Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_2002.31.2ON22322311471e-161
TPHA0E040701.2ON2312306187e-81
TPHA0E036101.121ON2312306187e-81
KAFR0D007201.121ON2062174352e-53
ZYRO0F15818g1.121ON2252194321e-52
ZYRO0F18568g1.2ON2252194321e-52
Suva_3.1471.2ON2102164032e-48
YCR039C (MATALPHA2)1.121ON2102164032e-48
YCL067C (HMLALPHA2)1.2ON2102164032e-48
Skud_3.1181.121ON2102164032e-48
KNAG0C001601.2ON2032173804e-45
NDAI0A001101.2ON2112153796e-45
NCAS0B091401.2ON2052243604e-42
Skud_102.1singletonON1851913533e-41
Smik_95.1singletonON1851913533e-41
TBLA0A070501.121ON2612443566e-41
CAGL0B01265g1.121ON1862123491e-40
Smik_3.1421.121ON2281913512e-40
TBLA0A076001.2ON2302303442e-39
CAGL0B00264g1.2ON2102123404e-39
Suva_3.135singletonON119903185e-37
Suva_3.74singletonON119903185e-37
Suva_3.751.121ON119903185e-37
YCR096C (HMRA2)singletonOFF119903185e-37
Ecym_11151.121ON2302343007e-33
Ecym_10021.2ON2302343007e-33
TDEL0C070001.2ON2372382808e-30
KLLA0C00374g1.2ON223861899e-17
TBLA0C037406.170ON293671285e-08
TPHA0B025806.170ON264571285e-08
KLTH0F00396g1.2ON108511181e-07
Kwal_YGOB_matalpha21.121ON110811182e-07
Kwal_33.12995singletonOFF110811182e-07
Kwal_YGOB_HMalpha21.2ON110811182e-07
Kwal_33.matalpha2singletonOFF110811182e-07
Kpol_1036.566.170ON265721214e-07
Suva_16.1326.170ON292701198e-07
Skud_16.1036.170ON295701171e-06
Smik_7.1816.170ON274521162e-06
ZYRO0G22044g6.170ON201581142e-06
KNAG0M005006.170ON298521153e-06
KAFR0A043706.170ON409891153e-06
Smik_6.3746.170ON294641134e-06
CAGL0C01551g6.170ON221591124e-06
YGL096W (TOS8)6.170ON276521134e-06
Skud_7.1816.170ON274631135e-06
KLTH0H05236g6.170ON234511116e-06
Suva_7.1726.170ON270601117e-06
KLLA0B10450g6.170ON389731128e-06
AFL049C6.170ON257661108e-06
NDAI0F021706.170ON383971119e-06
Ecym_22476.170ON349591119e-06
TDEL0F018106.170ON256611101e-05
NCAS0H011306.170ON280561092e-05
YPL177C (CUP9)6.170ON306581092e-05
NCAS0D035706.170ON257521082e-05
NDAI0I013206.170ON409681092e-05
KAFR0G036506.170ON177521053e-05
SAKL0A05610g6.170ON320521064e-05
CAGL0H02959g6.170ON259521054e-05
KNAG0F022106.170ON324521064e-05
Kwal_27.110926.170ON229521038e-05
Skud_71.2singletonON4537820.004
Suva_69.1singletonON3434760.018
SAKL0H14036g8.382ON38846780.15
KLTH0E09108g2.414ON92876760.30
Smik_4.5525.322ON887137683.4
Suva_4.4248.588ON20656647.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_2002.3
         (223 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353...   446   e-161
TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 ...   242   7e-81
TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 ...   242   7e-81
KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating ...   172   2e-53
ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa] ...   171   1e-52
ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa] ...   171   1e-52
Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}...   159   2e-48
YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}  M...   159   2e-48
YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}  HML...   159   2e-48
Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}...   159   2e-48
KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2 YC...   150   4e-45
NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  sil...   150   6e-45
NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {...   143   4e-42
Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)       140   3e-41
Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)         140   3e-41
TBLA0A07050 Chr1 (1728941..1729002,1729096..1729189,1729249..172...   141   6e-41
CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar...   139   1e-40
Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}...   139   2e-40
TBLA0A07600 Chr1 (1882710..1882771,1882865..1882958,1883018..188...   137   2e-39
CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly si...   135   4e-39
Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}...   127   5e-37
Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...   127   5e-37
Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON} ...   127   5e-37
YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}  ...   127   5e-37
Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa] ...   120   7e-33
Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa...   120   7e-33
TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {...   112   8e-30
KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON} uniprot|Q...    77   9e-17
TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON...    54   5e-08
TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.17...    54   5e-08
KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {...    50   1e-07
Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON} (...    50   2e-07
Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C ...    50   2e-07
Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON} ANNO...    50   2e-07
Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF} (m...    50   2e-07
Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON} (15399...    51   4e-07
Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {O...    50   8e-07
Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {O...    50   1e-06
Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W (...    49   2e-06
ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some ...    49   2e-06
KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}...    49   3e-06
KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {O...    49   3e-06
Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C (...    48   4e-06
CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {O...    48   4e-06
YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}  TOS8Homeodo...    48   4e-06
Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W (...    48   5e-06
KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {O...    47   6e-06
Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W (...    47   7e-06
KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some s...    48   8e-06
AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON} Sy...    47   8e-06
NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.1...    47   9e-06
Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}...    47   9e-06
TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON...    47   1e-05
NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON...    47   2e-05
YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}  ...    47   2e-05
NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.17...    46   2e-05
NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {O...    47   2e-05
KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.17...    45   3e-05
SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {O...    45   4e-05
CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some si...    45   4e-05
KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON...    45   4e-05
Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C...    44   8e-05
Skud_71.2 Chr71 (734..868) [135 bp, 45 aa] {ON} YCL067C (REAL)         36   0.004
Suva_69.1 Chr69 complement(1..102) [102 bp, 34 aa] {ON} YCR039C ...    34   0.018
SAKL0H14036g Chr8 (1200951..1202117) [1167 bp, 388 aa] {ON} weak...    35   0.15 
KLTH0E09108g Chr5 (823623..826409) [2787 bp, 928 aa] {ON} some s...    34   0.30 
Smik_4.552 Chr4 complement(1000275..1002938) [2664 bp, 887 aa] {...    31   3.4  
Suva_4.424 Chr4 (747821..748441) [621 bp, 206 aa] {ON} YBR171W (...    29   7.2  

>Kpol_2002.3 s2002 (4682..5353) [672 bp, 223 aa] {ON} (4682..5353)
           [672 nt, 224 aa]
          Length = 223

 Score =  446 bits (1147), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 223/223 (100%), Positives = 223/223 (100%)

Query: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT 60
           MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT
Sbjct: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT 60

Query: 61  VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANENYESQTSKENSEEELTSPSSSDS 120
           VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANENYESQTSKENSEEELTSPSSSDS
Sbjct: 61  VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANENYESQTSKENSEEELTSPSSSDS 120

Query: 121 NDRNEFVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISEL 180
           NDRNEFVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISEL
Sbjct: 121 NDRNEFVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISEL 180

Query: 181 MKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLLQELKTEKA 223
           MKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLLQELKTEKA
Sbjct: 181 MKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLLQELKTEKA 223

>TPHA0E04070 Chr5 complement(848980..849613,849670..849731) [696 bp,
           231 aa] {ON}   silenced copy of alpha2 at HMLalpha locus
          Length = 231

 Score =  242 bits (618), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 136/230 (59%), Positives = 173/230 (75%), Gaps = 12/230 (5%)

Query: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT 60
           MNKIPIN LLNPS   NL +KLQQIN  L++LC+K+P   + L + DH ELQ ILL+LTT
Sbjct: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60

Query: 61  VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANEN---------YESQTSKENSEEE 111
           VVK ++L  +EIMLV+TTYQL TTL++MVKS +  N+          YES TS +NSE  
Sbjct: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQENDKENKENEIIKYESGTS-DNSETN 119

Query: 112 LTSPSSSDSNDRNE-FVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENP 170
            +S +SSD+ D+N   VFN++TQDMMN  K N KSYRGHRLPK+NV+ LE WY+ + +NP
Sbjct: 120 -SSCNSSDNEDKNSILVFNVITQDMMNNNKKNNKSYRGHRLPKKNVQYLEDWYMDHRKNP 178

Query: 171 YLDDKSISELMKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLLQELKT 220
           YL++ +I  LM  TSLS++Q+KNW+SNRRRKEKSITISPEVS LL++ KT
Sbjct: 179 YLNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALLRDNKT 228

>TPHA0E03610 Chr5 complement(765003..765636,765693..765754) [696 bp,
           231 aa] {ON} Anc_1.122 YCR039C MATalpha2 gene at MAT
           locus
          Length = 231

 Score =  242 bits (618), Expect = 7e-81,   Method: Compositional matrix adjust.
 Identities = 136/230 (59%), Positives = 173/230 (75%), Gaps = 12/230 (5%)

Query: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT 60
           MNKIPIN LLNPS   NL +KLQQIN  L++LC+K+P   + L + DH ELQ ILL+LTT
Sbjct: 1   MNKIPINKLLNPSQHYNLTEKLQQINITLSNLCTKLPDTITDLTEADHRELQDILLYLTT 60

Query: 61  VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANEN---------YESQTSKENSEEE 111
           VVK ++L  +EIMLV+TTYQL TTL++MVKS +  N+          YES TS +NSE  
Sbjct: 61  VVKQQELKKEEIMLVKTTYQLCTTLTLMVKSCKQENDKENKENEIIKYESGTS-DNSETN 119

Query: 112 LTSPSSSDSNDRNE-FVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENP 170
            +S +SSD+ D+N   VFN++TQDMMN  K N KSYRGHRLPK+NV+ LE WY+ + +NP
Sbjct: 120 -SSCNSSDNEDKNSILVFNVITQDMMNNNKKNNKSYRGHRLPKKNVQYLEDWYMDHRKNP 178

Query: 171 YLDDKSISELMKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLLQELKT 220
           YL++ +I  LM  TSLS++Q+KNW+SNRRRKEKSITISPEVS LL++ KT
Sbjct: 179 YLNEINIKLLMSKTSLSRIQVKNWISNRRRKEKSITISPEVSALLRDNKT 228

>KAFR0D00720 Chr4 (128684..129304) [621 bp, 206 aa] {ON}  mating
           type gene MATalpha2
          Length = 206

 Score =  172 bits (435), Expect = 2e-53,   Method: Compositional matrix adjust.
 Identities = 96/217 (44%), Positives = 137/217 (63%), Gaps = 13/217 (5%)

Query: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT 60
           MNKI I  LLN     + K +L+ INDKL +LCSK+P + + LE E HLEL+ I+L L+ 
Sbjct: 1   MNKIQIQDLLNSPRDVDTKQELRDINDKLFALCSKLPSSEALLEAEFHLELRDIMLNLSK 60

Query: 61  VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANENYESQTSKENSEEELTSPSSSDS 120
           +    ++ ++E  L  T +QL+ T+  ++K ++    N+        S  +  S   +  
Sbjct: 61  LQDTSRMGSEEKHLAYTAHQLTCTMITLIKGMK----NFHGTGGHSYSSSKSESDDKT-- 114

Query: 121 NDRNEFVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISEL 180
                 VFN+VTQDMMN  +  I SYRGHR  K+NVK+LERWY  +++ PYL+ +S   L
Sbjct: 115 ------VFNVVTQDMMNLNRTGI-SYRGHRFSKENVKVLERWYTAHIDRPYLNRQSTEYL 167

Query: 181 MKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLLQE 217
           +  T LS+VQIKNWVSNRRRKEKS+ +SPE+ +LLQ+
Sbjct: 168 ISKTGLSRVQIKNWVSNRRRKEKSVHVSPELIQLLQK 204

>ZYRO0F15818g Chr6 complement(1302816..1303493) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score =  171 bits (432), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 97/219 (44%), Positives = 138/219 (63%), Gaps = 2/219 (0%)

Query: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT 60
           MNKIPI  LLNP HQE   +KL+ IN+KL +LCSK+P      E+ D  EL++IL  L  
Sbjct: 1   MNKIPIERLLNPVHQEFPHEKLKNINNKLLALCSKLPSENEQFEK-DKAELEKILPSLNI 59

Query: 61  VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANENYESQTSKENSEEELTSPSSSDS 120
           +++      ++  +V   +QLS+  S+++  +    ++  SQ  +   +  L   ++  +
Sbjct: 60  LIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSEL-KSKRSQFLRSKPKYHLPYAAALGN 118

Query: 121 NDRNEFVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISEL 180
             +   VFNIVTQD +N  + + K+YRGHRLPK   +LLE W+ +N+E+PYL   S+ EL
Sbjct: 119 TGKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKEL 178

Query: 181 MKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLLQELK 219
           M  T LS  QIKNWVSNRRRKEKS+TIS EVS L++E K
Sbjct: 179 MVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELVKESK 217

>ZYRO0F18568g Chr6 complement(1532755..1533432) [678 bp, 225 aa]
           {ON} similar to uniprot|Q6B2C0 Saccharomyces cerevisiae
           YCR039C MATALPHA2 Homeobox-domain containing protein
           which in haploid cells acts with Mcm1p to repress
           a-specific genes in diploid cells Alpha2p acts together
           with A1p to repress transcription of haploid-specific
           genes
          Length = 225

 Score =  171 bits (432), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 97/219 (44%), Positives = 138/219 (63%), Gaps = 2/219 (0%)

Query: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT 60
           MNKIPI  LLNP HQE   +KL+ IN+KL +LCSK+P      E+ D  EL++IL  L  
Sbjct: 1   MNKIPIERLLNPVHQEFPHEKLKNINNKLLALCSKLPSENEQFEK-DKAELEKILPSLNI 59

Query: 61  VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANENYESQTSKENSEEELTSPSSSDS 120
           +++      ++  +V   +QLS+  S+++  +    ++  SQ  +   +  L   ++  +
Sbjct: 60  LIRECGSSKEDQKMVHRIHQLSSVFSLLLNEVSEL-KSKRSQFLRSKPKYHLPYAAALGN 118

Query: 121 NDRNEFVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISEL 180
             +   VFNIVTQD +N  + + K+YRGHRLPK   +LLE W+ +N+E+PYL   S+ EL
Sbjct: 119 TGKEGMVFNIVTQDTLNSARRSNKTYRGHRLPKHITRLLESWFNRNIEHPYLQTSSMKEL 178

Query: 181 MKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLLQELK 219
           M  T LS  QIKNWVSNRRRKEKS+TIS EVS L++E K
Sbjct: 179 MVETKLSGPQIKNWVSNRRRKEKSLTISFEVSELVKESK 217

>Suva_3.147 Chr3 complement(221912..222544) [633 bp, 210 aa] {ON}
           (REAL)
          Length = 210

 Score =  159 bits (403), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 101/216 (46%), Positives = 144/216 (66%), Gaps = 17/216 (7%)

Query: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT 60
           MNKIPI  LLNP   +  K  +  IN KL S+C  +P     +  E+ +EL+ IL FL+ 
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLR-MANENYESQTSKENSEEELTSPSSSD 119
             KN K+ ++E  L++TT QL+TT+++++K +R + N+    Q +++N         S+D
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNK--------SAD 112

Query: 120 SNDRNEFVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISE 179
                  VFN+VTQDM+NK   + K YRGHR  K+NV++LE W+ +N+ENPYLD K +  
Sbjct: 113 G-----LVFNVVTQDMINK---STKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLEN 164

Query: 180 LMKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLL 215
           LMK TSLS++QIKNWVSNRRRKEK+ITI+PE++ LL
Sbjct: 165 LMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 200

>YCR039C Chr3 complement(199546..200178) [633 bp, 210 aa] {ON}
           MATALPHA2Homeobox-domain protein that, with Mcm1p,
           represses a-specific genes in haploids; acts with A1p to
           repress transcription of haploid-specific genes in
           diploids; one of two genes encoded by the MATalpha
           mating type cassette
          Length = 210

 Score =  159 bits (403), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 101/216 (46%), Positives = 144/216 (66%), Gaps = 17/216 (7%)

Query: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT 60
           MNKIPI  LLNP   +  K  +  IN KL S+C  +P     +  E+ +EL+ IL FL+ 
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLR-MANENYESQTSKENSEEELTSPSSSD 119
             KN K+ ++E  L++TT QL+TT+++++K +R + N+    Q +++N         S+D
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNK--------SAD 112

Query: 120 SNDRNEFVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISE 179
                  VFN+VTQDM+NK   + K YRGHR  K+NV++LE W+ +N+ENPYLD K +  
Sbjct: 113 G-----LVFNVVTQDMINK---STKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLEN 164

Query: 180 LMKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLL 215
           LMK TSLS++QIKNWVSNRRRKEK+ITI+PE++ LL
Sbjct: 165 LMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 200

>YCL067C Chr3 complement(12386..13018) [633 bp, 210 aa] {ON}
           HMLALPHA2Silenced copy of ALPHA2 at HML; homeobox-domain
           protein that associates with Mcm1p in haploid cells to
           repress a-specific gene expression and interacts with
           a1p in diploid cells to repress haploid-specific gene
           expression
          Length = 210

 Score =  159 bits (403), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 101/216 (46%), Positives = 144/216 (66%), Gaps = 17/216 (7%)

Query: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT 60
           MNKIPI  LLNP   +  K  +  IN KL S+C  +P     +  E+ +EL+ IL FL+ 
Sbjct: 1   MNKIPIKDLLNPQITDEFKSSILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLR-MANENYESQTSKENSEEELTSPSSSD 119
             KN K+ ++E  L++TT QL+TT+++++K +R + N+    Q +++N         S+D
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNK--------SAD 112

Query: 120 SNDRNEFVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISE 179
                  VFN+VTQDM+NK   + K YRGHR  K+NV++LE W+ +N+ENPYLD K +  
Sbjct: 113 G-----LVFNVVTQDMINK---STKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLEN 164

Query: 180 LMKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLL 215
           LMK TSLS++QIKNWVSNRRRKEK+ITI+PE++ LL
Sbjct: 165 LMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 200

>Skud_3.118 Chr3 complement(184042..184674) [633 bp, 210 aa] {ON}
           YCR039C (REAL)
          Length = 210

 Score =  159 bits (403), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 101/216 (46%), Positives = 144/216 (66%), Gaps = 17/216 (7%)

Query: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT 60
           MNKIPI  LLNP   +  K  +  IN KL S+C  +P     +  E+ +EL+ IL FL+ 
Sbjct: 1   MNKIPIKDLLNPQITDEFKSNILDINKKLFSICCNLPKLPESVTTEEEVELRDILGFLSR 60

Query: 61  VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLR-MANENYESQTSKENSEEELTSPSSSD 119
             KN K+ ++E  L++TT QL+TT+++++K +R + N+    Q +++N         S+D
Sbjct: 61  ANKNRKISDEEKKLLQTTSQLTTTITVLLKEMRSIENDRSNYQLTQKNK--------SAD 112

Query: 120 SNDRNEFVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISE 179
                  VFN+VTQDM+NK   + K YRGHR  K+NV++LE W+ +N+ENPYLD K +  
Sbjct: 113 G-----LVFNVVTQDMINK---STKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLEN 164

Query: 180 LMKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLL 215
           LMK TSLS++QIKNWVSNRRRKEK+ITI+PE++ LL
Sbjct: 165 LMKNTSLSRIQIKNWVSNRRRKEKTITIAPELADLL 200

>KNAG0C00160 Chr3 (25548..26159) [612 bp, 203 aa] {ON} Anc_1.2
           YCL067C silent copy of mating type alpha2 gene at HML
           locus
          Length = 203

 Score =  150 bits (380), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 91/217 (41%), Positives = 126/217 (58%), Gaps = 14/217 (6%)

Query: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT 60
           MN+I I  LLN     +L    + IN +L  +CS  P        E  ++LQ ILLFLT 
Sbjct: 1   MNRIEIQDLLNNQDCSSLDKDFKNINSQLLEICSNFPKELLSNHGELQMQLQGILLFLTK 60

Query: 61  VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANENYESQTSKENSEEELTSPSSSDS 120
           +V    L        R TYQ S  ++ ++KS     E++  +       +E   P++S+ 
Sbjct: 61  LVGKNDLSVTLKNEARMTYQFSKIIASLLKSF----EDFFFE------RKEYNDPATSE- 109

Query: 121 NDRNEFVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISEL 180
              NEFVF++VTQDMMNK+K +++  RGHR    + + LE WY ++ E PYLD +S+ EL
Sbjct: 110 ---NEFVFSVVTQDMMNKRKESMRPCRGHRFSSNSTETLEDWYKKHHEKPYLDKRSLHEL 166

Query: 181 MKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLLQE 217
              T LSK+QI+NWVSNRRRKEKSI +SP +  LLQE
Sbjct: 167 EFKTKLSKMQIRNWVSNRRRKEKSIHVSPVIQDLLQE 203

>NDAI0A00110 Chr1 (1584..2219) [636 bp, 211 aa] {ON} Anc_1.2  silent
           copy of MATalpha2 gene at HMLalpha
          Length = 211

 Score =  150 bits (379), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 87/215 (40%), Positives = 135/215 (62%), Gaps = 10/215 (4%)

Query: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT 60
           MNKI I+ LLNP     +   L  IN++L ++CSK P     ++    ++L  I+ FL+T
Sbjct: 1   MNKIAISDLLNPPTAGPVTSNLDSINNQLVTICSKFPTAKENVDGSYQIQLHNIVSFLST 60

Query: 61  VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANENYESQTSKENSEEELTSPSSSDS 120
           + ++  L + +   ++ TY+LS+ L  ++K + + N   E +  K   EEEL + S    
Sbjct: 61  LTQSTNLTSKDCSNIQLTYELSSMLGKVLKDMVLLNGTEEVEKKKVKEEEELETNS---- 116

Query: 121 NDRNEFVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISEL 180
               ++VFN++TQDMM  +K   K +RGHRLPK+ V  LE WY+ +++ PYLD K++  L
Sbjct: 117 ----KYVFNVITQDMMIPEKN--KPHRGHRLPKEKVNRLEHWYLAHIQKPYLDSKNLKVL 170

Query: 181 MKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLL 215
           M+ T LSKVQIKNW+SNRRRKEK ++ISP++  ++
Sbjct: 171 MEETKLSKVQIKNWISNRRRKEKLLSISPDIVEII 205

>NCAS0B09140 Chr2 complement(1754708..1755325) [618 bp, 205 aa] {ON}
           Anc_1.2
          Length = 205

 Score =  143 bits (360), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 91/224 (40%), Positives = 143/224 (63%), Gaps = 24/224 (10%)

Query: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLE-LQRILLFLT 59
           MNKI I+ LLNP +     ++L+ IN +L ++CS  P  T  L+ + + E L+ I + L+
Sbjct: 1   MNKIAIHDLLNPPNTTKTHEQLESINTQLNTICSVFPT-TENLDFKTYQEQLRNIAVTLS 59

Query: 60  TVVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANENYESQTSKENSEEELTSPSSSD 119
           ++    +L ++   ++R TYQ+S+ L      L++  EN        +++++  +P+S  
Sbjct: 60  SLTNQNELSSENKNVLRVTYQISSVL------LKLLGEN-------AHNKDQPKTPTSGS 106

Query: 120 SNDRN-EFVFNIVTQDMMNKKKMNIKS---YRGHRLPKQNVKLLERWYIQNVENPYLDDK 175
            ++RN + VFNI+T     KK+M+  S    RGHRL K+ V LLE WYIQ+++NPYL+  
Sbjct: 107 ESERNPKLVFNILT-----KKRMSPTSNEPRRGHRLAKEKVDLLEHWYIQHMDNPYLNKA 161

Query: 176 SISELMKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLLQELK 219
           S+  LM+ TSLSK+QIKNWVSNRRRKEKS++I+PE+  +L + K
Sbjct: 162 SLQMLMQETSLSKMQIKNWVSNRRRKEKSLSIAPEIVDILNKQK 205

>Skud_102.1 Chr102 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score =  140 bits (353), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 89/191 (46%), Positives = 130/191 (68%), Gaps = 17/191 (8%)

Query: 26  NDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTTVVKNEKLDNDEIMLVRTTYQLSTTL 85
           N KL S+C  +P     +  E+ +EL+ IL FL+   KN K+ ++E  L++TT QL+TT+
Sbjct: 1   NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTI 60

Query: 86  SIMVKSLR-MANENYESQTSKENSEEELTSPSSSDSNDRNEFVFNIVTQDMMNKKKMNIK 144
           ++++K +R + N+    Q +++N         S+D       VFN+VTQDM+NK   + K
Sbjct: 61  TVLLKEMRSIENDRSNYQLTQKNK--------SADG-----LVFNVVTQDMINK---STK 104

Query: 145 SYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKEKS 204
            YRGHR  K+NV++LE W+ +N+ENPYLD K +  LMK TSLS++QIKNWVSNRRRKEK+
Sbjct: 105 PYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKT 164

Query: 205 ITISPEVSRLL 215
           ITI+PE++ LL
Sbjct: 165 ITIAPELADLL 175

>Smik_95.1 Chr95 (1..558) [558 bp, 185 aa] {ON} YCR039C (REAL)
          Length = 185

 Score =  140 bits (353), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 89/191 (46%), Positives = 130/191 (68%), Gaps = 17/191 (8%)

Query: 26  NDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTTVVKNEKLDNDEIMLVRTTYQLSTTL 85
           N KL S+C  +P     +  E+ +EL+ IL FL+   KN K+ ++E  L++TT QL+TT+
Sbjct: 1   NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTI 60

Query: 86  SIMVKSLR-MANENYESQTSKENSEEELTSPSSSDSNDRNEFVFNIVTQDMMNKKKMNIK 144
           ++++K +R + N+    Q +++N         S+D       VFN+VTQDM+NK   + K
Sbjct: 61  TVLLKEMRSIENDRSNYQLTQKNK--------SADG-----LVFNVVTQDMINK---STK 104

Query: 145 SYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKEKS 204
            YRGHR  K+NV++LE W+ +N+ENPYLD K +  LMK TSLS++QIKNWVSNRRRKEK+
Sbjct: 105 PYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKT 164

Query: 205 ITISPEVSRLL 215
           ITI+PE++ LL
Sbjct: 165 ITIAPELADLL 175

>TBLA0A07050 Chr1
           (1728941..1729002,1729096..1729189,1729249..1729878)
           [786 bp, 261 aa] {ON}  MATalpha2 gene at MAT locus
          Length = 261

 Score =  141 bits (356), Expect = 6e-41,   Method: Compositional matrix adjust.
 Identities = 91/244 (37%), Positives = 135/244 (55%), Gaps = 32/244 (13%)

Query: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT 60
           MNKIPI+ LLNP++ EN+K++LQ +N +L S+CS++P   S  E +    L  IL FLT 
Sbjct: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKSMEETQ----LSEILKFLTK 56

Query: 61  VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANENYESQTSK--------------- 105
            +K+E L  +E  LV TT QLST LS +VK  R  +  + SQ++                
Sbjct: 57  TIKHEPLGKEETELVTTTVQLSTVLSSLVKEARQLHRLHHSQSTHNPRVFNVLTQHMMSN 116

Query: 106 -------ENSEEELTSPSSSDS-----NDRNEFVFNIVTQDMMNKKKMNIKSYRGHRLPK 153
                   +S     SPS+  S     N    + ++  +   ++    +  S+RGHRLPK
Sbjct: 117 SNSTSTSPHSNSLPNSPSTKKSTTPLTNPSPPYYYSSSSPKSLSPPLQHTPSHRGHRLPK 176

Query: 154 QNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKEK-SITISPEVS 212
             +  LE+W++ N  +PYL +  +  L   +SLSK Q+KNW+SNRRRKE+ S+ IS  ++
Sbjct: 177 HTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKERHSLKISNNIA 236

Query: 213 RLLQ 216
            LLQ
Sbjct: 237 SLLQ 240

>CAGL0B01265g Chr2 (113719..114279) [561 bp, 186 aa] {ON} similar to
           uniprot|P01367 Saccharomyces cerevisiae YCR039c or
           uniprot|P01367 Saccharomyces cerevisiae YCL067c HMLALP2
           mating type regulatory protein
          Length = 186

 Score =  139 bits (349), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 91/212 (42%), Positives = 120/212 (56%), Gaps = 49/212 (23%)

Query: 3   KIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTS--GLEQEDHLELQRILLFLTT 60
           +I I  LLNP  +ENLK+KLQ+IN++L SLCS +P   S  G   +       IL FL+ 
Sbjct: 6   RISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPSSD-------ILRFLS- 57

Query: 61  VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANENYESQTSKENSEEELTSPSSSDS 120
                 LD  EI L++TTY+LST LS     LR                           
Sbjct: 58  ---RNNLDPQEIGLIKTTYRLSTLLS----KLR--------------------------- 83

Query: 121 NDRNEFVFNIVTQDMMNKKKM---NIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSI 177
              +E VFN+VT+D + KK +      SYRGHR  ++NV++LE WY  +++NPYLD  S 
Sbjct: 84  --EHEIVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNSQ 141

Query: 178 SELMKITSLSKVQIKNWVSNRRRKEKSITISP 209
             L + T+LSK+QIKNWV+NRRRK+KSI ISP
Sbjct: 142 QYLAQKTNLSKIQIKNWVANRRRKQKSIYISP 173

>Smik_3.142 Chr3 complement(197575..198261) [687 bp, 228 aa] {ON}
           YCL067C (REAL)
          Length = 228

 Score =  139 bits (351), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 89/191 (46%), Positives = 130/191 (68%), Gaps = 17/191 (8%)

Query: 26  NDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTTVVKNEKLDNDEIMLVRTTYQLSTTL 85
           N KL S+C  +P     +  E+ +EL+ IL FL+   KN K+ ++E  L++TT QL+TT+
Sbjct: 44  NKKLFSICCNLPKLPESVTTEEEVELRDILGFLSRANKNRKISDEEKKLLQTTSQLTTTI 103

Query: 86  SIMVKSLR-MANENYESQTSKENSEEELTSPSSSDSNDRNEFVFNIVTQDMMNKKKMNIK 144
           ++++K +R + N+    Q +++N         S+D       VFN+VTQDM+NK   + K
Sbjct: 104 TVLLKEMRSIENDRSNYQLTQKNK--------SADG-----LVFNVVTQDMINK---STK 147

Query: 145 SYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKEKS 204
            YRGHR  K+NV++LE W+ +N+ENPYLD K +  LMK TSLS++QIKNWVSNRRRKEK+
Sbjct: 148 PYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTSLSRIQIKNWVSNRRRKEKT 207

Query: 205 ITISPEVSRLL 215
           ITI+PE++ LL
Sbjct: 208 ITIAPELADLL 218

>TBLA0A07600 Chr1
           (1882710..1882771,1882865..1882958,1883018..1883554)
           [693 bp, 230 aa] {ON} Anc_1.2 YCL067C silenced copy of
           alpha2 gene at HML locus
          Length = 230

 Score =  137 bits (344), Expect = 2e-39,   Method: Compositional matrix adjust.
 Identities = 85/230 (36%), Positives = 126/230 (54%), Gaps = 31/230 (13%)

Query: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT 60
           MNKIPI+ LLNP++ EN+K++LQ +N +L S+CS++P   S  E +    L  IL FLT 
Sbjct: 1   MNKIPIDTLLNPTNSENIKEQLQNLNKELLSMCSRLPSAKSMEETQ----LSEILKFLTK 56

Query: 61  VVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANENYESQTSK--------------- 105
            +K+E L  +E  LV TT QLST LS +VK  R  +  + SQ++                
Sbjct: 57  TIKHEPLGKEETELVTTTVQLSTVLSSLVKEARQLHRLHHSQSTHNPRVFNVLTQHMMSN 116

Query: 106 -------ENSEEELTSPSSSDS-----NDRNEFVFNIVTQDMMNKKKMNIKSYRGHRLPK 153
                   +S     SPS+  S     N    + ++  +   ++    +  S+RGHRLPK
Sbjct: 117 SNSTSTSPHSNSLPNSPSTKKSTTPLTNPSPPYYYSSSSPKSLSPPLQHTPSHRGHRLPK 176

Query: 154 QNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKEK 203
             +  LE+W++ N  +PYL +  +  L   +SLSK Q+KNW+SNRRRKE+
Sbjct: 177 HTLIPLEKWFLHNKSHPYLHNSDLQALTTQSSLSKTQVKNWISNRRRKER 226

>CAGL0B00264g Chr2 (11470..12102) [633 bp, 210 aa] {ON} highly
           similar to uniprot|P01367 Saccharomyces cerevisiae
           YCR039c or uniprot|P01367 Saccharomyces cerevisiae
           YCL067c HMLALP 2 mating type regulatory protein
          Length = 210

 Score =  135 bits (340), Expect = 4e-39,   Method: Compositional matrix adjust.
 Identities = 90/212 (42%), Positives = 120/212 (56%), Gaps = 49/212 (23%)

Query: 2   NKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTS--GLEQEDHLELQRILLFLT 59
           ++I I  LLNP  +ENLK+KLQ+IN++L SLCS +P   S  G   +       IL FL+
Sbjct: 5   SRISITHLLNPIQEENLKEKLQEINNQLISLCSSLPKRQSLPGPSSD-------ILRFLS 57

Query: 60  TVVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANENYESQTSKENSEEELTSPSSSD 119
                  LD  EI L++TTY+LST LS     LR                          
Sbjct: 58  ----RNNLDPQEIGLIKTTYRLSTLLS----KLR-------------------------- 83

Query: 120 SNDRNEFVFNIVTQDMMNKKKM---NIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKS 176
               +E VFN+VT+D + KK +      SYRGHR  ++NV++LE WY  +++NPYLD  S
Sbjct: 84  ---EHEIVFNVVTKDHLLKKGVPNHYAASYRGHRFTRENVQILETWYRNHIDNPYLDHNS 140

Query: 177 ISELMKITSLSKVQIKNWVSNRRRKEKSITIS 208
              L + T+LSK+QIKNWV+NRRRK+KSI IS
Sbjct: 141 QQYLAQKTNLSKIQIKNWVANRRRKQKSIYIS 172

>Suva_3.135 Chr3 complement(211196..211555) [360 bp, 119 aa] {ON}
           YCR096C (REAL)
          Length = 119

 Score =  127 bits (318), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 74/90 (82%), Gaps = 3/90 (3%)

Query: 126 FVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISELMKITS 185
            VFN+VTQDM+NK   + K YRGHR  K+NV++LE W+ +N+ENPYLD K +  LMK TS
Sbjct: 23  LVFNVVTQDMINK---STKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTS 79

Query: 186 LSKVQIKNWVSNRRRKEKSITISPEVSRLL 215
           LS++QIKNWVSNRRRKEK+ITI+PE++ LL
Sbjct: 80  LSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>Suva_3.74 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCR039C (REAL)
          Length = 119

 Score =  127 bits (318), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 74/90 (82%), Gaps = 3/90 (3%)

Query: 126 FVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISELMKITS 185
            VFN+VTQDM+NK   + K YRGHR  K+NV++LE W+ +N+ENPYLD K +  LMK TS
Sbjct: 23  LVFNVVTQDMINK---STKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTS 79

Query: 186 LSKVQIKNWVSNRRRKEKSITISPEVSRLL 215
           LS++QIKNWVSNRRRKEK+ITI+PE++ LL
Sbjct: 80  LSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>Suva_3.75 Chr3 complement(112965..113324) [360 bp, 119 aa] {ON}
           YCL067C (REAL)
          Length = 119

 Score =  127 bits (318), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 74/90 (82%), Gaps = 3/90 (3%)

Query: 126 FVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISELMKITS 185
            VFN+VTQDM+NK   + K YRGHR  K+NV++LE W+ +N+ENPYLD K +  LMK TS
Sbjct: 23  LVFNVVTQDMINK---STKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTS 79

Query: 186 LSKVQIKNWVSNRRRKEKSITISPEVSRLL 215
           LS++QIKNWVSNRRRKEK+ITI+PE++ LL
Sbjct: 80  LSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>YCR096C Chr3 complement(293179..293538) [360 bp, 119 aa] {OFF}
           HMRA2Silenced copy of a2 at HMR; similarity to Alpha2p;
           required along with a1p for inhibiting expression of the
           HO endonuclease in a/alpha HO/HO diploid cells with an
           active mating-type interconversion system
          Length = 119

 Score =  127 bits (318), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 58/90 (64%), Positives = 74/90 (82%), Gaps = 3/90 (3%)

Query: 126 FVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISELMKITS 185
            VFN+VTQDM+NK   + K YRGHR  K+NV++LE W+ +N+ENPYLD K +  LMK TS
Sbjct: 23  LVFNVVTQDMINK---STKPYRGHRFTKENVRILESWFAKNIENPYLDTKGLENLMKNTS 79

Query: 186 LSKVQIKNWVSNRRRKEKSITISPEVSRLL 215
           LS++QIKNWVSNRRRKEK+ITI+PE++ LL
Sbjct: 80  LSRIQIKNWVSNRRRKEKTITIAPELADLL 109

>Ecym_1115 Chr1 (237261..237485,237542..238009) [693 bp, 230 aa]
           {ON} similar to YCL067C HMLALPHA2, 1-intron
          Length = 230

 Score =  120 bits (300), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 88/234 (37%), Positives = 128/234 (54%), Gaps = 25/234 (10%)

Query: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT 60
           MN+IPI  LLNPS  ++       I   LTS  S         E +  L+++  L+ L +
Sbjct: 1   MNRIPIISLLNPSPGDS-----HNIRQTLTS-SSTFSLKKDTYEADILLKMRNELMKLHS 54

Query: 61  VVKNEKLDNDEI-MLVRTTYQLSTTLS---IMVKSLRMANENYESQTS--------KE-- 106
            +    ++N E+  ++    Q    LS   +  K  R+  +N    T+        KE  
Sbjct: 55  SICCTNIENGEVNFILNKVLQGLKILSSDQVFSKPDRVVIQNISQLTAIIVRLVNKKEDI 114

Query: 107 -NSEEELTSP---SSSDSNDRNEFVFNIVTQDMM-NKKKMNIKSYRGHRLPKQNVKLLER 161
            N ++ L  P     + S ++   +FN+VTQDMM N +K    SY+GHRLPK++V+LLE 
Sbjct: 115 INLQKGLVDPKEIPEAISKEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLES 174

Query: 162 WYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLL 215
           WY  N+ENPYL+D  I  LM+ T  S+ Q+KNWV+N+RRK+K  TISPE+S LL
Sbjct: 175 WYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLL 228

>Ecym_1002 Chr1 complement(5334..5801,5858..6082) [693 bp, 230 aa]
           {ON} similar to Saccharomyces cerevisiae YCL067C
           HMLALPHA2; 1-intron
          Length = 230

 Score =  120 bits (300), Expect = 7e-33,   Method: Compositional matrix adjust.
 Identities = 88/234 (37%), Positives = 128/234 (54%), Gaps = 25/234 (10%)

Query: 1   MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGNTSGLEQEDHLELQRILLFLTT 60
           MN+IPI  LLNPS  ++       I   LTS  S         E +  L+++  L+ L +
Sbjct: 1   MNRIPIISLLNPSPGDS-----HNIRQTLTS-SSTFSLKKDTYEADILLKMRNELMKLHS 54

Query: 61  VVKNEKLDNDEI-MLVRTTYQLSTTLS---IMVKSLRMANENYESQTS--------KE-- 106
            +    ++N E+  ++    Q    LS   +  K  R+  +N    T+        KE  
Sbjct: 55  SICCTNIENGEVNFILNKVLQGLKILSSDQVFSKPDRVVIQNISQLTAIIVRLVNKKEDI 114

Query: 107 -NSEEELTSP---SSSDSNDRNEFVFNIVTQDMM-NKKKMNIKSYRGHRLPKQNVKLLER 161
            N ++ L  P     + S ++   +FN+VTQDMM N +K    SY+GHRLPK++V+LLE 
Sbjct: 115 INLQKGLVDPKEIPEAISKEKCGIIFNVVTQDMMENGRKGGSSSYKGHRLPKKHVQLLES 174

Query: 162 WYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLL 215
           WY  N+ENPYL+D  I  LM+ T  S+ Q+KNWV+N+RRK+K  TISPE+S LL
Sbjct: 175 WYKNNIENPYLNDTDIRILMRETGFSRSQVKNWVANKRRKDKHSTISPELSDLL 228

>TDEL0C07000 Chr3 complement(1273613..1274326) [714 bp, 237 aa] {ON}
           Anc_1.122 YCR039C silenced copy of alpha2 gene at T.
           delbrueckii HML locus
          Length = 237

 Score =  112 bits (280), Expect = 8e-30,   Method: Compositional matrix adjust.
 Identities = 84/238 (35%), Positives = 128/238 (53%), Gaps = 41/238 (17%)

Query: 3   KIPINILLNPSHQENLKDKLQQINDKLTSLCSKIPGN----------------TSGL--- 43
           KIPIN+LLNP   ++     ++     +  CSK+ G                 ++G+   
Sbjct: 4   KIPINLLLNPQQHDD-----KKEKKDKSESCSKLRGTRVTQHKREADELFFKLSNGIGKP 58

Query: 44  EQEDHLELQRILLFLTTVVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANE-NYESQ 102
           E E   EL+++L  L  V  N KL+ +  +L+RTT+QLS TLS+++   +   E N +  
Sbjct: 59  EFELRCELKKVLSSLKVVTTNGKLEENGELLLRTTFQLSKTLSVVLSEFKKVEESNIQFH 118

Query: 103 TSKE-NSEEELTSPSSSDSNDRNEFVFNIVT----QDMMNKKKMNIKSYRGHRLPKQNVK 157
            S++ +SE + T+      N      F IV     QD    K+     +RGHRLP + V+
Sbjct: 119 KSRDWDSERKETNLRCKVPN------FEIVPLNTKQDYSTGKR-----HRGHRLPSEKVE 167

Query: 158 LLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKEKSITISPEVSRLL 215
            LE W+ QN+  PYL+ +++  L+  TSLS +QIKNW+SNRRRK+KS  I+  +S LL
Sbjct: 168 KLELWFNQNISKPYLNQRALRTLVHETSLSPIQIKNWLSNRRRKKKSAGIADTISDLL 225

>KLLA0C00374g Chr3 (25132..25803) [672 bp, 223 aa] {ON}
           uniprot|Q9HDS5 Kluyveromyces lactis HMLALPHA2 Mating-
           type protein ALPHA2
          Length = 223

 Score = 77.4 bits (189), Expect = 9e-17,   Method: Compositional matrix adjust.
 Identities = 37/86 (43%), Positives = 57/86 (66%), Gaps = 2/86 (2%)

Query: 130 IVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKV 189
           I+TQD+M+      K  +G R PK +++LLE WY  N  NPYL +  ++ + K T+L+K 
Sbjct: 139 ILTQDLMHSNNNEFK--KGKRFPKSHIQLLENWYSMNRRNPYLAENDLAYISKNTTLTKT 196

Query: 190 QIKNWVSNRRRKEKSITISPEVSRLL 215
           QIKNW++NRRRK+K   +S ++  +L
Sbjct: 197 QIKNWLANRRRKDKITEVSSDIRNIL 222

>TBLA0C03740 Chr3 complement(892360..893241) [882 bp, 293 aa] {ON}
           Anc_6.170 YPL177C
          Length = 293

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/67 (37%), Positives = 41/67 (61%)

Query: 136 MNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWV 195
           + K K+N    +   LPK+ V++L  W + ++ NPY   K  SEL+ +T L+K+Q+ NW 
Sbjct: 167 LKKSKLNYMVSKRSNLPKETVQILNDWLLNHLRNPYPTPKEKSELLVLTGLTKIQLSNWF 226

Query: 196 SNRRRKE 202
            N RR++
Sbjct: 227 INVRRRK 233

>TPHA0B02580 Chr2 (592073..592867) [795 bp, 264 aa] {ON} Anc_6.170
           YPL177C
          Length = 264

 Score = 53.9 bits (128), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 25/57 (43%), Positives = 38/57 (66%), Gaps = 2/57 (3%)

Query: 148 GHR--LPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKE 202
           G R  LPKQ+V +L +W + ++ NPY   K   EL+++T LSK+Q+ NW  N RR++
Sbjct: 155 GKRSNLPKQSVDVLNKWLLNHLGNPYPTPKEKEELLELTGLSKIQLSNWFINVRRRK 211

>KLTH0F00396g Chr6 (31990..32051,32348..32612) [327 bp, 108 aa] {ON}
           conserved hypothetical protein
          Length = 108

 Score = 50.1 bits (118), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 25/51 (49%), Positives = 34/51 (66%)

Query: 157 KLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKEKSITI 207
           K LERW+  N++ PY +   I  L K T+LS  QI+NW+SNRRRK +  +I
Sbjct: 48  KRLERWFCSNIQYPYPNKIQILSLSKNTNLSIKQIQNWMSNRRRKSRKESI 98

>Kwal_YGOB_matalpha2 s33 (284511..284843) [333 bp, 110 aa] {ON}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 3/81 (3%)

Query: 126 FVFNIVTQDMMNKKKMNIKSYRGHRLPK--QNVKL-LERWYIQNVENPYLDDKSISELMK 182
           F+ + + + +++ K +N  +    ++ K   N+ + LE W+  N  +PYL  K IS L +
Sbjct: 11  FLADAIGKKILSFKFLNSAARGNQKVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSE 70

Query: 183 ITSLSKVQIKNWVSNRRRKEK 203
            T+LS  QI+NW+SNRRRK K
Sbjct: 71  RTNLSSKQIRNWMSNRRRKSK 91

>Kwal_33.12995 s33 (32369..32701) [333 bp, 110 aa] {OFF} YCR096C
           (HMRA2) - Regulatory protein MATa2p (no known function);
           sequence is the same as the last 119 residues of
           MATalpha2p [contig 123] FULL
          Length = 110

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 3/81 (3%)

Query: 126 FVFNIVTQDMMNKKKMNIKSYRGHRLPK--QNVKL-LERWYIQNVENPYLDDKSISELMK 182
           F+ + + + +++ K +N  +    ++ K   N+ + LE W+  N  +PYL  K IS L +
Sbjct: 11  FLADAIGKKILSFKFLNSAARGNQKVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSE 70

Query: 183 ITSLSKVQIKNWVSNRRRKEK 203
            T+LS  QI+NW+SNRRRK K
Sbjct: 71  RTNLSSKQIRNWMSNRRRKSK 91

>Kwal_YGOB_HMalpha2 s33 (32369..32701) [333 bp, 110 aa] {ON}
           ANNOTATED BY YGOB - This is Kwal_33.12995
          Length = 110

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 3/81 (3%)

Query: 126 FVFNIVTQDMMNKKKMNIKSYRGHRLPK--QNVKL-LERWYIQNVENPYLDDKSISELMK 182
           F+ + + + +++ K +N  +    ++ K   N+ + LE W+  N  +PYL  K IS L +
Sbjct: 11  FLADAIGKKILSFKFLNSAARGNQKVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSE 70

Query: 183 ITSLSKVQIKNWVSNRRRKEK 203
            T+LS  QI+NW+SNRRRK K
Sbjct: 71  RTNLSSKQIRNWMSNRRRKSK 91

>Kwal_33.matalpha2 s33 (284511..284843) [333 bp, 110 aa] {OFF}
           (matalpha2) - mating type alpha2 protein [contig MAT]
           FULL
          Length = 110

 Score = 50.1 bits (118), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 30/81 (37%), Positives = 49/81 (60%), Gaps = 3/81 (3%)

Query: 126 FVFNIVTQDMMNKKKMNIKSYRGHRLPK--QNVKL-LERWYIQNVENPYLDDKSISELMK 182
           F+ + + + +++ K +N  +    ++ K   N+ + LE W+  N  +PYL  K IS L +
Sbjct: 11  FLADAIGKKILSFKFLNSAARGNQKVSKYPHNISMHLENWFHLNSSHPYLTRKQISLLSE 70

Query: 183 ITSLSKVQIKNWVSNRRRKEK 203
            T+LS  QI+NW+SNRRRK K
Sbjct: 71  RTNLSSKQIRNWMSNRRRKSK 91

>Kpol_1036.56 s1036 (153997..154794) [798 bp, 265 aa] {ON}
           (153997..154794) [798 nt, 266 aa]
          Length = 265

 Score = 51.2 bits (121), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 25/72 (34%), Positives = 44/72 (61%)

Query: 131 VTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQ 190
           V++  M K    I + +   LPK +V++L +W + +++NPY   +   EL+K T L+K+Q
Sbjct: 143 VSKKSMKKCHGIIGAGKRSNLPKNSVQILNQWLLNHLQNPYPTPQEKKELLKQTGLTKIQ 202

Query: 191 IKNWVSNRRRKE 202
           + NW  N RR++
Sbjct: 203 LSNWFINVRRRK 214

>Suva_16.132 Chr16 complement(222346..223224) [879 bp, 292 aa] {ON}
           YPL177C (REAL)
          Length = 292

 Score = 50.4 bits (119), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 27/70 (38%), Positives = 42/70 (60%), Gaps = 2/70 (2%)

Query: 133 QDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIK 192
           +D  +KKK N  S R   LPK+ V++L  W + ++ NPY   +   EL+  T L+K+Q+ 
Sbjct: 139 EDSKSKKKQN--SGRRSNLPKETVQVLNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLS 196

Query: 193 NWVSNRRRKE 202
           NW  N RR++
Sbjct: 197 NWFINVRRRK 206

>Skud_16.103 Chr16 complement(185398..186285) [888 bp, 295 aa] {ON}
           YPL177C (REAL)
          Length = 295

 Score = 49.7 bits (117), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 42/70 (60%), Gaps = 2/70 (2%)

Query: 133 QDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIK 192
           +D  +K+K N  S R   LPK+ V++L  W + ++ NPY   +   EL+  T L+K+Q+ 
Sbjct: 142 EDSKSKRKQN--SGRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLS 199

Query: 193 NWVSNRRRKE 202
           NW  N RR++
Sbjct: 200 NWFINVRRRK 209

>Smik_7.181 Chr7 (319819..320643) [825 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 49.3 bits (116), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 33/52 (63%)

Query: 151 LPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKE 202
           LPK  V +L +W ++++ NPY   +   EL+  T L+K+QI NW  N RR++
Sbjct: 199 LPKATVSILNKWLLEHINNPYPTVQEKRELLAKTGLTKLQISNWFINARRRK 250

>ZYRO0G22044g Chr7 (1814345..1814950) [606 bp, 201 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 201

 Score = 48.5 bits (114), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 36/58 (62%)

Query: 144 KSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRK 201
           +S R   LPK+ V++L RW + ++ NPY   +   +L+  T L+K+Q+ NW  N RR+
Sbjct: 77  RSGRRSNLPKETVQILNRWLLDHLGNPYPTPQEKRDLLIKTGLTKIQLSNWFINVRRR 134

>KNAG0M00500 Chr13 complement(79067..79963) [897 bp, 298 aa] {ON}
           Anc_6.170 YPL177C
          Length = 298

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%)

Query: 151 LPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKE 202
           LPK  V +L RW + ++ NPY   +   EL+  T LSK+Q+ NW  N RR++
Sbjct: 183 LPKDTVLILNRWLLDHLHNPYPTSQEKRELLIKTGLSKIQLSNWFINVRRRK 234

>KAFR0A04370 Chr1 complement(870590..871819) [1230 bp, 409 aa] {ON}
           Anc_6.170 YPL177C
          Length = 409

 Score = 48.9 bits (115), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/89 (34%), Positives = 50/89 (56%), Gaps = 6/89 (6%)

Query: 119 DSNDRN-EFVFNIVTQDMMNKKKMNIKSYRG----HRLPKQNVKLLERWYIQNVENPYLD 173
           DSN+ N +F  +    D  N   + +KS +G      LPK+ V++L  W + ++ NPY  
Sbjct: 239 DSNNENTDFQRSPKANDNTNHNSI-LKSKKGTGKRSNLPKETVQILNNWLVNHLGNPYPT 297

Query: 174 DKSISELMKITSLSKVQIKNWVSNRRRKE 202
               +EL+K T L+K+Q+ NW  N RR++
Sbjct: 298 AIEKNELLKQTGLTKIQLSNWFINVRRRK 326

>Smik_6.374 Chr6 (610093..610977) [885 bp, 294 aa] {ON} YPL177C
           (REAL)
          Length = 294

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 38/64 (59%), Gaps = 2/64 (3%)

Query: 138 KKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSN 197
           KKK N  S R   LPK+ V++L  W + ++ NPY   +   EL+  T L+K+Q+ NW  N
Sbjct: 146 KKKQN--SGRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFIN 203

Query: 198 RRRK 201
            RR+
Sbjct: 204 VRRR 207

>CAGL0C01551g Chr3 complement(169232..169897) [666 bp, 221 aa] {ON}
           similar to uniprot|P41817 Saccharomyces cerevisiae
           YPL177c CUP9
          Length = 221

 Score = 47.8 bits (112), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 21/59 (35%), Positives = 36/59 (61%)

Query: 144 KSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKE 202
           KS R   LPK  +++L +W + ++ NPY   +   +L+  T L+K+Q+ NW  N RR++
Sbjct: 75  KSKRRSNLPKDTIQILNQWLLDHIHNPYPTQQEKRDLLIKTGLTKIQLSNWFINVRRRK 133

>YGL096W Chr7 (325331..326161) [831 bp, 276 aa] {ON}
           TOS8Homeodomain-containing protein and putative
           transcription factor found associated with chromatin;
           target of SBF transcription factor; induced during
           meiosis and under cell-damaging conditions; similar to
           Cup9p transcription factor
          Length = 276

 Score = 48.1 bits (113), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 22/52 (42%), Positives = 32/52 (61%)

Query: 151 LPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKE 202
           LPK  V +L +W  ++V NPY   +   EL+  T L+K+QI NW  N RR++
Sbjct: 201 LPKATVSILNKWLHEHVNNPYPTVQEKRELLAKTGLTKLQISNWFINARRRK 252

>Skud_7.181 Chr7 (328628..329449) [822 bp, 274 aa] {ON} YGL096W
           (REAL)
          Length = 274

 Score = 48.1 bits (113), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 23/63 (36%), Positives = 37/63 (58%), Gaps = 4/63 (6%)

Query: 144 KSYRGHR----LPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRR 199
           K  +GH     LPK  V +L +W ++++ NPY   +   +L+  T L+K+QI NW  N R
Sbjct: 188 KRLKGHGKRSNLPKATVCILNQWLLEHIHNPYPTVQEKRDLLAKTGLTKLQISNWFINAR 247

Query: 200 RKE 202
           R++
Sbjct: 248 RRK 250

>KLTH0H05236g Chr8 complement(465998..466702) [705 bp, 234 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 234

 Score = 47.4 bits (111), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 22/51 (43%), Positives = 31/51 (60%)

Query: 151 LPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRK 201
           LPK+ V++L  W   ++ NPY   +   EL+  T LSKVQ+ NW  N RR+
Sbjct: 109 LPKETVEILNAWLASHLNNPYPSPQEKRELLVQTGLSKVQLSNWFINVRRR 159

>Suva_7.172 Chr7 (319317..320129) [813 bp, 270 aa] {ON} YGL096W
           (REAL)
          Length = 270

 Score = 47.4 bits (111), Expect = 7e-06,   Method: Compositional matrix adjust.
 Identities = 22/60 (36%), Positives = 35/60 (58%), Gaps = 4/60 (6%)

Query: 147 RGHR----LPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKE 202
           +GH     LP   V +L +W ++++ NPY   +   EL+  T L+K+QI NW  N RR++
Sbjct: 193 KGHGKRSNLPGATVHILNKWLLEHINNPYPTLQEKRELLAQTGLTKLQISNWFINARRRK 252

>KLLA0B10450g Chr2 (912877..914046) [1170 bp, 389 aa] {ON} some
           similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 389

 Score = 47.8 bits (112), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 26/73 (35%), Positives = 43/73 (58%), Gaps = 4/73 (5%)

Query: 151 LPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKEKSITISPE 210
           LPK+ + +L  W ++N+ NPY   +   EL++ T L+ VQ+ NW  N RR++    I  E
Sbjct: 256 LPKEVINVLNDWLLKNLHNPYPTPQVKRELLEKTGLNPVQLSNWFINVRRRK----IFNE 311

Query: 211 VSRLLQELKTEKA 223
             +L Q + T+K+
Sbjct: 312 YYKLNQSVNTDKS 324

>AFL049C Chr6 complement(346546..347319) [774 bp, 257 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL177C
           (CUP9) and YGL096W (TOS8)
          Length = 257

 Score = 47.0 bits (110), Expect = 8e-06,   Method: Compositional matrix adjust.
 Identities = 25/66 (37%), Positives = 36/66 (54%)

Query: 137 NKKKMNIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVS 196
            K K   K +R   LPK+ V +L  W   + +NPY   +   EL+K T L+ VQ+ NW  
Sbjct: 124 GKLKETKKQHRRSNLPKETVDILNEWLRNHYDNPYPSPQEKKELLKQTGLNPVQLSNWFI 183

Query: 197 NRRRKE 202
           N RR++
Sbjct: 184 NVRRRK 189

>NDAI0F02170 Chr6 (527340..528491) [1152 bp, 383 aa] {ON} Anc_6.170
           YGL096W
          Length = 383

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 56/97 (57%), Gaps = 3/97 (3%)

Query: 106 ENSEEELTSPSSSDSNDRNEFVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLERWYIQ 165
           E + E  T+PS    +  N+ V   V+ D++ ++  +++  R   LPK+ +++L  W + 
Sbjct: 228 EKNYETSTTPSPKQPSPENKPV--NVSSDVV-EELTSLQHGRRSNLPKETIRILNSWLLN 284

Query: 166 NVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKE 202
           +++NPY   +   +L+  T L+KVQ+ NW  N RR++
Sbjct: 285 HLQNPYPTSQEKRDLLIKTGLTKVQLSNWFINVRRRK 321

>Ecym_2247 Chr2 complement(486469..487518) [1050 bp, 349 aa] {ON}
           similar to Ashbya gossypii AFL049C
          Length = 349

 Score = 47.4 bits (111), Expect = 9e-06,   Method: Compositional matrix adjust.
 Identities = 23/59 (38%), Positives = 34/59 (57%)

Query: 144 KSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKE 202
           K +R   LPK+ V +L  W   + +NPY   +   EL+K T L+ VQ+ NW  N RR++
Sbjct: 223 KQHRRSNLPKETVDILNEWLRDHYDNPYPSPQEKKELLKQTGLNPVQLSNWFINVRRRK 281

>TDEL0F01810 Chr6 complement(338066..338836) [771 bp, 256 aa] {ON}
           Anc_6.170 YPL177C
          Length = 256

 Score = 47.0 bits (110), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 36/61 (59%)

Query: 142 NIKSYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRK 201
            I + R   LPK+ V++L  W + ++ NPY   +   EL+  T L+K+Q+ NW  N RR+
Sbjct: 127 GISNGRRSNLPKETVQILNTWLLDHLRNPYPTPQEKRELLIKTGLTKIQLSNWFINVRRR 186

Query: 202 E 202
           +
Sbjct: 187 K 187

>NCAS0H01130 Chr8 complement(216012..216854) [843 bp, 280 aa] {ON}
           Anc_6.170 YGL096W
          Length = 280

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/56 (39%), Positives = 35/56 (62%)

Query: 147 RGHRLPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKE 202
           R   LPK+ V++L  W + +++NPY   +   EL+  T L+KVQ+ NW  N RR++
Sbjct: 129 RRSNLPKEMVQILNTWLLNHLQNPYPTSQEKRELLIKTGLTKVQLSNWFINVRRRK 184

>YPL177C Chr16 complement(213042..213962) [921 bp, 306 aa] {ON}
           CUP9Homeodomain-containing transcriptional repressor of
           PTR2, which encodes a major peptide transporter;
           imported peptides activate ubiquitin-dependent
           proteolysis, resulting in degradation of Cup9p and
           de-repression of PTR2 transcription
          Length = 306

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 22/58 (37%), Positives = 35/58 (60%)

Query: 145 SYRGHRLPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKE 202
           S R   LPK+ V++L  W + ++ NPY   +   EL+  T L+K+Q+ NW  N RR++
Sbjct: 163 SGRRSNLPKETVQILNTWLLNHLNNPYPTQQEKRELLIKTGLTKIQLSNWFINVRRRK 220

>NCAS0D03570 Chr4 (664388..665161) [774 bp, 257 aa] {ON} Anc_6.170
           YGL096W
          Length = 257

 Score = 46.2 bits (108), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 35/52 (67%)

Query: 151 LPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKE 202
           LP+  V++L  W ++++ NPY + +    L+++T L+KVQ+ NW  N RR++
Sbjct: 187 LPRGTVEVLNGWLLEHLNNPYPNVQEKKLLLELTGLTKVQLSNWFINVRRRK 238

>NDAI0I01320 Chr9 complement(318160..319389) [1230 bp, 409 aa] {ON}
           Anc_6.170 YGL096W
          Length = 409

 Score = 46.6 bits (109), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 25/68 (36%), Positives = 38/68 (55%), Gaps = 2/68 (2%)

Query: 137 NKKKMNIKSYRGHR--LPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNW 194
           N+  M  K   G R  LP   V++L  W + ++ NPY   +   EL+K T L+K+Q+ NW
Sbjct: 296 NEMNMRRKKGSGRRSSLPITTVQILNEWLLDHLTNPYPTTQEKKELLKQTGLTKIQLSNW 355

Query: 195 VSNRRRKE 202
             N RR++
Sbjct: 356 FINVRRRK 363

>KAFR0G03650 Chr7 (752766..753299) [534 bp, 177 aa] {ON} Anc_6.170
           YPL177C
          Length = 177

 Score = 45.1 bits (105), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 33/52 (63%)

Query: 151 LPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKE 202
           LPK+ +++L  W + ++ NPY   +   +L+  T L+K+Q+ NW  N RR++
Sbjct: 76  LPKETIQILNAWLLNHLHNPYPTSQEKRDLLIKTGLTKIQLSNWFINVRRRK 127

>SAKL0A05610g Chr1 complement(506437..507399) [963 bp, 320 aa] {ON}
           some similarities with uniprot|P41817 Saccharomyces
           cerevisiae YPL177C CUP9 Homeodomain-containing
           transcriptional repressor of PTR2 which encodes a major
           peptide transporter imported peptides activate
           ubiquitin- dependent proteolysis resulting in
           degradation of Cup9p and de-repression of PTR2
           transcription
          Length = 320

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 20/52 (38%), Positives = 32/52 (61%)

Query: 151 LPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKE 202
           LPK+ V++L  W + ++ NPY   +   EL+  T L+ VQ+ NW  N RR++
Sbjct: 213 LPKETVQILNNWLLAHLHNPYPSPQEKRELLLKTGLNPVQLSNWFINVRRRK 264

>CAGL0H02959g Chr8 (277540..278319) [780 bp, 259 aa] {ON} some
           similarities with uniprot|P53147 Saccharomyces
           cerevisiae YGL096w TOS8
          Length = 259

 Score = 45.1 bits (105), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%)

Query: 151 LPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKE 202
           LPK+ VK+L  W   ++ NPY   +   EL   T L+K+Q+ NW  N RR++
Sbjct: 168 LPKETVKILNEWLYDHINNPYPTPQEKMELSLKTGLTKIQLSNWFINVRRRK 219

>KNAG0F02210 Chr6 complement(423243..424217) [975 bp, 324 aa] {ON}
           Anc_6.170 YPL177C
          Length = 324

 Score = 45.4 bits (106), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 18/52 (34%), Positives = 33/52 (63%)

Query: 151 LPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKE 202
           LP++ V++L  W + ++ +PY       EL++ T L+K+Q+ NW  N RR++
Sbjct: 246 LPRETVQMLNNWLLNHLHDPYPTPHEKLELLRQTGLTKIQLSNWFINVRRRK 297

>Kwal_27.11092 s27 (635052..635741) [690 bp, 229 aa] {ON} YPL177C
           (CUP9) - putative DNA binding protein which shows
           similarity in homeobox domain to human proto-oncogene
           PBX1 [contig 31] FULL
          Length = 229

 Score = 44.3 bits (103), Expect = 8e-05,   Method: Compositional matrix adjust.
 Identities = 21/52 (40%), Positives = 31/52 (59%)

Query: 151 LPKQNVKLLERWYIQNVENPYLDDKSISELMKITSLSKVQIKNWVSNRRRKE 202
           LPK+ V +L  W + ++  PY   +   EL+  T LSKVQ+ NW  N RR++
Sbjct: 125 LPKETVDILNNWLLAHLNYPYPSPQEKRELLIKTGLSKVQLSNWFINVRRRK 176

>Skud_71.2 Chr71 (734..868) [135 bp, 45 aa] {ON} YCL067C (REAL)
          Length = 45

 Score = 36.2 bits (82), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 22/37 (59%)

Query: 1  MNKIPINILLNPSHQENLKDKLQQINDKLTSLCSKIP 37
          MNKIPI  LLNP   +  K  +  IN KL S+C  +P
Sbjct: 1  MNKIPIKDLLNPQITDEFKSNILDINKKLFSICCNLP 37

>Suva_69.1 Chr69 complement(1..102) [102 bp, 34 aa] {ON} YCR039C
          (REAL)
          Length = 34

 Score = 33.9 bits (76), Expect = 0.018,   Method: Compositional matrix adjust.
 Identities = 17/34 (50%), Positives = 20/34 (58%)

Query: 1  MNKIPINILLNPSHQENLKDKLQQINDKLTSLCS 34
          MNKIPI  LLNP   +  K  +  IN KL S+C 
Sbjct: 1  MNKIPIKDLLNPQITDEFKSSILDINKKLFSICC 34

>SAKL0H14036g Chr8 (1200951..1202117) [1167 bp, 388 aa] {ON} weakly
           similar to uniprot|Q04003 Saccharomyces cerevisiae
           YDR181c SAS4
          Length = 388

 Score = 34.7 bits (78), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 20/46 (43%), Positives = 26/46 (56%), Gaps = 1/46 (2%)

Query: 107 NSEEELTSPSSSDSNDRNEFVFNIVTQDMMNKKKMNIKSYRGHRLP 152
            SE +L S S  +  D N F F++    +  KKK+NI S RG RLP
Sbjct: 36  GSERKLRSKSQEERGDDNRFNFDVTAYKIDPKKKLNIVS-RGTRLP 80

>KLTH0E09108g Chr5 (823623..826409) [2787 bp, 928 aa] {ON} some
           similarities with uniprot|P39523 Saccharomyces
           cerevisiae YMR124W Protein of unknown function green
           fluorescent protein (GFP)-fusion protein localizes to
           the cell periphery cytoplasm bud and bud neck
          Length = 928

 Score = 33.9 bits (76), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 25/76 (32%), Positives = 37/76 (48%), Gaps = 4/76 (5%)

Query: 58  LTTVVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSLRMANENYESQTSKENSEEE----LT 113
           LT + +    D+ +    +  YQ S   +  VK LR  N N  S ++ E SE+E    L 
Sbjct: 686 LTNIEEKRGRDDADASKEQGVYQESAGPTSPVKPLRFDNANKRSDSNSEKSEDEADRTLE 745

Query: 114 SPSSSDSNDRNEFVFN 129
           + S  + N  NEFVF+
Sbjct: 746 ANSHDEENVGNEFVFD 761

>Smik_4.552 Chr4 complement(1000275..1002938) [2664 bp, 887 aa] {ON}
           YDR303C (REAL)
          Length = 887

 Score = 30.8 bits (68), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 40/137 (29%), Positives = 67/137 (48%), Gaps = 20/137 (14%)

Query: 46  EDHLELQR-ILLFLTTVVKNEKLDNDEIMLVRTTYQLSTTLSIMVKSL--RMANENYESQ 102
           E+ LEL R  L F+ + + N K    E   +  +  +  TL +M+ +L  R      E+ 
Sbjct: 667 EEFLELSRETLFFVFSNLANIKFAGHEFTFINKSITVLQTLVLMLLALYQRSFESFKETA 726

Query: 103 TSKENSEEELTSPSSSDSNDR--NEFVFNIVTQDMMNKKKMNIKSYRGHRLPKQNVKLLE 160
             KE+S ++  S  S++ N R  N+ V +++    +NK  M +K Y  +   KQN KL+E
Sbjct: 727 AEKEDSIDQTDSVHSNNDNKRIKNKNVIHLI----INKISMLLKDYTKN-CKKQN-KLIE 780

Query: 161 ---------RWYIQNVE 168
                     +YI+N+E
Sbjct: 781 NLIIKIKMISYYIKNLE 797

>Suva_4.424 Chr4 (747821..748441) [621 bp, 206 aa] {ON} YBR171W
           (REAL)
          Length = 206

 Score = 29.3 bits (64), Expect = 7.2,   Method: Compositional matrix adjust.
 Identities = 19/56 (33%), Positives = 28/56 (50%), Gaps = 4/56 (7%)

Query: 75  VRTTYQLSTTLSIMVKSLRMANENYESQTSKENSEEELTSPSSSDSNDRNEFVFNI 130
           V + Y     + I+V SL M   NY  + +K+ SE+    PS  D ND ++  F I
Sbjct: 27  VISVYTPLIYVFILVVSLVMFASNYRKKQAKKISEQ----PSIFDENDAHDLFFQI 78

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.310    0.126    0.335 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 24,822,318
Number of extensions: 1126167
Number of successful extensions: 7231
Number of sequences better than 10.0: 346
Number of HSP's gapped: 7161
Number of HSP's successfully gapped: 353
Length of query: 223
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 118
Effective length of database: 41,441,469
Effective search space: 4890093342
Effective search space used: 4890093342
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 63 (28.9 bits)