAIKILVQILG 142

Query: 141 GMSYCHALGIVHRDLKPENILLDHKLN---IKIADFGMAA-LETEDKLLETSCGSPHYAA 196
            + Y H+  IVHRDLKPEN+L   + +   + +ADFG+A  L++ D+L+  + GS  Y A
Sbjct: 143 AVEYIHSRNIVHRDLKPENLLYIDEADTSPLVLADFGIAKELKSGDELIFKAAGSLGYVA 202

Query: 197 PEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE----FEMPG 252
           PE+++    HG   D+WS GVI + LL G   F  E  ++   L +  + +    F  P 
Sbjct: 203 PEVLTS-DGHGKPCDIWSIGVITYTLLCGYSAFAAE--SVEGFLDECTQNDKPVVFHKPY 259

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
            D +S++A+  + + L +DP KR  +  +L+ P +
Sbjct: 260 WDNVSEDARKFILRALTLDPTKRPTATALLEDPWI 294

>KLTH0D11242g Chr4 (918232..920619) [2388 bp, 795 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 795

 Score =  154 bits (390), Expect = 9e-38,   Method: Compositional matrix adjust.
 Identities = 88/279 (31%), Positives = 145/279 (51%), Gaps = 31/279 (11%)

Query: 23  ETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREIII 82
           E +G G+   V+ A    T +  A+K+I                        G+ RE+ +
Sbjct: 192 EVVGQGAFATVKKAIERRTGKTHAVKIINKRKVMGNMD--------------GVTRELEV 237

Query: 83  MKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGM 142
           ++ LNHP ++ L   +E   + Y+V+E+   G+L + +   G + E+      RQ++  +
Sbjct: 238 LRRLNHPRIVSLKGFYEDKESYYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEAV 297

Query: 143 SYCHALGIVHRDLKPENILL--DHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 200
            Y HA+GI HRDLKP+NIL+  D  + +KI DFG+A ++     ++T CG+  Y APE++
Sbjct: 298 KYIHAMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQDNGTFMKTFCGTLAYVAPEVI 357

Query: 201 SGL--------PYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQKGEF-EM 250
           SG          Y  L  D+WS G +++ +LTG LPF    G+ +  L K +  G + E 
Sbjct: 358 SGKNSEEKEGNKYSSL-VDMWSIGCLVYVILTGHLPF---SGSTQQELYKQISAGSYHEG 413

Query: 251 P-GDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQ 288
           P  D  IS +A+D +   L V+P  R+ + + LKHP ++
Sbjct: 414 PLKDYRISDDARDFIESFLQVNPRDRMTAEQALKHPWIR 452

>CAGL0M02233g Chr13 complement(267332..269635) [2304 bp, 767 aa]
           {ON} highly similar to uniprot|P22216 Saccharomyces
           cerevisiae YPL153c SPK1 ser/thr/tyr protein kinase
          Length = 767

 Score =  154 bits (389), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 93/296 (31%), Positives = 151/296 (51%), Gaps = 37/296 (12%)

Query: 23  ETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREIII 82
           E +G G+   V+ A   +T +  A+K+I                        G+ RE+ +
Sbjct: 192 EVVGTGAFATVKKAVERNTGKTFAVKIINKRKVVGNMD--------------GVSRELEV 237

Query: 83  MKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGM 142
           ++ LNHP ++ L   +E   N YMV+E+   G+L + +   G + E       RQI+  +
Sbjct: 238 LQKLNHPRIVSLKAFYEDEANYYMVMEFISGGDLMDFVAAHGAVGEEAGREISRQILEAI 297

Query: 143 SYCHALGIVHRDLKPENILL--DHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 200
            Y H+ GI HRDLKP+NIL+  D  + +KI DFG+A ++    +++T CG+  Y APE++
Sbjct: 298 QYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSIMKTFCGTLAYVAPEVI 357

Query: 201 SGLP--------------YHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLL-KVQK 245
            G                Y  L  D+WS G ++F +LTG LPF    G+ +  L  +++K
Sbjct: 358 GGFTGATGEEETEEERIEYSSL-VDMWSMGCLVFVILTGHLPF---SGSTQEQLYEQIRK 413

Query: 246 GEF-EMPGDD-EISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTI 299
           G + E P  D  IS EA+D +  +L VD  KR+   + L HP +++  S  D+ ++
Sbjct: 414 GSYHEGPLKDFRISDEARDFIDGLLQVDQSKRMTVDDALNHPWIKQCSSQFDANSM 469

>KLLA0F23155g Chr6 (2157146..2158429) [1284 bp, 427 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016C CMK2
           Calmodulin-dependent protein kinase and uniprot|P27466
           Saccharomyces cerevisiae YFR014C CMK1
          Length = 427

 Score =  149 bits (375), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 90/268 (33%), Positives = 142/268 (52%), Gaps = 18/268 (6%)

Query: 21  LGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREI 80
            G+TLG G+ G V+ A   S+ +  A+K++                         +  E+
Sbjct: 48  FGKTLGAGTFGVVRQARCISSGENVAVKILLKKALKGQSVQLQM-----------LYDEL 96

Query: 81  IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIII 140
            I++ LNHPN++R  D +E+    Y+V + A  GELF+ ++EKG   E +A+   +QI+ 
Sbjct: 97  SILQQLNHPNIVRFKDWFESKEKFYIVTQLATGGELFDRILEKGKFCEVDAVFIVKQILQ 156

Query: 141 GMSYCHALGIVHRDLKPENILLDHKLN---IKIADFGMAA-LETEDKLLETSCGSPHYAA 196
           G+ Y H   IVHRDLKPENIL  +K +   + I DFG+A  L+ +++L+  + GS  Y A
Sbjct: 157 GVQYLHQRNIVHRDLKPENILYLNKSDDSPLVIGDFGIAKELKDDNELIHKAAGSMGYVA 216

Query: 197 PEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPGDD 254
           PE+++    HG   D+WS GVI + LL G  PF  E  DG I           F  P  +
Sbjct: 217 PEVLTS-SGHGKPCDIWSIGVITYTLLCGYSPFLAESADGFIEECTSGQYPVVFHKPYWN 275

Query: 255 EISKEAQDLLYKILVVDPEKRIKSREIL 282
            +SK A++ +   L V P++R  + +++
Sbjct: 276 NVSKTAKEFILWALTVSPKRRPTATDLI 303

>Kwal_26.8796 s26 (946406..948796) [2391 bp, 796 aa] {ON} YPL153C
           (RAD53) - protein kinase, Mec1p and Tel1p regulate
           rad53p phosphorylation [contig 68] FULL
          Length = 796

 Score =  154 bits (389), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 88/279 (31%), Positives = 148/279 (53%), Gaps = 31/279 (11%)

Query: 23  ETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREIII 82
           E +G G+   V+ A    T +  A+K+I                     +  G+ RE+ +
Sbjct: 192 EVVGQGAFATVKKAIERKTGKTHAVKIISKRKVV--------------GVMDGVARELEV 237

Query: 83  MKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGM 142
           ++ L+HP ++ L   +E  ++ Y+V+E+   G+L + +   G + E+      RQI+  +
Sbjct: 238 LQRLDHPRIVSLKGFYEDKDSHYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAV 297

Query: 143 SYCHALGIVHRDLKPENILL--DHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 200
            Y H++GI HRDLKP+NIL+  D  + +KI DFG+A ++     ++T CG+  Y APE++
Sbjct: 298 KYIHSMGISHRDLKPDNILIERDDPVLVKITDFGLAKIQGNGTFMKTFCGTLAYVAPEVI 357

Query: 201 SGL--------PYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQKGEF-EM 250
           SG          Y  L  D+WS G +++ +LTG LPF    G+ +N L K +  G + E 
Sbjct: 358 SGKNSGEKEGNTYSSL-VDMWSIGCLVYVILTGHLPF---SGSTQNDLYKQITAGSYHEG 413

Query: 251 P-GDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQ 288
           P  D  IS +A+D +   L VDP  R+ + + L+HP ++
Sbjct: 414 PLKDYRISDDARDFIESFLQVDPRNRMTAEQALRHPWIK 452

>Suva_13.163 Chr13 complement(259136..261253) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  152 bits (385), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 91/242 (37%), Positives = 135/242 (55%), Gaps = 13/242 (5%)

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           EI I K + HPN+++  D +E ++N+Y++LE    G L  LL  +  L E E +RFF   
Sbjct: 129 EIQIHKSMAHPNIVQFVDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFTTQ 187

Query: 139 IIG-MSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAA-LETEDKLLETSCGSPHYAA 196
           I G + Y H+  ++HRDLK  NI  D   N+KI DFG+AA L  E +   T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIA 247

Query: 197 PEIVSG-LPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           PE++ G    H  E D+WS GV+L+ALL G+ PF   D N   +  +++  +F  P D  
Sbjct: 248 PEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPKDKP 305

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY--PSI-----KDSKTIRNLPREDTY 308
           IS E + L+  IL +DP +R    EI+ +   +    PSI      ++    N+P E + 
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEASNFDNIPEEQSL 365

Query: 309 LN 310
           +N
Sbjct: 366 IN 367

>KNAG0E00850 Chr5 complement(158992..161127) [2136 bp, 711 aa] {ON}
           Anc_6.31 YMR001C
          Length = 711

 Score =  152 bits (384), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 87/242 (35%), Positives = 135/242 (55%), Gaps = 12/242 (4%)

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           EI I K + H NV++  D +E + N+Y++LE    G L  LL ++  + E E   F  QI
Sbjct: 138 EIQIHKSMRHFNVVQFIDCFEDDTNVYILLEICPNGSLMELLKKRRTVTEPEVRYFMTQI 197

Query: 139 IIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLE-TSCGSPHYAAP 197
              + Y H+  ++HRDLK  NI  D   N+KI DFG+AA+   D+  + T CG+P+Y AP
Sbjct: 198 CGAIKYMHSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAP 257

Query: 198 EIVSG-LPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDEI 256
           E++ G    H  E D+WS GV+++ALL G+ PF  +D N+  +  +++  +F  P D  I
Sbjct: 258 EVLMGKHSGHSYEVDIWSIGVMIYALLIGKPPFQSKDVNM--IYERIKNRDFAFPKDKYI 315

Query: 257 SKEAQDLLYKILVVDPEKRIKSREILKHPLLQK-YPSIKDSKTIRNLPR-------EDTY 308
           S EA+ L++ IL  DP +R    EI+ +   +  +PS   S  +   P        E++Y
Sbjct: 316 SNEAKTLIHDILSTDPLERPSIEEIIDYVWFRGIFPSCTLSTVMSEDPNYEQIISAEESY 375

Query: 309 LN 310
           +N
Sbjct: 376 IN 377

>Kpol_1065.3 s1065 complement(4445..5575) [1131 bp, 376 aa] {ON}
           complement(4445..5575) [1131 nt, 377 aa]
          Length = 376

 Score =  146 bits (369), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 85/284 (29%), Positives = 147/284 (51%), Gaps = 17/284 (5%)

Query: 6   KGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXX 65
           KG   +    +  +++G  LG G  GKV    ++ +    A+KV+               
Sbjct: 105 KGRFPMVDLKLNDFEIGRKLGKGKFGKVYCVRHKPSGLICALKVMNKMEIVNF------- 157

Query: 66  XXTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGP 125
                ++    +REI I   LNH N+ +LY  +  + N+Y+V+EY   GEL+ LL + GP
Sbjct: 158 -----NVQKQFKREIDIQYHLNHKNLTKLYAFFHDSKNVYLVMEYLIGGELYKLLKKNGP 212

Query: 126 LPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLL 185
           + +  A  +  Q+   ++Y H   I+HRDLKPENIL+     IK+ DFG +     ++  
Sbjct: 213 MNDITASNYVYQMTDALNYMHKRKIIHRDLKPENILIGFNNQIKLTDFGWSIYNPNNQKR 272

Query: 186 ETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQK 245
           +T CG+  Y +PE++S   Y     DVW+ G++ + L+ G  PF+E+         ++ K
Sbjct: 273 KTLCGTIDYLSPELISSREYDE-NVDVWALGILTYELVVGAPPFEEDTK--EQTYKRIAK 329

Query: 246 GEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
            + + P +  +S EA+DL+  +L V P +R   ++++ HP ++K
Sbjct: 330 SDLKFPPN--VSSEARDLITNLLKVVPSERFNLQQVMNHPWIEK 371

>Suva_15.155 Chr15 complement(267680..269038) [1359 bp, 452 aa] {ON}
           YOL016C (REAL)
          Length = 452

 Score =  148 bits (373), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 91/275 (33%), Positives = 143/275 (52%), Gaps = 18/275 (6%)

Query: 19  WKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIER 78
           +  G TLG GS G V+ A   STN+  AIK++                         +  
Sbjct: 47  YIFGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNIQLQM-----------LYE 95

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           E+ I++ L+HPN++   D +E+ +  Y+V + A  GELF+ ++ +G   E +A+    QI
Sbjct: 96  ELSILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEIDAVEIIVQI 155

Query: 139 IIGMSYCHALGIVHRDLKPENILLDHKLN---IKIADFGMA-ALETEDKLLETSCGSPHY 194
           +  + Y H+  +VHRDLKPEN+L   K +   + IADFG+A  L+ ++ L+  + GS  Y
Sbjct: 156 LGAVEYIHSKNVVHRDLKPENVLYVDKSDNSPLVIADFGIAKQLKGKEDLIYKAAGSLGY 215

Query: 195 AAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPG 252
            APE+++    HG   D+WS GVI + LL G  PF  E  +G +           F MP 
Sbjct: 216 VAPEVLTQ-DGHGKPCDIWSVGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPY 274

Query: 253 DDEISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
            D IS +A+  + K L+++P  R  + E+L  P +
Sbjct: 275 WDNISVDAKRFILKALILNPADRPTATELLDDPWI 309

>Skud_6.89 Chr6 (166257..167594) [1338 bp, 446 aa] {ON} YFR014C
           (REAL)
          Length = 446

 Score =  147 bits (372), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 87/277 (31%), Positives = 149/277 (53%), Gaps = 22/277 (7%)

Query: 19  WKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIER 78
           +  G+TLG G+ G V+ A N  T +  A+K++                         +  
Sbjct: 37  YVFGKTLGAGTFGVVRQARNTETGEDVAVKILIKKALKGNKIQLE-----------ALYD 85

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           E+ I++ L+HPN++   D +E+ +  Y++ + A+ GELF+ +++KG   E +A+R   +I
Sbjct: 86  ELDILQRLHHPNIVAFKDWFESKDKFYIITQLAKGGELFDRILKKGKFTEVDAVRILVEI 145

Query: 139 IIGMSYCHALGIVHRDLKPENILLDHKLN---IKIADFGMAA-LETEDKLLETSCGSPHY 194
           +  + Y H+  IVHRDLKPEN+L   K +   + +ADFG+A  L+++++L+    GS  Y
Sbjct: 146 LSAVKYMHSQNIVHRDLKPENLLYVDKSDESPLVVADFGIAKRLKSDEELIYKPAGSLGY 205

Query: 195 AAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE----FEM 250
            APE+++    HG   D+WS GVI + LL G   F  E   +++ L +   GE    F  
Sbjct: 206 VAPEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSAFKAE--RVQDFLDECTTGEHPVRFHR 262

Query: 251 PGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
           P  D +S +A+  + K L +DP +R  + ++L  P +
Sbjct: 263 PYWDSVSGKAKQFILKALNLDPAERPTAAQLLDDPWI 299

>KAFR0K00280 Chr11 complement(64906..65988) [1083 bp, 360 aa] {ON}
           Anc_6.222 YPL209C
          Length = 360

 Score =  145 bits (366), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 75/214 (35%), Positives = 122/214 (57%), Gaps = 5/214 (2%)

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           + REI I  +LNHPN+ +LY  +     +Y+V+EY  +GEL+ LL   GP  +  A  + 
Sbjct: 147 VRREIEIQTILNHPNLTKLYSFFHDEKRIYIVMEYLIQGELYKLLQSHGPFNDVLASNYV 206

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            QI   + Y H   I+HRD+KPENIL+     +K+ DFG + +  +    +T CG+  Y 
Sbjct: 207 YQIADALDYLHQKHIIHRDIKPENILIGFNNTVKLTDFGWSIINPKGIRRKTLCGTIDYL 266

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           +PEI++   Y     D+W+ GV+ + L+ G   F+EE   +     ++ KGE + P  + 
Sbjct: 267 SPEIITSKEYDH-TVDIWALGVLAYELVVGSPAFEEETKEMT--YKRIVKGELKFP--EH 321

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
           +    +DL+ +ILV++P KR+  +EI +HP + K
Sbjct: 322 LPNIVRDLIQRILVIEPSKRMSLKEIKRHPWILK 355

>SAKL0E01584g Chr5 complement(121830..123917) [2088 bp, 695 aa] {ON}
           highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001C
          Length = 695

 Score =  151 bits (382), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 82/231 (35%), Positives = 134/231 (58%), Gaps = 5/231 (2%)

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           EI I K + HPN+++  D +E + N+Y++LE    G L +LL ++  L E E   F  QI
Sbjct: 124 EIQIHKSMKHPNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKVLTEPEVRYFTTQI 183

Query: 139 IIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLE-TSCGSPHYAAP 197
           +  + Y H   ++HRDLK  NI  D   N+KI DFG+AA+   D+  + T CG+P+Y AP
Sbjct: 184 VGAIKYMHNRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIAP 243

Query: 198 EIVSG-LPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDEI 256
           E+++G    H  E D+WS GV+++ALL G+ PF  ++ NI  +  +++ G++  P +   
Sbjct: 244 EVLAGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKEVNI--IYERIKSGDYIFPREKPT 301

Query: 257 SKEAQDLLYKILVVDPEKRIKSREILKHPLLQK-YPSIKDSKTIRNLPRED 306
           SKE   L+  IL +DP +R    EI+ +   +  +P+  +   + ++P  D
Sbjct: 302 SKEVMVLIQDILSIDPIERPSLDEIMDYVWFRGIFPARINGDVLTSVPVYD 352

>NDAI0F01600 Chr6 complement(392424..393662) [1239 bp, 412 aa] {ON} 
          Length = 412

 Score =  146 bits (368), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 76/219 (34%), Positives = 126/219 (57%), Gaps = 5/219 (2%)

Query: 71  SLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENE 130
           +L     RE+ I   LNHPN+ +LY  +  +  +Y+++EY   GEL+ LL   GP  +  
Sbjct: 194 NLQRQFRREVEIQTSLNHPNLTKLYGHFYDDKRVYLIMEYLVYGELYKLLRSHGPFNDII 253

Query: 131 AIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCG 190
           A RF  QI   +++ H  GI+HRDLKPENIL+     +K+ DFG + +  +    +T CG
Sbjct: 254 ASRFVYQIADALNHLHEKGIIHRDLKPENILIGFNNVLKLTDFGWSIINPKGVKRKTLCG 313

Query: 191 SPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEM 250
           +  Y +PE++    Y     DVW+ GV+ + L+ G  PF+E+   +     ++ KGE   
Sbjct: 314 TIDYLSPEMIRSREYDD-TVDVWALGVLTYELVAGDPPFEEDSKEL--TYKRILKGEIRF 370

Query: 251 PGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
           PG   +S++ +DL+ ++L  DP++RI  +E++ HP + +
Sbjct: 371 PG--TVSQDVRDLISRLLKNDPKERILLKEVMVHPWIMR 407

>Kwal_56.24091 s56 (845680..846825) [1146 bp, 381 aa] {ON} YPL209C
           (IPL1) - Protein kinase [contig 166] FULL
          Length = 381

 Score =  145 bits (366), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 72/214 (33%), Positives = 120/214 (56%), Gaps = 5/214 (2%)

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
             RE+ I   L HPN+ RLY  +     +Y+++EY   GEL+  L   GP  +  A  F 
Sbjct: 168 FRREVEIQSSLKHPNLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDITASHFV 227

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            Q+   ++Y H+  I+HRD+KPENILL  +  +K+ DFG +     +   +T CG+  Y 
Sbjct: 228 HQMADALNYMHSKNILHRDIKPENILLGFQNTLKLTDFGWSVSNVGNSKRKTLCGTMDYL 287

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           +PE++    Y   + DVW+ GV+ + LL G  PF+E+   +     ++ K +   P  D+
Sbjct: 288 SPELIKSREYDN-KVDVWALGVLTYELLVGSPPFEEDTKEL--TYKRIIKRDLRFP--DQ 342

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
           +S  A+DL+ ++L  DP+ RI  +++ +HP ++K
Sbjct: 343 VSPHARDLISRLLEYDPQNRIPLKDVKRHPWIKK 376

>Skud_13.154 Chr13 complement(255263..257380) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  151 bits (381), Expect = 7e-37,   Method: Compositional matrix adjust.
 Identities = 84/209 (40%), Positives = 123/209 (58%), Gaps = 6/209 (2%)

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFR-Q 137
           EI I K ++HPN+++  D +E ++N+Y++LE    G L  LL  +  L E E +RFF  Q
Sbjct: 129 EIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFTTQ 187

Query: 138 IIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAA-LETEDKLLETSCGSPHYAA 196
           I   + Y H+  ++HRDLK  NI  D   N+KI DFG+AA L  E +   T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIA 247

Query: 197 PEIVSG-LPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           PE++ G    H  E D+WS GV+L+ALL G+ PF   D N   +  +++  +F  P D  
Sbjct: 248 PEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPKDKP 305

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKH 284
           IS E + L+  IL +DP +R    EI+ +
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDY 334

>Smik_13.159 Chr13 complement(260249..262366) [2118 bp, 705 aa] {ON}
           YMR001C (REAL)
          Length = 705

 Score =  150 bits (380), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 91/242 (37%), Positives = 134/242 (55%), Gaps = 13/242 (5%)

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFR-Q 137
           EI I K + HPN+++  D +E ++N+Y++LE    G L  LL  +  L E E +RFF  Q
Sbjct: 129 EIQIHKSMAHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLSEPE-VRFFTTQ 187

Query: 138 IIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAA-LETEDKLLETSCGSPHYAA 196
           I   + Y H+  ++HRDLK  NI  D   N+KI DFG+AA L  E +   T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIA 247

Query: 197 PEIVSG-LPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           PE++ G    H  E D+WS GV+L+ALL G+ PF   D N   +  +++  +F  P D  
Sbjct: 248 PEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPKDKP 305

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY--PSIKDS-----KTIRNLPREDTY 308
           IS E + L+  IL +DP +R    EI+ +   +    PSI  +         N+P E + 
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEVPNFGNIPEEQSL 365

Query: 309 LN 310
           +N
Sbjct: 366 VN 367

>Kpol_1037.20 s1037 (41658..43772) [2115 bp, 704 aa] {ON}
           (41658..43772) [2115 nt, 705 aa]
          Length = 704

 Score =  150 bits (380), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 87/235 (37%), Positives = 135/235 (57%), Gaps = 7/235 (2%)

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           EI I K + H NV++  D +E + N+Y++LE    G L +LL ++  L E E +RFF   
Sbjct: 129 EIQIHKSMKHQNVVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKLLTEPE-VRFFTTQ 187

Query: 139 IIG-MSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLE-TSCGSPHYAA 196
           I G + Y H+  ++HRDLK  NI  D   N+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 247

Query: 197 PEIVSG-LPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           PE++ G    H  E D+WS GV+L+ALL G+ PF  +D N   +  +++  +F  P +  
Sbjct: 248 PEVLMGKHSGHSYEVDIWSIGVMLYALLIGKPPFQSKDVN--TIYERIKCCDFSFPKEKH 305

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK-YPSIKDSKTIRNLPREDTYL 309
           IS EA+ L+  +L +DP +R    EI+ +   +  +P   +S  +  +P  D  L
Sbjct: 306 ISNEAKVLIQDLLSLDPLERPSISEIMDYVWFRGIFPPYIESTVMTEVPNYDKTL 360

>Kpol_1072.16 s1072 complement(37585..39972) [2388 bp, 795 aa] {ON}
           complement(37585..39972) [2388 nt, 796 aa]
          Length = 795

 Score =  151 bits (382), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 88/281 (31%), Positives = 148/281 (52%), Gaps = 33/281 (11%)

Query: 23  ETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREIII 82
           E +G G+   V+ A   ST +  A+K+I                        G+ RE+ +
Sbjct: 197 EVVGQGAFAIVKKAVERSTGKTFAVKIINKRKVMGNMD--------------GVTRELDV 242

Query: 83  MKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGM 142
           ++ L+HP ++RL   +E  ++ Y+++E+   G+L + +   G + E+      RQI+  +
Sbjct: 243 LRKLDHPRIVRLKGFYEDEDSYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAV 302

Query: 143 SYCHALGIVHRDLKPENILL--DHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 200
            Y H  GI HRDLKP+NIL+  D  + +KI DFG+A ++     ++T CG+  Y APE++
Sbjct: 303 KYIHLQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVI 362

Query: 201 SG----------LPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQKGEF- 248
            G          + Y  L  D+WS G +++ +LTG LPF    G+ ++ L K + +G + 
Sbjct: 363 GGKNSAEENEDRIEYSSL-VDMWSIGCLVYVILTGHLPF---SGSTQDQLYKQICRGSYH 418

Query: 249 EMPGDD-EISKEAQDLLYKILVVDPEKRIKSREILKHPLLQ 288
           E P  D  IS EA+D +  +L V P KR+ + + L HP ++
Sbjct: 419 EGPLKDFRISDEARDFIDSLLQVSPNKRLTAIKALNHPWIK 459

>Skud_15.144 Chr15 complement(254620..255969) [1350 bp, 449 aa] {ON}
           YOL016C (REAL)
          Length = 449

 Score =  146 bits (369), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 93/273 (34%), Positives = 142/273 (52%), Gaps = 18/273 (6%)

Query: 21  LGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREI 80
            G TLG GS G V+ A   STN+  AIK++                         +  E+
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQM-----------LYEEL 97

Query: 81  IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIII 140
            I++ L+HPN++   D +E+ +  Y+V + A  GELF+ ++ +G   E +A+    QI+ 
Sbjct: 98  SILQKLSHPNIVAFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQILG 157

Query: 141 GMSYCHALGIVHRDLKPENIL-LDHKLN--IKIADFGMA-ALETEDKLLETSCGSPHYAA 196
            + Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ ++ L+  + GS  Y A
Sbjct: 158 AVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLGYVA 217

Query: 197 PEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPGDD 254
           PE+++    HG   D+WS GVI + LL G  PF  E  +G +           F MP  D
Sbjct: 218 PEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTAYRYPVTFHMPYWD 276

Query: 255 EISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
            IS +A+  + K L +DP  R  + E+L  P +
Sbjct: 277 SISVDAKHFILKALRLDPADRPTATELLDDPWI 309

>YMR001C Chr13 complement(269019..271136) [2118 bp, 705 aa] {ON}
           CDC5Polo-like kinase with multiple functions in mitosis
           and cytokinesis through substrate phosphorylation, also
           functions in adaptation to DNA damage during meiosis;
           has similarity to Xenopus Plx1 and S. pombe Plo1p;
           possible Cdc28p substrate
          Length = 705

 Score =  150 bits (380), Expect = 8e-37,   Method: Compositional matrix adjust.
 Identities = 90/242 (37%), Positives = 136/242 (56%), Gaps = 13/242 (5%)

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           EI I K ++HPN+++  D +E ++N+Y++LE    G L  LL  +  L E E +RFF   
Sbjct: 129 EIQIHKSMSHPNIVQFIDCFEDDSNVYILLEICPNGSLMELLKRRKVLTEPE-VRFFTTQ 187

Query: 139 IIG-MSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAA-LETEDKLLETSCGSPHYAA 196
           I G + Y H+  ++HRDLK  NI  D   N+KI DFG+AA L  E +   T CG+P+Y A
Sbjct: 188 ICGAIKYMHSRRVIHRDLKLGNIFFDSNYNLKIGDFGLAAVLANESERKYTICGTPNYIA 247

Query: 197 PEIVSG-LPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           PE++ G    H  E D+WS GV+L+ALL G+ PF   D N   +  +++  +F  P D  
Sbjct: 248 PEVLMGKHSGHSFEVDIWSLGVMLYALLIGKPPFQARDVN--TIYERIKCRDFSFPRDKP 305

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY--PSI-----KDSKTIRNLPREDTY 308
           IS E + L+  IL +DP +R    EI+ +   +    PSI      ++    ++P E + 
Sbjct: 306 ISDEGKILIRDILSLDPIERPSLTEIMDYVWFRGTFPPSIPSTVMSEAPNFEDIPEEQSL 365

Query: 309 LN 310
           +N
Sbjct: 366 VN 367

>SAKL0H06534g Chr8 complement(575439..577853) [2415 bp, 804 aa] {ON}
           similar to uniprot|P22216 Saccharomyces cerevisiae
           YPL153C RAD53 Protein kinase required for cell-cycle
           arrest in response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 804

 Score =  151 bits (382), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 85/281 (30%), Positives = 149/281 (53%), Gaps = 33/281 (11%)

Query: 23  ETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREIII 82
           E +G G+   V+ A    T +  A+K+I                        G+ RE+ +
Sbjct: 192 EVVGQGAFAIVKKAVERKTGKTFAVKIISKRKVMGNID--------------GVTRELEV 237

Query: 83  MKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGM 142
           ++ LNHP ++RL   +E + + Y+++E+   G+L + +   G + E+      +Q++  +
Sbjct: 238 LRRLNHPRIVRLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITKQVLEAV 297

Query: 143 SYCHALGIVHRDLKPENILL--DHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 200
            Y H +GI HRDLKP+NIL+  D  + +KI DFG+A ++     ++T CG+  Y APE++
Sbjct: 298 KYIHGMGISHRDLKPDNILIEQDDPVMVKITDFGLAKIQGNGTFMKTFCGTLAYVAPEVI 357

Query: 201 SGL----------PYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQKGEF- 248
           SG            Y  L  D+WS G +++ +LTG LPF    G+ ++ L K + +G + 
Sbjct: 358 SGKNSEDKSQNKNKYSSL-VDMWSIGCLVYVILTGHLPF---SGSTQDQLYKQISRGSYH 413

Query: 249 EMPGDD-EISKEAQDLLYKILVVDPEKRIKSREILKHPLLQ 288
           E P  D  IS EA++ +  +L V+P+ R+ + + L HP ++
Sbjct: 414 EGPLKDFRISDEARNFIDSLLQVNPKDRLTAEKALDHPWIK 454

>KAFR0G02690 Chr7 complement(555573..557714) [2142 bp, 713 aa] {ON}
           Anc_6.31 YMR001C
          Length = 713

 Score =  150 bits (380), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 87/226 (38%), Positives = 132/226 (58%), Gaps = 8/226 (3%)

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           EI I K + H N+++  D +E + N+Y++LE    G L +LL ++  L E E +RFF   
Sbjct: 142 EIQIHKSMKHVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQ 200

Query: 139 IIG-MSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLE-TSCGSPHYAA 196
           I G + Y H+  ++HRDLK  NI  D K N+KI DFG+AA    D+  + T CG+P+Y A
Sbjct: 201 ICGAIKYMHSRKVIHRDLKLGNIFFDRKYNLKIGDFGLAATLANDRERKYTVCGTPNYIA 260

Query: 197 PEIVSG-LPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           PE++ G    H  E D+WS GV+++AL+ GR PF  +D N   +  +++  +F  P D  
Sbjct: 261 PEVLMGKHSGHSYEVDIWSIGVMIYALIIGRPPFQSKDVN--TIYERIKCRDFSFPKDKL 318

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKY--PSIKDSKTI 299
           IS EA+ L+  IL +DP +R    EI+ +   +    PS K+S  +
Sbjct: 319 ISSEAKILIQDILSLDPLERPSVNEIMDYIWFRGCFPPSTKESVMV 364

>TBLA0B03840 Chr2 complement(881914..884490) [2577 bp, 858 aa] {ON}
           Anc_8.676 YPL153C
          Length = 858

 Score =  151 bits (382), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 87/280 (31%), Positives = 150/280 (53%), Gaps = 31/280 (11%)

Query: 23  ETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREIII 82
           E +G G+   V+ A   ST +  A+K+I                    +LS G+ RE+ I
Sbjct: 201 EVVGQGAFATVKKAVERSTGRTFAVKIINKRKVMG-------------NLS-GVTRELEI 246

Query: 83  MKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGM 142
           ++ L+HP ++RL   +E   + Y+V+E+   G+L + +   G + E+      RQI+  +
Sbjct: 247 LRKLDHPRIVRLKGFYEDEESYYLVMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAV 306

Query: 143 SYCHALGIVHRDLKPENILL--DHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 200
           +Y H  GI HRD+KP+NIL+  D  + +KI DFG+A ++     ++T CG+  Y APE++
Sbjct: 307 AYMHEKGISHRDIKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVI 366

Query: 201 SG----------LPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEF-E 249
           SG          + Y  L  D+WS G +++ +LT  LPF       + L  ++ +G + E
Sbjct: 367 SGKNAATENDDRIEYSSL-VDMWSIGCLVYVILTAHLPF--SGSTQQELYEQINRGSYHE 423

Query: 250 MPGDD-EISKEAQDLLYKILVVDPEKRIKSREILKHPLLQ 288
            P  D  +S+EA+D +  ++ VDP  R+ +++ LKH  ++
Sbjct: 424 GPLKDYRVSEEARDFIESLIQVDPNNRLTAKDALKHEWIK 463

>YDL101C Chr4 complement(280307..281848) [1542 bp, 513 aa] {ON}
           DUN1Cell-cycle checkpoint serine-threonine kinase
           required for DNA damage-induced transcription of certain
           target genes, phosphorylation of Rad55p and Sml1p, and
           transient G2/M arrest after DNA damage; also regulates
           postreplicative DNA repair
          Length = 513

 Score =  147 bits (372), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 92/295 (31%), Positives = 143/295 (48%), Gaps = 40/295 (13%)

Query: 19  WKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIER 78
           + LG+ LG G    V+ A N+ T QQ A+K+                             
Sbjct: 200 YLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQ------------FRE 247

Query: 79  EIIIMKLLNHPNVLRLYDVW-----ETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIR 133
           E  I+  + HPN++ L D +     ++    Y+VLE  + GELF  +V K  L ++E+  
Sbjct: 248 ETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKA 307

Query: 134 FFRQIIIGMSYCHALGIVHRDLKPENILL-------------------DHKLNIKIADFG 174
            F+Q++ G+ Y H   I+HRD+KPENILL                   +  + +KIADFG
Sbjct: 308 LFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENPSQVQLGPWDEDEIDIQVKIADFG 367

Query: 175 MAALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDG 234
           +A    E +   T CG+P Y APE+++   Y   + D+WS GVIL+  L G  PF ++ G
Sbjct: 368 LAKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTS-KVDLWSAGVILYVCLCGFPPFSDQLG 426

Query: 235 --NIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
             +++  +L+  K  F  P  D+I      L+  +LV++P++R    E L HP  
Sbjct: 427 PPSLKEQILQA-KYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNIDEALNHPWF 480

>TDEL0A06220 Chr1 (1088622..1091006) [2385 bp, 794 aa] {ON}
           Anc_8.676 YPL153C
          Length = 794

 Score =  151 bits (381), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 88/281 (31%), Positives = 148/281 (52%), Gaps = 33/281 (11%)

Query: 23  ETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREIII 82
           E +G G+   V+ A   ST +  A K+I                        G+ RE+ +
Sbjct: 197 EVVGQGAFATVKKAVERSTGKTFAAKIISKRKVMGNMD--------------GVTRELEV 242

Query: 83  MKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGM 142
           ++ LNHP ++RL   +E +   Y+++E+   G+L + +   G + E+      RQ++ G+
Sbjct: 243 LRKLNHPKIVRLKGFYEDDEFYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEGV 302

Query: 143 SYCHALGIVHRDLKPENILL--DHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 200
            Y H+ GI HRDLKP+NIL+  D  + +KI DFG+A ++     ++T CG+  Y APE++
Sbjct: 303 KYIHSQGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEVI 362

Query: 201 SGLP----------YHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQKGEF- 248
           +G            Y  L  D+WS G +++ +LTG LPF    G+ +  L K ++ G + 
Sbjct: 363 AGKANAEENEKRNEYSSL-VDMWSMGCLVYVILTGHLPF---SGSTQEQLYKQIKNGSYH 418

Query: 249 EMPGDD-EISKEAQDLLYKILVVDPEKRIKSREILKHPLLQ 288
           E P  D  IS EA+D +  +L V+P  R  +++ L+HP ++
Sbjct: 419 EGPLKDFRISDEARDFIDSLLQVNPNARPTAKKALEHPWIK 459

>KAFR0C04280 Chr3 (848308..849912) [1605 bp, 534 aa] {ON} Anc_1.336
           YBR274W
          Length = 534

 Score =  147 bits (372), Expect = 1e-36,   Method: Compositional matrix adjust.
 Identities = 112/296 (37%), Positives = 155/296 (52%), Gaps = 35/296 (11%)

Query: 21  LGETLGLGSTGKVQLAYNESTNQQ--AAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGI-E 77
           +GET+G GS G V+ A  + +NQ    AIK I                  P +   GI E
Sbjct: 17  IGETIGQGSFGIVKSARIKDSNQNNIFAIKFIH----------------LPSANDKGITE 60

Query: 78  REI-----IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAI 132
           REI     I MK  NHPN+L+  D   TN  L+MVLE A+ G+LF+ +     +  + A 
Sbjct: 61  REISREVSIHMKCSNHPNILKFIDCNVTNKFLWMVLEMADGGDLFDKIEPDYGVDSHIAQ 120

Query: 133 RFFRQIIIGMSYCH-ALGIVHRDLKPENILLDHKLNIKIADFGMA-ALETEDKLLETSC- 189
            +F+Q+I  + Y H   GI HRD+KPENILLD   N+K+ADFG+A + + +D  +  S  
Sbjct: 121 FYFQQLIRALDYLHNTCGIAHRDIKPENILLDKDGNLKLADFGLASSFKRKDGTMRLSHD 180

Query: 190 --GSPHYAAPEIVS-GLPYHGLETDVWSCGVILFALLTGRLPFD---EEDGNIRNLLLKV 243
             GSP Y APEI++   PYH   TD+WS GV+LF LL G++P++    ED +  N  +K 
Sbjct: 181 QRGSPPYMAPEILTLNSPYHANITDIWSVGVLLFVLLAGQVPWELPVNEDSD-YNAFIK- 238

Query: 244 QKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTI 299
             G        +I  +  +LL KIL  DP KR     +  H    K     +SK +
Sbjct: 239 NNGNINAGPWSKIKLDQLNLLRKILHSDPSKRATLTTLKSHRWFLKKNMYANSKGL 294

>TBLA0A02030 Chr1 complement(491365..492576) [1212 bp, 403 aa] {ON}
           Anc_6.214 YPL203W
          Length = 403

 Score =  144 bits (364), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 91/274 (33%), Positives = 143/274 (52%), Gaps = 24/274 (8%)

Query: 19  WKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIER 78
           +++  TLG GS G+V L  +    +  AIKV+                 T D      ER
Sbjct: 93  FQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVL----KKQQIIKMKQIEHTND------ER 142

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
              ++KL+ HP ++RL+  ++ + NL+MV++Y E GELF+LL +    P   A  +  ++
Sbjct: 143 R--MLKLVEHPFIIRLWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEV 200

Query: 139 IIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPE 198
           ++ + Y HA  I++RDLKPENILLD   +IK+ADFG A  +    +  T CG+P Y APE
Sbjct: 201 VLALEYLHANNIIYRDLKPENILLDRNGHIKVADFGFA--KEVSSVTWTLCGTPDYIAPE 258

Query: 199 IVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDEISK 258
           +++  PY+    D WS GV+++ +L G  PF   D        K+ +G+   P       
Sbjct: 259 VIATKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDVTPMKTYEKILQGKINFP--QGFHP 313

Query: 259 EAQDLLYKILVVDPEKRI-----KSREILKHPLL 287
           +  DLL +++  D  KR+      SR++  HP  
Sbjct: 314 DVIDLLTRLITSDLTKRLGNLQNGSRDVKNHPWF 347

>TPHA0J00420 Chr10 complement(96445..98568) [2124 bp, 707 aa] {ON}
           Anc_6.31 YMR001C
          Length = 707

 Score =  150 bits (378), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 87/235 (37%), Positives = 136/235 (57%), Gaps = 7/235 (2%)

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           EI I K + + N+++  D +E + N+Y++LE    G L +LL ++  L E E +RFF   
Sbjct: 130 EIQIHKSMKNVNIVQFIDCFEDDTNVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQ 188

Query: 139 IIG-MSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLE-TSCGSPHYAA 196
           I G + Y H+  ++HRDLK  NI  D   N+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 189 ICGAIKYMHSRRVIHRDLKLGNIFFDKDYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 248

Query: 197 PEIVSGLPY-HGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           PE++ G    H  E D+WS GV+L+ALL G+ PF  +D N   +  +++  +F  P D  
Sbjct: 249 PEVLMGKHTGHSYEVDIWSIGVMLYALLIGKPPFQSKDVN--TIYERIKCCDFTFPKDKY 306

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK-YPSIKDSKTIRNLPREDTYL 309
           IS EA+ L+  +L +DP +R    EI+ +   +  +P   +S  + N+P  D  L
Sbjct: 307 ISPEAKILIQDLLSLDPLERPSVDEIIDYVWFRGLFPPQIESDVMTNIPNYDNQL 361

>CAGL0J11638g Chr10 complement(1130744..1132984) [2241 bp, 746 aa]
           {ON} highly similar to uniprot|P32562 Saccharomyces
           cerevisiae YMR001c CDC5 involved in regulation of DNA
           replication
          Length = 746

 Score =  150 bits (378), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 79/208 (37%), Positives = 126/208 (60%), Gaps = 4/208 (1%)

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           EI I K ++H N+++  D +E N N+Y++LE    G L  L+ ++  + E E   F  QI
Sbjct: 128 EIQIHKSMSHTNIVQFIDCFEDNVNVYILLEICPNGSLMELIKKRKTITEPEVRFFMTQI 187

Query: 139 IIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLE-TSCGSPHYAAP 197
             G+ Y H+  ++HRDLK  NI  D   N+KI DFG+AA+   D+  + T CG+P+Y AP
Sbjct: 188 CGGIQYMHSNRVIHRDLKLGNIFFDEHYNLKIGDFGLAAVLANDRERKFTICGTPNYIAP 247

Query: 198 EIVSG-LPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDEI 256
           E++ G    H  E D+WS GV+L+ALL G+ PF  +D N   +  ++++  F  P D +I
Sbjct: 248 EVLMGKHSGHSYEVDIWSIGVMLYALLIGKPPFQAKDVN--TIYERIKQRNFAYPKDKKI 305

Query: 257 SKEAQDLLYKILVVDPEKRIKSREILKH 284
           S++A+ L+  IL ++P +R   +EI+ +
Sbjct: 306 SQDAKYLIDDILSLNPMERPSIQEIMDY 333

>KAFR0K00330 Chr11 (74162..75283) [1122 bp, 373 aa] {ON} Anc_6.214
           YPL203W
          Length = 373

 Score =  143 bits (361), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 93/291 (31%), Positives = 147/291 (50%), Gaps = 24/291 (8%)

Query: 2   ISSNKGNISVKGDTIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXX 61
           +   +  +S    T+  +++  TLG GS G+V L  +    +  AIKV+           
Sbjct: 46  VLQQRSTVSKGKYTLNDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVL----KKQQIVK 101

Query: 62  XXXXXXTPDSLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLV 121
                 T D      ER   ++KL+ HP ++R++  ++ +NNL+MV++Y E GELF+LL 
Sbjct: 102 MKQIEHTND------ERR--MLKLVEHPFLIRMWGTFQDSNNLFMVMDYIEGGELFSLLR 153

Query: 122 EKGPLPENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETE 181
           +    P   A  +  ++++ + Y H   I++RDLKPENILLD   +IKI DFG A   T 
Sbjct: 154 KSQRFPNPVAKFYAAEVVLALEYLHFNNIIYRDLKPENILLDRNGHIKITDFGFAKEVT- 212

Query: 182 DKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLL 241
             +  T CG+P Y APE+++  PY+    D WS G++++ +L G  PF   D        
Sbjct: 213 -TVTWTLCGTPDYIAPEVIATKPYNK-SVDWWSLGILIYEMLAGYTPF--YDTTPMKTYE 268

Query: 242 KVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRI-----KSREILKHPLL 287
           K+  G    P     + +  DLL K++  D  +RI      ++EI  HP  
Sbjct: 269 KILHGRVTYPS--FFNSDVVDLLSKLITADLTRRIGNLQNGTQEIKSHPWF 317

>KAFR0H02510 Chr8 complement(476574..479213) [2640 bp, 879 aa] {ON}
           Anc_8.668 YPL150W
          Length = 879

 Score =  150 bits (379), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 102/353 (28%), Positives = 171/353 (48%), Gaps = 45/353 (12%)

Query: 16  IGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYG 75
           +G +++ + +G GS GKV LA +  T+++  +K                   T D     
Sbjct: 38  VGNYRILKQIGEGSFGKVYLALHRPTHRKVVLK-------------------TSDKNDPN 78

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
           I RE+   +  ++P + ++Y++  T   ++M LEY    EL++ L+    +P  E    F
Sbjct: 79  IVREVFYHRQFDYPYITKVYEIIVTETKVWMALEYCPGKELYDHLLFSKRIPIAECTELF 138

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            QI+  + Y H+L  VHRDLK ENILLD     K+ DFG          LET CG+  Y 
Sbjct: 139 AQIVGAVYYAHSLNCVHRDLKLENILLDKHGRAKLTDFGFTRECMTRSTLETVCGTTVYM 198

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           APE++    Y G + D+W+ GVIL+ ++ G +PFDE+D       +  +  +F    ++ 
Sbjct: 199 APELIERKSYDGFKIDIWALGVILYTMIYGAMPFDEDDEVKTKWKIVNEDPDF---TNNI 255

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPREDTYLNPLIGN 315
            S + +DL+ K+L  DP +R   REILKH  L+ Y      KT + + R+          
Sbjct: 256 SSNDVKDLIKKLLKKDPTERPTIREILKHDFLKPYGFTILEKTDKIIQRQ---------- 305

Query: 316 DGGDATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEKTLYALLYRFKVDS 368
                       +N  + +H + E  + K+L+  G + +   ++++ + K DS
Sbjct: 306 ------------RNDSIHFHSKIEKRLLKRLKRSGFDTQSIKHSIMKK-KCDS 345

>NCAS0C01370 Chr3 complement(250693..253092) [2400 bp, 799 aa] {ON}
           Anc_8.676
          Length = 799

 Score =  150 bits (378), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 88/279 (31%), Positives = 145/279 (51%), Gaps = 31/279 (11%)

Query: 23  ETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREIII 82
           E +G G+   V+ A   ST +  A+K+I                        G+ RE+ +
Sbjct: 199 EVVGQGAFATVKKAVERSTGKTFAVKIISKRKVMGNME--------------GVSRELEV 244

Query: 83  MKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGM 142
           ++ L+HP ++RL   +E  ++ YMV+E+   G+L + +   G + E       RQI+  +
Sbjct: 245 LQQLDHPRIVRLKGFYEDKDSYYMVMEFVSGGDLMDFVAAHGAVGEEAGKEISRQILEAV 304

Query: 143 SYCHALGIVHRDLKPENILL--DHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 200
            Y H+ GI HRDLKP+NIL+  D  + +KI DFG+A ++     ++T CG+  Y APE++
Sbjct: 305 KYIHSKGISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGSFMKTFCGTLAYVAPEVI 364

Query: 201 SGL--------PYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQKGEF-EM 250
            G          Y  L  D+WS G +++ +LTG LPF    G+ +  L K + +G + E 
Sbjct: 365 GGKGETNEERNEYSSL-VDMWSMGCLVYVILTGHLPF---SGSTQEQLYKQISRGSYHEG 420

Query: 251 PGDD-EISKEAQDLLYKILVVDPEKRIKSREILKHPLLQ 288
           P  D  IS EA+  +  +L V+P  R+ +   L+HP ++
Sbjct: 421 PLKDFRISDEARSFIDSLLQVNPGNRLTAARALEHPWIK 459

>YOL016C Chr15 complement(294777..296120) [1344 bp, 447 aa] {ON}
           CMK2Calmodulin-dependent protein kinase; may play a role
           in stress response, many CA++/calmodulan dependent
           phosphorylation substrates demonstrated in vitro, amino
           acid sequence similar to Cmk1p and mammalian Cam Kinase
           II
          Length = 447

 Score =  145 bits (365), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 92/273 (33%), Positives = 141/273 (51%), Gaps = 18/273 (6%)

Query: 21  LGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREI 80
            G TLG GS G V+ A   STN+  AIK++                         +  E+
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQM-----------LYEEL 97

Query: 81  IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIII 140
            I++ L+HPN++   D +E+ +  Y+V + A  GELF+ ++ +G   E +A+    QI+ 
Sbjct: 98  SILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIIVQILG 157

Query: 141 GMSYCHALGIVHRDLKPENIL-LDHKLN--IKIADFGMA-ALETEDKLLETSCGSPHYAA 196
            + Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ E+ L+  + GS  Y A
Sbjct: 158 AVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGEEDLIYKAAGSLGYVA 217

Query: 197 PEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPGDD 254
           PE+++    HG   D+WS GVI + LL G  PF  E  +G +           F MP  D
Sbjct: 218 PEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHMPYWD 276

Query: 255 EISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
            IS + +  + K L ++P  R  + E+L  P +
Sbjct: 277 NISIDVKRFILKALRLNPADRPTATELLDDPWI 309

>KLTH0H04180g Chr8 (381111..382172) [1062 bp, 353 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203W TPK2 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 353

 Score =  142 bits (359), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 88/269 (32%), Positives = 139/269 (51%), Gaps = 24/269 (8%)

Query: 24  TLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREIIIM 83
           TLG GS G+V L  +    +  AIKV+                          ER   ++
Sbjct: 48  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTND----------ERR--ML 95

Query: 84  KLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGMS 143
           KL++HP ++R++  ++ + NL+MV++Y E GELF+LL +    P   A  +  ++I+ + 
Sbjct: 96  KLVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALE 155

Query: 144 YCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGL 203
           Y HA  I++RDLKPENILLD   +IKI DFG A  +  D +  T CG+P Y APE+++  
Sbjct: 156 YLHAHDIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYIAPEVIATK 213

Query: 204 PYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQDL 263
           PY+    D WS G+++F +L G  PF   D        K+ +G+   P       +  DL
Sbjct: 214 PYNK-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVAYP--PFFHPDVVDL 268

Query: 264 LYKILVVDPEKRIKS-----REILKHPLL 287
           L K++  D  +R+ +     +++  HP  
Sbjct: 269 LSKLITADLTRRLGNLQSGPQDVKSHPWF 297

>NDAI0C02680 Chr3 complement(621951..624203) [2253 bp, 750 aa] {ON}
           Anc_6.31
          Length = 750

 Score =  149 bits (375), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 78/200 (39%), Positives = 124/200 (62%), Gaps = 6/200 (3%)

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFR-Q 137
           EI I K + H N+++  D +E + N+Y++LE    G L +LL ++  L E E +RFF  Q
Sbjct: 142 EIQIHKSMKHSNIVQFIDCFEDDANVYILLEICPNGSLMDLLKKRKSLTEPE-VRFFTTQ 200

Query: 138 IIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLE-TSCGSPHYAA 196
           I   + Y H+  I+HRDLK  NI  D   N+K+ DFG+AA+   D+  + T CG+P+Y A
Sbjct: 201 ICGAIKYLHSRRIIHRDLKLGNIFFDKDYNLKVGDFGLAAVLANDRERKYTVCGTPNYIA 260

Query: 197 PEIVSG-LPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           PE++ G    H  E D+WS GV+++ALL G+ PF  +D N+  +  +++  ++  P D  
Sbjct: 261 PEVLMGKHSGHSFEVDIWSIGVMIYALLVGKPPFQAKDVNV--IYERIKLCKYGYPKDKY 318

Query: 256 ISKEAQDLLYKILVVDPEKR 275
           +SKEA+ L++ IL ++P +R
Sbjct: 319 VSKEAEILIHDILSLNPLQR 338

>NCAS0A01100 Chr1 (218400..219464) [1065 bp, 354 aa] {ON} 
          Length = 354

 Score =  142 bits (358), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 92/278 (33%), Positives = 142/278 (51%), Gaps = 24/278 (8%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           T+  +++  TLG GS G+V L  +    +  AIKV+                        
Sbjct: 40  TLHDFQVMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVRMKQIEHTND-------- 91

Query: 75  GIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRF 134
             ER   ++KL+ HP ++R++  ++ + NL+MV++Y E GELF+LL +    P   A  +
Sbjct: 92  --ERR--MLKLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFY 147

Query: 135 FRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHY 194
             ++ +G+ Y H+  I++RDLKPENILLD   +IKI DFG A  +  D +  T CG P Y
Sbjct: 148 AAEVTLGLEYLHSHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGPPDY 205

Query: 195 AAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDD 254
            APE+++  PY+    D WS GV++F +L G  PF   D        K+ +G+   P   
Sbjct: 206 IAPEVIATKPYNK-SVDWWSLGVLIFEMLAGYTPF--YDTTPMKTYEKILQGKVVYP--T 260

Query: 255 EISKEAQDLLYKILVVDPEKRI-----KSREILKHPLL 287
               +  DLL K++  D  +RI      S++I  HP  
Sbjct: 261 FFHPDVVDLLGKLITADLTRRIGNLQSGSKDIKCHPWF 298

>CAGL0I09504g Chr9 (909589..911175) [1587 bp, 528 aa] {ON} similar
           to uniprot|P38147 Saccharomyces cerevisiae YBR274w CHK1
           regulats inhibitory Cdk phosphorylation of PDS1
          Length = 528

 Score =  146 bits (368), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 93/250 (37%), Positives = 139/250 (55%), Gaps = 18/250 (7%)

Query: 76  IEREIIIM-KLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRF 134
           + RE+++  K   H NVLR+ D       L+++LE A+ G+LF+ +     +  + A  +
Sbjct: 61  VSREVVLHSKCSKHANVLRVIDCNVGGEYLWIMLEMADGGDLFDKIEPDVGVDPDVAQFY 120

Query: 135 FRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAA-LETEDKLLETSC---G 190
           F+Q+I  ++Y H +G+ HRD+KPENILLD K N+K+ADFG+A+    +D  L  S    G
Sbjct: 121 FQQLIRALNYLHDVGVAHRDIKPENILLDKKGNLKLADFGLASQFRRKDGTLRVSTDQRG 180

Query: 191 SPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFD---EEDGNIRNLL---LKVQ 244
           SP Y APEI+S   Y+   TD+WS GV+LF LLTG +P+    +ED N    +    KV 
Sbjct: 181 SPPYMAPEILSSQGYYANITDIWSAGVLLFVLLTGEIPWSIPAKEDDNYEWFVNNEGKVS 240

Query: 245 KGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKDSKTIRNLPR 304
            G +E      +     +LL KIL  DP KR+   ++  HP L     + +S+ + N P 
Sbjct: 241 LGPWE-----RVELRQMNLLRKILQPDPRKRVSLEKLRHHPWLTSRSKLANSEGLCNNP- 294

Query: 305 EDTYLNPLIG 314
            D     L+G
Sbjct: 295 -DVLAKKLLG 303

>TBLA0D05010 Chr4 complement(1234934..1236238) [1305 bp, 434 aa]
           {ON} Anc_1.374 YFR014C
          Length = 434

 Score =  144 bits (363), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 90/278 (32%), Positives = 150/278 (53%), Gaps = 22/278 (7%)

Query: 19  WKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIER 78
           +  G+TLG GS G V+ A   ST++  A+K+I                   D     +  
Sbjct: 47  YVFGKTLGAGSFGVVRQAKKLSTDENVAVKIILKKALKGN-----------DVQLQMLYD 95

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           E+ I++ L+HPN+++  D +E+    Y+V + A  GELF+ ++++G   E +A++   Q+
Sbjct: 96  ELSILQRLHHPNIVQFKDWFESKEKFYIVTQLATGGELFDRILKRGKFTEVDAVKIIIQM 155

Query: 139 IIGMSYCHALGIVHRDLKPENILL-----DHKLNIKIADFGMA-ALETEDKLLETSCGSP 192
           +  + Y H+  IVHRDLKPEN+L      D +L   IADFG+A  L+  D L+  + GS 
Sbjct: 156 LKAIEYIHSQNIVHRDLKPENVLYIDPSDDSQL--VIADFGIAKELKDGDDLIFKAAGSL 213

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEM 250
            Y APE+++    HG   D+WS GVI + LL G   F  E  +G +      +   +F  
Sbjct: 214 GYVAPEVLTT-NGHGKPCDIWSLGVITYTLLCGYSAFIAETVEGFLEECTSNIYPVKFHE 272

Query: 251 PGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQ 288
           P  + +S+EA++ + K L ++P++R  + E+L  P ++
Sbjct: 273 PYWNNVSREAKEFILKALTLNPDERPTATELLNDPWIK 310

>TPHA0E02820 Chr5 complement(589816..590970) [1155 bp, 384 aa] {ON}
           Anc_6.222 YPL209C
          Length = 384

 Score =  142 bits (359), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 75/222 (33%), Positives = 126/222 (56%), Gaps = 9/222 (4%)

Query: 72  LSYGIER----EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLP 127
           L+Y + +    EI I   LNH N+ +LY  +  +  +Y+++EY   GEL+++L + GP  
Sbjct: 163 LTYNVTKQFRNEIEIQSNLNHENLTKLYGFFHDSKRVYLIMEYIYNGELYSILKKNGPFN 222

Query: 128 ENEAIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLET 187
           +  A  F  Q+   + Y H   I+HRDLKPENIL+D    IKI DFG +         +T
Sbjct: 223 DIVASNFVFQLTNAIRYLHKKRIIHRDLKPENILIDFNNVIKITDFGWSVYNEAGNKRKT 282

Query: 188 SCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGE 247
            CG+  Y +PE+++   Y GL  DVW+ G+I + L+ G  PF+E+   +     +++  +
Sbjct: 283 LCGTIDYLSPELINSKEYDGL-IDVWALGIIAYELIVGTPPFEEDTKELT--YKRIKNCD 339

Query: 248 FEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
              P    +S++A++L+  +L ++P +RI   ++LKHP + K
Sbjct: 340 LNFPA--HVSQDAKNLISSLLKLNPSERITLTDVLKHPWINK 379

>Skud_16.76 Chr16 (139571..140719) [1149 bp, 382 aa] {ON} YPL203W
           (REAL)
          Length = 382

 Score =  142 bits (359), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 91/278 (32%), Positives = 141/278 (50%), Gaps = 24/278 (8%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           T+  +++  TLG GS G+V L  +    +  AIKV+                        
Sbjct: 68  TLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTND-------- 119

Query: 75  GIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRF 134
             ER   ++KL+ HP ++R++  ++   N++MV++Y E GELF+LL +    P   A  +
Sbjct: 120 --ERR--MLKLVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFY 175

Query: 135 FRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHY 194
             ++I+ + Y HA  I++RDLKPENILLD   +IKI DFG A  +    +  T CG+P Y
Sbjct: 176 AAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTPDY 233

Query: 195 AAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDD 254
            APE+++  PY+    D WS GV+++ +L G  PF   D        K+ +G+   P   
Sbjct: 234 IAPEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYP--P 288

Query: 255 EISKEAQDLLYKILVVDPEKRI-----KSREILKHPLL 287
               +  DLL K++  D  +RI      SR+I  HP  
Sbjct: 289 YFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 326

>KLLA0E01585g Chr5 (149305..149370,149488..150960) [1539 bp, 512 aa]
           {ON} similar to uniprot|P39009 Saccharomyces cerevisiae
           YDL101C DUN1 Cell-cycle checkpoint serine-threonine
           kinase required for DNA damage-induced transcription of
           certain target genes phosphorylation of Rad55p and Sml1p
           and transient G2/M arrest after DNA damage also
           regulates postreplicative DNA repair
          Length = 512

 Score =  145 bits (367), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 97/292 (33%), Positives = 138/292 (47%), Gaps = 40/292 (13%)

Query: 22  GETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREII 81
           G+ LG G    V+ A N+ T +  A+K+                    D  +     E  
Sbjct: 201 GKELGTGHYAIVKEARNKETGETVAVKIFHPQQNDD------------DKRTKKFTEETK 248

Query: 82  IMKLLNHPNVLRLYD-----VWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFR 136
           I+  + HPN+++L D     V +T    Y+VLE    GELF  +V K  L E+E    FR
Sbjct: 249 ILLSIQHPNIVKLIDRFVEPVSKTQIQTYLVLEKINDGELFERIVRKNNLREDETKALFR 308

Query: 137 QIIIGMSYCHALGIVHRDLKPENILL-----------------DHKLNI--KIADFGMAA 177
           Q++ G+ Y H+  I+HRD+KPENILL                 D +L+I  KIADFG+A 
Sbjct: 309 QLLNGLKYLHSRNIIHRDIKPENILLSISKRRSPEEIALGPWDDDELDIQVKIADFGLAK 368

Query: 178 LETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDG--N 235
              E K   T CG+P Y APE++    Y     D+WS GV+L+  L G  PF E+    +
Sbjct: 369 FTGEMKFTNTLCGTPSYVAPEVLVKTGYTS-RVDMWSAGVLLYVCLCGFPPFSEQLAPPS 427

Query: 236 IRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
           ++  +L+  K  F  P  D I      L+  +LVV+P  R    + L HP  
Sbjct: 428 MKEQILQ-GKFAFYSPYWDNIDDSVLHLISNLLVVNPASRFSVNDALTHPWF 478

>YPL203W Chr16 (166256..167398) [1143 bp, 380 aa] {ON}
           TPK2cAMP-dependent protein kinase catalytic subunit;
           promotes vegetative growth in response to nutrients via
           the Ras-cAMP signaling pathway; partially redundant with
           Tpk1p and Tpk3p; localizes to P-bodies during stationary
           phase
          Length = 380

 Score =  142 bits (359), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 91/278 (32%), Positives = 141/278 (50%), Gaps = 24/278 (8%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           T+  +++  TLG GS G+V L  +    +  AIKV+                        
Sbjct: 66  TLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTND-------- 117

Query: 75  GIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRF 134
             ER   ++KL+ HP ++R++  ++   N++MV++Y E GELF+LL +    P   A  +
Sbjct: 118 --ERR--MLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFY 173

Query: 135 FRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHY 194
             ++I+ + Y HA  I++RDLKPENILLD   +IKI DFG A  +    +  T CG+P Y
Sbjct: 174 AAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTPDY 231

Query: 195 AAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDD 254
            APE+++  PY+    D WS GV+++ +L G  PF   D        K+ +G+   P   
Sbjct: 232 IAPEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVVYP--P 286

Query: 255 EISKEAQDLLYKILVVDPEKRI-----KSREILKHPLL 287
               +  DLL K++  D  +RI      SR+I  HP  
Sbjct: 287 YFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 324

>Suva_4.145 Chr4 complement(268826..270370) [1545 bp, 514 aa] {ON}
           YDL101C (REAL)
          Length = 514

 Score =  145 bits (366), Expect = 6e-36,   Method: Compositional matrix adjust.
 Identities = 90/296 (30%), Positives = 145/296 (48%), Gaps = 40/296 (13%)

Query: 19  WKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIER 78
           + LG+ LG G    V+ A N+ T QQ A+K+                             
Sbjct: 201 YLLGKELGAGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQ------------FRE 248

Query: 79  EIIIMKLLNHPNVLRLYDVW-----ETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIR 133
           E  I+  ++HPN++ L D +     ++    Y+VLE  + GELF  +V K  L ++E+  
Sbjct: 249 ETNILMRVHHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLGQDESRA 308

Query: 134 FFRQIIIGMSYCHALGIVHRDLKPENILL-------------------DHKLNIKIADFG 174
            F+Q++ G+ Y H   I+HRD+KPENILL                   +  + +KIADFG
Sbjct: 309 LFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENSNQVQLGPWDEDEIDIQVKIADFG 368

Query: 175 MAALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDG 234
           +A    E +   T CG+P Y APE+++   Y   + D+WS GVIL+  L G  PF ++ G
Sbjct: 369 LAKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTS-KVDLWSAGVILYVCLCGFPPFSDQLG 427

Query: 235 --NIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQ 288
             +++  +++  K  F  P  D+I      L+  +LV++P++R    E + HP  +
Sbjct: 428 PPSLKEQIMQA-KYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNIDEAMNHPWFK 482

>SAKL0E05984g Chr5 complement(485895..487391,487462..487482) [1518
           bp, 505 aa] {ON} similar to uniprot|P39009 Saccharomyces
           cerevisiae YDL101C DUN1 Cell-cycle checkpoint
           serine-threonine kinase required for DNA damage-induced
           transcription of certain target genes phosphorylation of
           Rad55p and Sml1p and transient G2/M arrest after DNA
           damage also regulates postreplicative DNA repair
          Length = 505

 Score =  145 bits (365), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 93/292 (31%), Positives = 143/292 (48%), Gaps = 40/292 (13%)

Query: 22  GETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREII 81
           G+ LG G    V+ A N+ T Q AA+K+                  T            I
Sbjct: 192 GKELGTGHYAVVKEAINKETGQIAAVKIFHPQQNDDQKKTKQFRDETK-----------I 240

Query: 82  IMKLLNHPNVLRLYD-----VWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFR 136
           +M++  H N+++L D     V +++   Y+VLE    GELF+ +V K  L ++E    F+
Sbjct: 241 LMRI-QHKNIVKLLDRFVEPVSKSHIQTYLVLEKINDGELFDRIVRKTKLEQDETRAIFK 299

Query: 137 QIIIGMSYCHALGIVHRDLKPENILLDHK-------------------LNIKIADFGMAA 177
           Q++ G+ Y H+  I+HRD+KPENILL  +                   + +KIADFG+A 
Sbjct: 300 QLLNGLKYLHSENIIHRDIKPENILLSIQKRKSSEEKCLGPWDRDEIDIKVKIADFGLAK 359

Query: 178 LETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDG--N 235
              E K   T CG+P Y APE+++   Y   + D+WS GV+L+  L G  PF E+    +
Sbjct: 360 FTGEMKFTNTLCGTPSYVAPEVLTKTGYTA-KVDMWSAGVLLYVCLCGFPPFSEQLSPPS 418

Query: 236 IRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
           ++  +L+  K  F  P  DEI   A  L+  +LVV+P +R    + + HP  
Sbjct: 419 MKEQILQ-GKYAFYSPYWDEIDDSALHLISNLLVVNPAQRFSVNDTINHPWF 469

>CAGL0K10604g Chr11 complement(1030055..1031395) [1341 bp, 446 aa]
           {ON} similar to uniprot|P27466 Saccharomyces cerevisiae
           YFR014c CMK1 Ca2+/calmodulin-dependent ser/thr protein
           kinase type I
          Length = 446

 Score =  144 bits (362), Expect = 7e-36,   Method: Compositional matrix adjust.
 Identities = 93/277 (33%), Positives = 147/277 (53%), Gaps = 19/277 (6%)

Query: 24  TLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREIIIM 83
           TLG GS G V+ A    +++  A+K++                         I  E+ I+
Sbjct: 70  TLGAGSFGVVKRAKQLHSDEDVAVKILLKRALEKNGGLEP------------IYDELNII 117

Query: 84  KLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGMS 143
           + L+HPN+++  D +ET +  Y+V + A  GELF+ ++  G   E +A+    QI+  + 
Sbjct: 118 QHLDHPNIVKFKDWFETESKFYIVTQLASGGELFDRIMHDGKYTEEDAVNIVVQILKAVE 177

Query: 144 YCHALGIVHRDLKPENIL-LDHKLN--IKIADFGMA-ALETEDKLLETSCGSPHYAAPEI 199
           Y H+  I+HRDLKPEN+L LD   +  I +ADFG+A  LE +D ++    GS  Y APE+
Sbjct: 178 YLHSQNIIHRDLKPENLLYLDKSKDSRIVLADFGIARQLENDDDVIYRPAGSLGYVAPEV 237

Query: 200 VSGLPYHGLETDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPGDDEIS 257
            +    HG  +D+WS GVI + LL G  PF  E  DG +  +       +F+ P  D IS
Sbjct: 238 FTS-DGHGKPSDIWSVGVITYTLLCGYSPFKAESVDGFLDEVTSDENPVKFQRPYWDGIS 296

Query: 258 KEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIK 294
           + A++ + +IL +DP  R  + E+L  P +Q   S++
Sbjct: 297 ELAKNFILRILDLDPACRPSATELLNDPWIQSKCSLR 333

>ZYRO0E05588g Chr5 (430271..431686) [1416 bp, 471 aa] {ON} similar
           to uniprot|P22517 Saccharomyces cerevisiae YOL016C CMK2
           Calmodulin-dependent protein kinase and to YFR014C
           uniprot|P27466 Saccharomyces cerevisiae YFR014C CMK1
           Calmodulin-dependent protein kinase
          Length = 471

 Score =  144 bits (363), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 91/277 (32%), Positives = 145/277 (52%), Gaps = 22/277 (7%)

Query: 19  WKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIER 78
           +  G TLG G+ G V+ A   ST Q  A+K++                   D     +  
Sbjct: 59  YVFGRTLGAGTFGIVRQARRYSTKQNVAVKILLKKALKGN-----------DVQLQMLYD 107

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           E+ I++ L HPN++R  D +E+ +  Y+V + A  GELF+ ++ KG   E +A++   Q+
Sbjct: 108 ELSILQKLRHPNIVRFEDWFESKDKFYIVTQLATGGELFDRIIAKGHFTEEDAVKIVVQM 167

Query: 139 IIGMSYCHALGIVHRDLKPENILLDHKLN---IKIADFGMA-ALETEDKLLETSCGSPHY 194
           +  + Y H+  IVHRDLKPENIL     +   + IADFG+A  L   D+L+  + GS  Y
Sbjct: 168 LNAVEYMHSENIVHRDLKPENILYIDPSDDSPLVIADFGIAKELHNNDELIFKAAGSLGY 227

Query: 195 AAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDD 254
            APE+++    HG   D+WS GVI + LL G  PF  E  ++   L +V K  + +   +
Sbjct: 228 VAPEVLT-TNGHGKPCDIWSLGVITYTLLCGYSPFVAE--SVEGFLEEVAKDRYPVKFHE 284

Query: 255 E----ISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
           +    IS EA+  + + L ++P+ R  + E+L  P +
Sbjct: 285 QYWSKISTEARRFILRALEINPQYRPTASELLCDPWI 321

>Smik_6.408 Chr6 complement(657018..658163) [1146 bp, 381 aa] {ON}
           YPL203W (REAL)
          Length = 381

 Score =  142 bits (357), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 91/278 (32%), Positives = 141/278 (50%), Gaps = 24/278 (8%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           T+  +++  TLG GS G+V L  +    +  AIKV+                        
Sbjct: 67  TLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQVVKMKQVEHTND-------- 118

Query: 75  GIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRF 134
             ER   ++KL+ HP ++R++  ++   N++MV++Y E GELF+LL +    P   A  +
Sbjct: 119 --ERR--MLKLVEHPFLIRMWGTFQDAKNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFY 174

Query: 135 FRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHY 194
             ++I+ + Y HA  I++RDLKPENILLD   +IKI DFG A  +    +  T CG+P Y
Sbjct: 175 AAEVILALEYLHAHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTPDY 232

Query: 195 AAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDD 254
            APE+++  PY+    D WS GV+++ +L G  PF   D        K+ +G+   P   
Sbjct: 233 IAPEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYP--P 287

Query: 255 EISKEAQDLLYKILVVDPEKRI-----KSREILKHPLL 287
               +  DLL K++  D  +RI      SR+I  HP  
Sbjct: 288 YFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 325

>Kwal_56.24059 s56 complement(829673..830734) [1062 bp, 353 aa] {ON}
           YPL203W (TPK2) - cAMP-dependent protein kinase catalytic
           subunit [contig 166] FULL
          Length = 353

 Score =  141 bits (355), Expect = 9e-36,   Method: Compositional matrix adjust.
 Identities = 87/269 (32%), Positives = 139/269 (51%), Gaps = 24/269 (8%)

Query: 24  TLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREIIIM 83
           TLG GS G+V L  +    +  AIKV+                          ER   ++
Sbjct: 48  TLGTGSFGRVHLVRSVHNGRYYAIKVLKKEQVIRMKQIEHTND----------ERR--ML 95

Query: 84  KLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGMS 143
           KL++HP ++R++  ++ + NL+MV++Y E GELF+LL +    P   A  +  ++I+ + 
Sbjct: 96  KLVDHPFLIRMWGTFQDSRNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVILALE 155

Query: 144 YCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGL 203
           Y H+  I++RDLKPENILLD   +IKI DFG A  +  D +  T CG+P Y APE+++  
Sbjct: 156 YLHSHDIIYRDLKPENILLDRNGHIKITDFGFA--KEVDTVTWTLCGTPDYIAPEVIATK 213

Query: 204 PYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQDL 263
           PY+    D WS G+++F +L G  PF   D        K+ +G+   P       +  DL
Sbjct: 214 PYNK-SVDWWSLGILIFEMLAGYTPF--YDATPMKTYEKILQGKVAYP--PFFHPDVVDL 268

Query: 264 LYKILVVDPEKRIKS-----REILKHPLL 287
           L K++  D  +R+ +     +++  HP  
Sbjct: 269 LCKLITSDLTRRLGNLQSGPQDVKSHPWF 297

>ZYRO0E07018g Chr5 (531316..532419) [1104 bp, 367 aa] {ON} similar
           to uniprot|P38991 Saccharomyces cerevisiae YPL209C IPL1
           Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 367

 Score =  141 bits (356), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 122/214 (57%), Gaps = 5/214 (2%)

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
             RE+ I   LNH N+ +LY  +  +  +Y+++EY   GEL+ LL  KGPL +  A  + 
Sbjct: 154 FRREVEIQSSLNHQNLTKLYGYFHDDKRVYLLMEYLVNGELYKLLRAKGPLDDIFASHYV 213

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            Q+   + Y H   I+HRD+KPENIL+     +K+ DFG + +       +T CG+  Y 
Sbjct: 214 YQMADALDYMHQRNIIHRDVKPENILIGFDNTVKLTDFGWSIINPRGTKRKTMCGTLDYL 273

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           +PE+++   Y   + DVW+ GV+ F L+    PF+E+   + +   ++ +G+ + P  + 
Sbjct: 274 SPELIASKEYDD-KVDVWALGVLTFELVVNSPPFEEDSKELTS--KRIVRGDLKFP--NH 328

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
           IS +AQDL+ K+L  + + RI  RE+ +HP + K
Sbjct: 329 ISSDAQDLITKLLRHNSKDRISLREVKQHPWITK 362

>KLTH0H03982g Chr8 complement(363432..364628) [1197 bp, 398 aa] {ON}
           similar to uniprot|P38991 Saccharomyces cerevisiae
           YPL209C IPL1 Aurora kinase involved in regulating
           kinetochore-microtubule attachments associates with
           Sli5p which stimulates Ipl1p kinase activity and
           promotes its association with the mitotic spindle
           potential Cdc28p substrate
          Length = 398

 Score =  142 bits (358), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 73/214 (34%), Positives = 117/214 (54%), Gaps = 5/214 (2%)

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
             RE+ I   L HPN+ RLY  +     +Y+++EY   GEL+  L   GP  +  A  F 
Sbjct: 185 FRREVEIQSSLKHPNLTRLYGYFHDEKRVYLLMEYLVNGELYKHLRSHGPFNDIVASHFV 244

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            Q+   + Y H+  I+HRD+KPENILL  +  +K+ DFG +     +    T CG+  Y 
Sbjct: 245 YQMADALDYMHSKHIIHRDIKPENILLGFQNTLKLTDFGWSVTNLNNSRRRTLCGTMDYL 304

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           +PE++    Y   + DVW+ GV+ + LL G  PF E+   +     ++++ + + P  D 
Sbjct: 305 SPELIKSREYDN-KVDVWALGVLTYELLVGTPPFLEDSKEM--TYKRIKRRDLKFP--DH 359

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
           IS +A+D++ K+L  +P  RI  R++ KHP + K
Sbjct: 360 ISSQARDIISKLLEYEPNARIALRDVKKHPWILK 393

>TDEL0G04380 Chr7 (792278..794446) [2169 bp, 722 aa] {ON} Anc_6.31
           YMR001C
          Length = 722

 Score =  147 bits (372), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 84/229 (36%), Positives = 131/229 (57%), Gaps = 7/229 (3%)

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFR-Q 137
           EI I K + H N+++  D +E   N+Y++LE    G L  LL ++  L E E +RFF  Q
Sbjct: 148 EIQIHKSMRHANIVQFIDCFEDETNVYILLEICPNGSLMELLKKRKTLTEPE-VRFFTTQ 206

Query: 138 IIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLE-TSCGSPHYAA 196
           I  G+ Y H+  ++HRDLK  NI  D   N+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 207 ICGGIKYMHSRRVIHRDLKLGNIFFDKNYNLKIGDFGLAAVLANDRERKYTVCGTPNYIA 266

Query: 197 PEIVSG-LPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           PE++ G    H  E D+WS GV+++ALL G+ PF  +D N   +  +++  +F  P +  
Sbjct: 267 PEVLMGKHSGHSYEVDIWSIGVMIYALLIGKPPFQAKDVN--TIYERIKCCDFVFPKEKY 324

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK-YPSIKDSKTIRNLP 303
           IS EA+ L+  +L +DP +R    E+L +   +  +P    S  +  +P
Sbjct: 325 ISSEARILVQDLLSLDPLERPSIMEVLDYVWFRGIFPPYIQSDVMTEVP 373

>KNAG0D01140 Chr4 (192308..193495) [1188 bp, 395 aa] {ON} 
          Length = 395

 Score =  142 bits (357), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 91/278 (32%), Positives = 143/278 (51%), Gaps = 24/278 (8%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           T+  +++  TLG GS G+V L  +    +  AIKV+                        
Sbjct: 80  TLNDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKTQVVRMKQIEHTND-------- 131

Query: 75  GIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRF 134
             ER   ++KL+ HP ++R++  ++  +NL+MV++Y E GELF+LL +    P   A  +
Sbjct: 132 --ERR--MLKLVEHPFLIRMWGTFQDAHNLFMVMDYIEGGELFSLLRKSQRFPNPVAKFY 187

Query: 135 FRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHY 194
             ++++ + Y H   I++RDLKPENILLD   +IKI DFG A  E E  +  T CG+P Y
Sbjct: 188 AAEVVLALEYLHFHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVE-SVTWTLCGTPDY 245

Query: 195 AAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDD 254
            APE+++  PY+    D WS G+++F +L G  PF   D        K+ +G+   P   
Sbjct: 246 IAPEVIATKPYNK-SVDWWSLGILIFEMLAGYTPF--YDSTPMKTYEKILQGKVIYP--P 300

Query: 255 EISKEAQDLLYKILVVDPEKRI-----KSREILKHPLL 287
               +  DLL K++  D  +RI      S++I +HP  
Sbjct: 301 FFHPDVVDLLSKLITADLTRRIGNLQSGSQDIKQHPWF 338

>Smik_15.153 Chr15 complement(261920..263248) [1329 bp, 442 aa] {ON}
           YOL016C (REAL)
          Length = 442

 Score =  143 bits (360), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 91/273 (33%), Positives = 143/273 (52%), Gaps = 18/273 (6%)

Query: 21  LGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREI 80
            G TLG GS G V+ A   STN+  AIK++                         +  E+
Sbjct: 49  FGRTLGAGSFGVVRQARKLSTNEDVAIKILLKKALQGNNVQLQM-----------LYEEL 97

Query: 81  IIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIII 140
            I++ L+HPN++   D +E+ +  Y+V + A  GELF+ ++ +G   E +A+    QI+ 
Sbjct: 98  SILQKLSHPNIVSFKDWFESKDKFYIVTQLATGGELFDRILSRGKFTEVDAVEIVVQILG 157

Query: 141 GMSYCHALGIVHRDLKPENIL-LDHKLN--IKIADFGMA-ALETEDKLLETSCGSPHYAA 196
            + Y H+  +VHRDLKPEN+L +D   N  + IADFG+A  L+ ++ L+  + GS  Y A
Sbjct: 158 AVEYMHSKNVVHRDLKPENVLYVDKSENSPLVIADFGIAKQLKGKEDLIYKAAGSLGYVA 217

Query: 197 PEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEE--DGNIRNLLLKVQKGEFEMPGDD 254
           PE+++    HG   D+WS GVI + LL G  PF  E  +G +           F +P  D
Sbjct: 218 PEVLTQ-DGHGKPCDIWSIGVITYTLLCGYSPFIAESVEGFMEECTASRYPVTFHIPYWD 276

Query: 255 EISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
            IS +A+  + K L ++P +R  + E+L  P +
Sbjct: 277 NISIDAKRFILKALRLNPTERPTATELLDDPWI 309

>Smik_4.135 Chr4 complement(256861..258402) [1542 bp, 513 aa] {ON}
           YDL101C (REAL)
          Length = 513

 Score =  144 bits (363), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 89/296 (30%), Positives = 144/296 (48%), Gaps = 40/296 (13%)

Query: 19  WKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIER 78
           + LG+ LG G    V+ A N+ T QQ A+K+                             
Sbjct: 200 YLLGKELGSGHYALVKEAKNKKTGQQVAVKIFHAQQNDDQKKNKQ------------FRE 247

Query: 79  EIIIMKLLNHPNVLRLYDVW-----ETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIR 133
           E  I+  + HPN++ L D +     ++    Y+VLE  + GELF  +V K  L ++E+  
Sbjct: 248 ETNILMRVQHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKA 307

Query: 134 FFRQIIIGMSYCHALGIVHRDLKPENILL-------------------DHKLNIKIADFG 174
            F+Q++ G+ Y H   I+HRD+KPEN+LL                   +  + +KIADFG
Sbjct: 308 LFKQLLTGLKYLHEQNIIHRDIKPENVLLNITRRKNSSQVQLGPWDEDEIDIQVKIADFG 367

Query: 175 MAALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDG 234
           +A    E +   T CG+P Y APE+++   Y   + D+WS GVIL+  L G  PF ++ G
Sbjct: 368 LAKFTGEMQFTNTLCGTPSYVAPEVLTKKGYTS-KVDLWSAGVILYVCLCGFPPFSDQLG 426

Query: 235 --NIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQ 288
             +++  +L+  K  F  P  D+I      L+  +LV++P++R    + + HP  +
Sbjct: 427 PPSLKEQILQA-KYAFYSPYWDKIDDSVLHLISNLLVLNPDERYNIDDAMNHPWFK 481

>ZYRO0C07480g Chr3 (565426..567750) [2325 bp, 774 aa] {ON} highly
           similar to uniprot|P32562 Saccharomyces cerevisiae
           YMR001C
          Length = 774

 Score =  147 bits (371), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 98/300 (32%), Positives = 153/300 (51%), Gaps = 26/300 (8%)

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           EI I K + H N+++  D +E + N+Y++LE    G L  LL ++  L E E +RFF   
Sbjct: 192 EIQIHKSMKHQNIVQFIDCFEDDTNVYILLEICPNGSLMELLKKRKQLTEPE-VRFFTTQ 250

Query: 139 IIG-MSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLE-TSCGSPHYAA 196
           I G + Y H+  ++HRDLK  NI  D   N+KI DFG+AA+   D+  + T CG+P+Y A
Sbjct: 251 ICGAIKYMHSRRVIHRDLKLGNIFFDRNYNLKIGDFGLAAVLANDRERKFTVCGTPNYIA 310

Query: 197 PEIVSG-LPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           PE++ G    H  E DVWS GV+++ALL G+ PF  +D N   +  +++  +F  P +  
Sbjct: 311 PEVLMGKHSGHSYEVDVWSIGVMVYALLVGKPPFQAKDVN--TIYERIKCCDFIFPKEKP 368

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK-YPSIKDSKTIRNLPR-------EDT 307
           IS EA+ L+  +L +DP +R    EI+ +   +  +P    S  +  +P        E++
Sbjct: 369 ISHEAKVLVQDLLSLDPLERPSISEIMDYVWFRGIFPPYIQSNVMTEVPYYENRITLEES 428

Query: 308 YLN--------PLIGNDGGD----ATIDKTILQNLVVLWHGRNEDDIAKKLREPGANAEK 355
           ++N         L+  DG D      I   + Q+   + H  N   I      PG    K
Sbjct: 429 FINFKNCVIKSGLLTTDGTDNFNLRDIISLVSQDSAEMSHNENRQTILPHSISPGGTKNK 488

>KLLA0C06138g Chr3 (540409..542535) [2127 bp, 708 aa] {ON} similar
           to uniprot|P32562 Saccharomyces cerevisiae YMR001C
          Length = 708

 Score =  146 bits (369), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 81/231 (35%), Positives = 132/231 (57%), Gaps = 5/231 (2%)

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           EI I K + HPN+++  D +E + N+Y++LE    G +  LL ++  L E E      QI
Sbjct: 137 EIQIHKSMKHPNIVQFTDCFEDDTNVYILLEICPNGSVMELLRQRKHLTEPEVRFCMIQI 196

Query: 139 IIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLE-TSCGSPHYAAP 197
           I  + Y H+  ++HRDLK  NI  D + N+KI DFG+AA+   DK  + T CG+P+Y AP
Sbjct: 197 IGAIRYMHSRRVIHRDLKLGNIFFDKEYNLKIGDFGLAAVLANDKERKYTICGTPNYIAP 256

Query: 198 EIVSGLPY-HGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDEI 256
           E+++G    H  E D+WS GV+L+ALL G+ PF  ++  +  +  +++  +F  P D  +
Sbjct: 257 EVLTGKHTGHSYEVDIWSIGVMLYALLFGKPPFQAKE--VETIYERIKCRDFIFPADKPV 314

Query: 257 SKEAQDLLYKILVVDPEKRIKSREILKHPLLQK-YPSIKDSKTIRNLPRED 306
           S +A++L+  +L ++P  R    EI  +   +  +PS   S   + +P  D
Sbjct: 315 SSDAKNLISHLLQLNPAARPSLYEITDNVWFRNTFPSRLPSTITKEIPNFD 365

>NCAS0B04490 Chr2 (814474..815523) [1050 bp, 349 aa] {ON} Anc_8.141
          Length = 349

 Score =  139 bits (351), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 74/212 (34%), Positives = 120/212 (56%), Gaps = 5/212 (2%)

Query: 76  IEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFF 135
             RE+ I   LNHPN+ +LY  +     +Y+++EY   GEL+ LL   GP  +  A RF 
Sbjct: 136 FRREVEIQTSLNHPNLTKLYGHFHDEKRVYLLMEYLVYGELYKLLRSHGPFNDVIASRFV 195

Query: 136 RQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYA 195
            QI   ++Y H   I+HRDLKPENIL+     IK+ DFG + +       +T CG+  Y 
Sbjct: 196 FQIADALNYLHDKQIIHRDLKPENILIGFNNVIKLTDFGWSIINPRGVKRKTLCGTIDYL 255

Query: 196 APEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDE 255
           +PE++    Y   + DVW+ GV+ + L+ G  PF+E+   +     ++ K + + P  + 
Sbjct: 256 SPEMIRSREYDD-KVDVWALGVLTYELIVGSPPFEEDTKEL--TYKRILKNDIKFP--ET 310

Query: 256 ISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
           +S + +DL+ K+L  +P +RI  R+++KHP +
Sbjct: 311 VSHDVKDLISKLLKYNPSERISMRDVMKHPWI 342

>KAFR0K02450 Chr11 (504087..504131,504190..505680) [1536 bp, 511 aa]
           {ON} 
          Length = 511

 Score =  143 bits (361), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 95/295 (32%), Positives = 139/295 (47%), Gaps = 40/295 (13%)

Query: 19  WKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIER 78
           + LG  LG G    V+   N+ T Q  A+K+                       S     
Sbjct: 197 YTLGRELGSGHYAIVKEGKNKQTGQTVAVKIFHPQQNDDQKK------------SKQFRE 244

Query: 79  EIIIMKLLNHPNVLRLYD-----VWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIR 133
           E  I+  ++HPN++ L D     + +     Y+VLE  + GELF+ +V+K  L ++E   
Sbjct: 245 ETNILMRIHHPNIVNLLDSFVEPISKQQTQKYLVLEKIDNGELFDRIVKKTCLRQDETKA 304

Query: 134 FFRQIIIGMSYCHALGIVHRDLKPENILL--------DHK-----------LNIKIADFG 174
            F QI+ G+ Y H   I+HRD+KPENILL        D K           + +KIADFG
Sbjct: 305 IFTQILHGLKYLHGQNIIHRDIKPENILLNITKRTSPDQKQLGPWDDDEIDVQVKIADFG 364

Query: 175 MAALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDG 234
           +A    E +   T CG+P Y APE++    Y   + D+WS GVIL+  L G  PF ++ G
Sbjct: 365 LAKFTGEMQFTNTLCGTPSYVAPEVLIKKGYTS-KVDMWSSGVILYVCLCGFPPFSDQLG 423

Query: 235 --NIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
              ++  +L+  K  F  P  D I      L+  +LV+DPE+R    +   HP L
Sbjct: 424 PPALKEQILQA-KFAFYTPYWDNIDDSILHLISHLLVLDPEQRYSVSDAFNHPWL 477

>KAFR0I02010 Chr9 complement(411589..412887) [1299 bp, 432 aa] {ON}
           Anc_1.374 YFR014C
          Length = 432

 Score =  141 bits (356), Expect = 3e-35,   Method: Compositional matrix adjust.
 Identities = 90/279 (32%), Positives = 150/279 (53%), Gaps = 22/279 (7%)

Query: 17  GPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGI 76
           G +  G+TLG G+ G V+ A   ST++  A+K+I                   D     +
Sbjct: 37  GNYTFGKTLGAGTFGVVRQARKVSTDEDVAVKIILKKALKGN-----------DIQLQML 85

Query: 77  EREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFR 136
             E+ I++ L+HPN++   D +E+ +  Y+V + A  GELF+ ++ KG   E +A++   
Sbjct: 86  YDELSILQHLSHPNIVEFKDWFESRDKFYIVTQLAIGGELFDRILSKGKFTELDAVKIVV 145

Query: 137 QIIIGMSYCHALGIVHRDLKPENILLDHKLN---IKIADFGMA-ALETEDKLLETSCGSP 192
           QI+  + Y H+  +VHRDLKPEN+L     +   I IADFG+A  L+ ++ L+  + GS 
Sbjct: 146 QILGAIEYMHSQDVVHRDLKPENVLYVDNSDSSPIVIADFGIAKKLKNKNDLIFKAAGSL 205

Query: 193 HYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEM-- 250
            Y APE+++    HG   D+WS GVI + LL G   F  E   +   L +  + +F +  
Sbjct: 206 GYVAPEVLTE-GGHGKPCDIWSLGVITYTLLCGYSAFIAE--TVEGFLEECTRSKFPVKF 262

Query: 251 --PGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
             P  D IS EA++ + + L ++P++R  + E+L+ P +
Sbjct: 263 HKPYWDNISDEAKNFILRSLTLNPDERPTATELLEDPWI 301

>TPHA0G01600 Chr7 complement(329313..331850) [2538 bp, 845 aa] {ON}
           Anc_8.676 YPL153C
          Length = 845

 Score =  146 bits (369), Expect = 4e-35,   Method: Compositional matrix adjust.
 Identities = 88/281 (31%), Positives = 146/281 (51%), Gaps = 33/281 (11%)

Query: 23  ETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREIII 82
           E +G G+   V+ A   ST +  A+K+I                        G+ RE+ +
Sbjct: 201 EVVGQGAFAIVKKAVERSTGKTFAVKIISKRKVMGNMD--------------GVTRELEV 246

Query: 83  MKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGM 142
           ++ L+HP ++RL   +E   + Y+++E+   G+L + +   G + E+      RQI+  +
Sbjct: 247 LRKLDHPRIVRLKGFYEDEESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAV 306

Query: 143 SYCHALGIVHRDLKPENILL--DHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 200
            Y H+  I HRDLKP+NIL+  D  + +KI DFG+A ++     ++T CG+  Y APEI+
Sbjct: 307 KYIHSKCISHRDLKPDNILIEQDDPVLVKITDFGLAKVQGNGTFMKTFCGTLAYVAPEII 366

Query: 201 SG----------LPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQKGEF- 248
           SG            Y  L  D+WS G +++ +LTG LPF    G+ +  L K V+ G + 
Sbjct: 367 SGSNNLEENEERNEYSSL-VDMWSIGCLVYVILTGHLPF---SGSTQEQLYKQVRNGSYH 422

Query: 249 EMPGDD-EISKEAQDLLYKILVVDPEKRIKSREILKHPLLQ 288
           E P  D  IS EA++ +  +L V+P  R+ +   L+HP ++
Sbjct: 423 EGPLKDFRISDEARNFIDSLLQVNPNDRLSAERALQHPWIK 463

>SAKL0C05368g Chr3 complement(510576..511832) [1257 bp, 418 aa] {ON}
           similar to uniprot|P05986 Saccharomyces cerevisiae
           YKL166C TPK3 Involved in nutrient control of cell growth
           and division cAMP-dependent protein kinase catalytic
           subunit
          Length = 418

 Score =  140 bits (354), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 91/306 (29%), Positives = 149/306 (48%), Gaps = 28/306 (9%)

Query: 24  TLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREIIIM 83
           TLG GS G+V L  +    +  A+KV+                          ER   ++
Sbjct: 113 TLGTGSFGRVHLVRSNHNGRFYAMKVLKKRTIVKLKQVEHTND----------ERR--ML 160

Query: 84  KLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGMS 143
            +++HP  +R++  ++    ++M+++Y E GELF+LL +    P   A  +  ++ + + 
Sbjct: 161 SVVSHPFTIRMWGTFQDAQQVFMIMDYIEGGELFSLLRKSQRFPNPVAKFYAAEVCLALE 220

Query: 144 YCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGL 203
           Y H++ I++RDLKPENILLD   +IK+ DFG A    +  +  T CG+P Y APE+VS  
Sbjct: 221 YLHSMDIIYRDLKPENILLDKNGHIKLTDFGFAKYVPD--VTYTLCGTPDYIAPEVVSTK 278

Query: 204 PYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQDL 263
           PY+    D WS G+++F +L G  PF   D N       +   E + P       +AQDL
Sbjct: 279 PYNK-SVDWWSFGILIFEMLAGYTPF--YDSNTMKTYENILNAELQFPS--IFHPDAQDL 333

Query: 264 LYKILVVDPEKRI-----KSREILKHPLLQKYPSIKDSKTIRNLPREDTYLNPLIGNDGG 318
           L +++  D  KR+      S ++ +HP   +   + D    RN+  E  Y  P+    G 
Sbjct: 334 LCRLITRDLSKRLGNLQNGSEDVKRHPWFSE--VVWDKLLCRNI--ETPYEPPIQPGQGD 389

Query: 319 DATIDK 324
            +  D+
Sbjct: 390 TSQFDR 395

>Suva_16.104 Chr16 (176201..177352) [1152 bp, 383 aa] {ON} YPL203W
           (REAL)
          Length = 383

 Score =  140 bits (352), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 90/278 (32%), Positives = 140/278 (50%), Gaps = 24/278 (8%)

Query: 15  TIGPWKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSY 74
           T+  +++  TLG GS G+V L  +    +  AIKV+                        
Sbjct: 69  TLHDFQIMRTLGTGSFGRVHLVRSVHNGRYYAIKVLKKQQIVKMKQVEHTND-------- 120

Query: 75  GIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRF 134
             ER   ++KL+ HP ++R++  ++   N++MV++Y E GELF+LL +    P   A  +
Sbjct: 121 --ERR--MLKLVEHPFLIRMWGTFQDARNIFMVMDYIEGGELFSLLRKSQRFPNPVAKFY 176

Query: 135 FRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHY 194
             ++I+ + Y H   I++RDLKPENILLD   +IKI DFG A  +    +  T CG+P Y
Sbjct: 177 AAEVILALEYLHGHNIIYRDLKPENILLDRNGHIKITDFGFA--KEVQTVTWTLCGTPDY 234

Query: 195 AAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDD 254
            APE+++  PY+    D WS GV+++ +L G  PF   D        K+ +G+   P   
Sbjct: 235 IAPEVITTKPYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILQGKVIYP--P 289

Query: 255 EISKEAQDLLYKILVVDPEKRI-----KSREILKHPLL 287
               +  DLL K++  D  +RI      SR+I  HP  
Sbjct: 290 YFHPDVVDLLSKLITADLTRRIGNLQSGSRDIKAHPWF 327

>Skud_4.154 Chr4 complement(275783..277324) [1542 bp, 513 aa] {ON}
           YDL101C (REAL)
          Length = 513

 Score =  142 bits (359), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 90/296 (30%), Positives = 145/296 (48%), Gaps = 40/296 (13%)

Query: 19  WKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIER 78
           + LG+ LG G    V+ A N+ + QQ A+K+                             
Sbjct: 200 YLLGKELGAGHYALVKEAKNKKSGQQVAVKIFHAQQNDDQKKNKQ------------FRE 247

Query: 79  EIIIMKLLNHPNVLRLYDVW-----ETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIR 133
           E  I+  ++HPN++ L D +     ++    Y+VLE  + GELF  +V K  L ++E+  
Sbjct: 248 ETNILMRVHHPNIVNLLDSFVEPISKSQIQKYLVLEKIDDGELFERIVRKTCLRQDESKA 307

Query: 134 FFRQIIIGMSYCHALGIVHRDLKPENILL-------------------DHKLNIKIADFG 174
            F+Q++ G+ Y H   I+HRD+KPENILL                   +  + +KIADFG
Sbjct: 308 LFKQLLTGLKYLHEQNIIHRDIKPENILLNITRRENSNQAQLGPWDEDEIDIQVKIADFG 367

Query: 175 MAALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDG 234
           +A    E +   T CG+P Y APE+++   Y   + D+WS GVIL+  L G  PF ++ G
Sbjct: 368 LAKFTGEMQFTNTLCGTPSYVAPEVLTKKGYSS-KVDLWSAGVILYVCLCGFPPFSDQLG 426

Query: 235 --NIRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQ 288
             +++  +L+  K  F  P  D+I      L+  +LV++P++R    E + HP  +
Sbjct: 427 PPSLKEQILQA-KYAFYSPYWDKIDDLVLHLISNLLVLNPDERYNIDEAMDHPWFK 481

>AFL188C Chr6 complement(88793..90211) [1419 bp, 472 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDL101C
           (DUN1)
          Length = 472

 Score =  141 bits (356), Expect = 7e-35,   Method: Compositional matrix adjust.
 Identities = 98/309 (31%), Positives = 146/309 (47%), Gaps = 42/309 (13%)

Query: 22  GETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREII 81
           G+ LG G    V+ A N+ T Q  A+K+                             E  
Sbjct: 158 GKELGSGHYAIVKEAINKITGQSVAVKIFHPQKNDDAKKTRQ------------FREETK 205

Query: 82  IMKLLNHPNVLRLYDVW-----ETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFR 136
           I+  LNH N+++L + +     ++    Y+VLE  + GELF+ +V K  L ++E    F+
Sbjct: 206 ILMGLNHENIVKLLERFVEPLSKSQVQTYLVLEKIQDGELFDKIVRKTKLHQDETRALFK 265

Query: 137 QIIIGMSYCHALGIVHRDLKPENILLDHK-------------------LNIKIADFGMAA 177
           QI+ G+ Y H   I+HRD+KPENILL  +                   + +KIADFG+A 
Sbjct: 266 QILAGLKYLHDRNIIHRDIKPENILLSIRRRTSPDQVQLGPWDEDELDITVKIADFGLAK 325

Query: 178 LETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDG--N 235
              E +   T CG+P Y A E+++   Y   + D+WS GV+L+  L G  PF ++    +
Sbjct: 326 FTGEMQFTTTLCGTPSYVAAEVLTKTGYTS-KVDLWSAGVLLYVCLCGFPPFSDQLAPPS 384

Query: 236 IRNLLLKVQKGEFEMPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSIKD 295
           ++  +L+  K  F  P  DEI      L+  +LVVDP KR   R+ + H  L K    K 
Sbjct: 385 MKEQILQ-GKFAFYSPYWDEIDDSVLHLISNLLVVDPAKRYSVRDAIGHEWLTKTDDSKT 443

Query: 296 SKTIRNLPR 304
           SK  R  PR
Sbjct: 444 SKVER--PR 450

>ACR142W Chr3 (597519..600032) [2514 bp, 837 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL153C (RAD53)
          Length = 837

 Score =  145 bits (366), Expect = 9e-35,   Method: Compositional matrix adjust.
 Identities = 88/286 (30%), Positives = 145/286 (50%), Gaps = 33/286 (11%)

Query: 23  ETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREIII 82
           E +G G+   V+ A   +T +  A+K+I                        G+ RE+ +
Sbjct: 221 EVVGQGAFATVKKAVERNTGKTFAVKIINKRKVMGNVD--------------GVTRELEV 266

Query: 83  MKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGM 142
           ++ LNHP ++ L   +E + + Y+++E+   G+L + +   G + E+      RQI+  +
Sbjct: 267 LRRLNHPRIVSLKGFYEDDESYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQILEAV 326

Query: 143 SYCHALGIVHRDLKPENILL--DHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 200
            Y H  GI HRDLKP+NIL+  D  + +KI DFG+A ++     ++T CG+  Y APE++
Sbjct: 327 RYIHEQGISHRDLKPDNILIEQDDPVLVKITDFGLAKIQDNTTFMKTFCGTLAYVAPEVI 386

Query: 201 SGLP----------YHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLK-VQKGEF- 248
            G            Y  L  D+WS G +++ +LTG LPF    G+ +  L K +  G + 
Sbjct: 387 GGKNPEGNGANGNLYSSL-VDMWSIGCLVYVILTGHLPF---SGSTQEQLYKQIANGSYH 442

Query: 249 EMPGDDE-ISKEAQDLLYKILVVDPEKRIKSREILKHPLLQKYPSI 293
           E P  D  IS EA+D +  +L ++P  R+ +   L+HP L    SI
Sbjct: 443 EGPLKDYWISDEARDFIDSLLQINPVDRLTAERALQHPWLHPCTSI 488

>ZYRO0F07370g Chr6 (595931..598219) [2289 bp, 762 aa] {ON} similar
           to uniprot|P22216 Saccharomyces cerevisiae YPL153C RAD53
           Protein kinase required for cell-cycle arrest in
           response to DNA damage activated by trans
           autophosphorylation when interacting with
           hyperphosphorylated Rad9p
          Length = 762

 Score =  144 bits (364), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 83/279 (29%), Positives = 143/279 (51%), Gaps = 30/279 (10%)

Query: 23  ETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREIII 82
           E +G G+   V+ A   ST +  A K+I                        G++RE+ +
Sbjct: 190 EVVGQGAFAVVKKAVERSTGKTFAAKIISKRKLMGNWD--------------GVDRELAV 235

Query: 83  MKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGM 142
           ++ L+HP ++RL   +E     Y+++E+   G+L + +   G + E+      RQ++  +
Sbjct: 236 LRKLHHPRIVRLKGFYEDKECYYLLMEFVSGGDLMDFVAAHGSVGEDAGREITRQVLEAV 295

Query: 143 SYCHALGIVHRDLKPENILL--DHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIV 200
           +Y H+ GI HRDLKP+NIL+  D  + +K+ DFG+A ++     ++T CG+  Y APE++
Sbjct: 296 AYIHSRGISHRDLKPDNILIEQDDPVLVKVTDFGLAKVQGNGTFMKTFCGTLAYVAPEVI 355

Query: 201 SGL---------PYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEF-EM 250
            G           Y  L  D+WS G +++ +LTG LPF         L  ++ +G + E 
Sbjct: 356 GGKNDNTEEEKNEYSSL-VDMWSMGCLVYVILTGHLPF--SGSTQEQLYEQISRGSYHEG 412

Query: 251 PGDD-EISKEAQDLLYKILVVDPEKRIKSREILKHPLLQ 288
           P  D  IS EA+D +  +L V+P  R  + + L+HP ++
Sbjct: 413 PLKDFRISDEARDFIDSLLQVNPNLRTTAEKALQHPWIR 451

>CAGL0G09020g Chr7 (860266..861351) [1086 bp, 361 aa] {ON} highly
           similar to uniprot|P06245 Saccharomyces cerevisiae
           YPL203w TPK2 cAMP-dependent protein kinase 2 catalytic
           chain
          Length = 361

 Score =  138 bits (347), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 92/269 (34%), Positives = 137/269 (50%), Gaps = 24/269 (8%)

Query: 24  TLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIEREIIIM 83
           TLG GS G+V L  +    +  AIKV+                 T D      ER   ++
Sbjct: 56  TLGTGSFGRVHLVRSVHNGRYYAIKVL----KKAQVVKMKQIEHTND------ERR--ML 103

Query: 84  KLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQIIIGMS 143
           KL+ HP ++R++  ++ + NL+MV++Y E GELF LL +    P   A  +  ++ + + 
Sbjct: 104 KLVEHPFLIRMWGTFQDSRNLFMVMDYIEGGELFTLLRKSQRFPNPVAKFYAAEVTLALE 163

Query: 144 YCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPHYAAPEIVSGL 203
           Y H   I++RDLKPENILLD   +IKI DFG A  E E  +  T CG+P Y APE+++  
Sbjct: 164 YLHFHNIIYRDLKPENILLDRNGHIKITDFGFAK-EVE-TVTWTLCGTPDYIAPEVIATK 221

Query: 204 PYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDDEISKEAQDL 263
           PY+    D WS GV+++ +L G  PF   D        K+  G+   P     + +  DL
Sbjct: 222 PYNK-SVDWWSLGVLIYEMLAGYTPF--YDTTPMKTYEKILHGKVVYP--QFFNSDVIDL 276

Query: 264 LYKILVVDPEKRI-----KSREILKHPLL 287
           L K+L  D  +RI      +++I  HP  
Sbjct: 277 LSKLLTADLTRRIGNLQKGAQDIKSHPWF 305

>Kpol_1023.26 s1023 (51805..54024) [2220 bp, 739 aa] {ON}
           (51805..54024) [2220 nt, 740 aa]
          Length = 739

 Score =  144 bits (363), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 79/230 (34%), Positives = 131/230 (56%), Gaps = 8/230 (3%)

Query: 79  EIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIRFFRQI 138
           EI I K + H N++   D +E + N+Y++LE    G L +LL  +  L E E +RFF   
Sbjct: 145 EIQIHKNMRHQNIVHFIDCFEDDINVYILLEICPNGSLMDLLKRRKILTEPE-VRFFTTQ 203

Query: 139 IIG-MSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAA-LETEDKLLETSCGSPHYAA 196
           I G + + H+  I+HRDLK  NI  D   N+KI DFG+AA +  E++   T CG+P+Y A
Sbjct: 204 ICGALDHMHSRNIIHRDLKLGNIFFDKDFNLKIGDFGLAAIINNENERKYTICGTPNYIA 263

Query: 197 PEIVSGLPY--HGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGDD 254
           PE++ G     H  E D+WS GV++FA++TG+ PF  ++  +  +  +++   +  P D 
Sbjct: 264 PEVIMGGKQIGHSFEVDIWSLGVMIFAMITGKPPFQAKE--VSTIYDRIKHCNYSFPTDK 321

Query: 255 EISKEAQDLLYKILVVDPEKRIKSREILKHPLLQ-KYPSIKDSKTIRNLP 303
            +SK+ + L+  IL ++P +R   +EIL +   +  +P       + ++P
Sbjct: 322 YVSKDVKKLIQDILSMNPMERPTIQEILNYNWFKGNFPPCMPIDVMNDIP 371

>TDEL0G02820 Chr7 complement(543911..545377,545450..545476) [1494
           bp, 497 aa] {ON} Anc_2.352 YDL101C
          Length = 497

 Score =  141 bits (355), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 89/295 (30%), Positives = 140/295 (47%), Gaps = 40/295 (13%)

Query: 19  WKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIER 78
           + +G+ LG+G    V+   N+ T Q  AIK+                           + 
Sbjct: 181 YVVGKELGVGHYATVKEGINKKTEQIVAIKIFHPQLNDDQKKNKQ------------FKE 228

Query: 79  EIIIMKLLNHPNVLRLYD-----VWETNNNLYMVLEYAEKGELFNLLVEKGPLPENEAIR 133
           E  I+  + H N+++L D     V ++    Y+VLE  + GELF+ ++ K  L ++E   
Sbjct: 229 ETDILMRVKHSNIVKLLDSYVETVSKSQIQKYLVLEKIDDGELFDRILRKTSLRQDETKA 288

Query: 134 FFRQIIIGMSYCHALGIVHRDLKPENILL-------------------DHKLNIKIADFG 174
            F+QI+ G+ Y H + I+HRD+KPENILL                   +  + +KIADFG
Sbjct: 289 LFKQILTGLQYLHGMNIIHRDIKPENILLNITKRSDPKELQKGPWDADEIDIQVKIADFG 348

Query: 175 MAALETEDKLLETSCGSPHYAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDG 234
           +A    E +   T CG+P Y APE++    Y   + D+WS GV+L+  L G  PF +  G
Sbjct: 349 LAKFTGEMQFTNTLCGTPSYVAPEVLRKTDYSS-KVDMWSAGVLLYVCLCGFPPFSDTLG 407

Query: 235 NIRNLLLKVQKGEFEM--PGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
              +L  ++ +G F    P  DEI      L+  +LVV+P  R    + ++HP  
Sbjct: 408 P-PSLKEQIAQGIFAFYSPYWDEIDDSVLHLISHLLVVNPTNRYSVEDTIRHPWF 461

>TBLA0A02050 Chr1 (495735..497039) [1305 bp, 434 aa] {ON} 
          Length = 434

 Score =  139 bits (351), Expect = 1e-34,   Method: Compositional matrix adjust.
 Identities = 82/276 (29%), Positives = 145/276 (52%), Gaps = 26/276 (9%)

Query: 19  WKLGETLGLGSTGKVQLAYNESTNQQAAIKVIXXXXXXXXXXXXXXXXXTPDSLSYGIE- 77
           +++G  LG G  GKV    ++ +   +A+KV+                   + +SY  E 
Sbjct: 175 FEIGRGLGKGKFGKVYCVKHKQSGFISALKVMKKK----------------EIVSYNAEK 218

Query: 78  ---REIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELF-NLLVEKGPLPENEAIR 133
              RE+ +   LNHPN+++++  ++    +Y+++EY   GEL+ +L    GP  +  A  
Sbjct: 219 QFKREVEVQNSLNHPNIVKIFGFFQDEIFVYLIMEYLINGELYKSLKNNNGPFNDILASN 278

Query: 134 FFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCGSPH 193
           +  QI   + Y H+  I+HRD+KPENI+L     IK+ADFG +     +   +T CG+  
Sbjct: 279 YIYQIADALKYMHSKHIIHRDIKPENIVLGFNNKIKLADFGWSICTPPNLRRKTICGTID 338

Query: 194 YAAPEIVSGLPYHGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFEMPGD 253
           Y APE+V+   Y     D+W+ G++ + L+ G  PF+EE  ++     ++   +   P  
Sbjct: 339 YLAPELVTFKEY-DYNVDIWALGILTYELIVGNPPFEEETKDLT--YKRIINVDLNFP-- 393

Query: 254 DEISKEAQDLLYKILVVDPEKRIKSREILKHPLLQK 289
             +S +A+DL+ ++L  DP KR+   +++KHP + K
Sbjct: 394 QTVSMDARDLITRLLRFDPSKRMPLVDVMKHPWITK 429

>Smik_6.414 Chr6 (666806..667909) [1104 bp, 367 aa] {ON} YPL209C
           (REAL)
          Length = 367

 Score =  138 bits (347), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 75/218 (34%), Positives = 121/218 (55%), Gaps = 7/218 (3%)

Query: 71  SLSYGIEREIIIMKLLNHPNVLRLYDVWETNNNLYMVLEYAEKGELFNLLVEKGPLPENE 130
           +L     RE+ I   LNHPN+ + Y  +     +Y+++EY   GE++ LL   GP  +  
Sbjct: 144 NLQRQFRREVEIQTSLNHPNLTKSYGYFHDEKRVYLLMEYLVNGEMYKLLRSHGPFNDIL 203

Query: 131 AIRFFRQIIIGMSYCHALGIVHRDLKPENILLDHKLNIKIADFGMAALETEDKLLETSCG 190
           A  +  QI   + Y H   I+HRD+KPENIL+     IK+ DFG + +   D   +T CG
Sbjct: 204 ASDYVYQIANALDYMHKKNIIHRDIKPENILIGFNNIIKLTDFGWSIINPPDSRRKTVCG 263

Query: 191 SPHYAAPEIVSGLPY-HGLETDVWSCGVILFALLTGRLPFDEEDGNIRNLLLKVQKGEFE 249
           +  Y +PE++    Y H +  D W+ GV+ F LLTG  PF+EE  +      ++   + +
Sbjct: 264 TIDYLSPEMIESREYDHTI--DAWALGVLAFELLTGAPPFEEEMKD--TTYKRIAALDIK 319

Query: 250 MPGDDEISKEAQDLLYKILVVDPEKRIKSREILKHPLL 287
           +P +  IS++AQDL+ K+L  DP+ R++  ++  HP +
Sbjct: 320 IPSN--ISQDAQDLILKLLKYDPKDRMRLEDVKMHPWI 355

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.130    0.357 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 113,115,155
Number of extensions: 5207651
Number of successful extensions: 34531
Number of sequences better than 10.0: 2735
Number of HSP's gapped: 30788
Number of HSP's successfully gapped: 3288
Length of query: 1123
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 1003
Effective length of database: 39,721,479
Effective search space: 39840643437
Effective search space used: 39840643437
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 71 (32.0 bits)