Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_2002.21.1ON2092099391e-130
TBLA0A070401.120ON2012083723e-44
TBLA0A075901.1ON2012083723e-44
TPHA0E036201.120ON1952023715e-44
TPHA0E040801.1ON1952023715e-44
ZYRO0F18590g1.1ON2002113593e-42
ZYRO0F15840g1.120ON2002113593e-42
TDEL0C070101.1ON2051653491e-40
Suva_3.1481.1ON175712331e-23
YCR040W (MATALPHA1)1.120ON175702285e-23
YCL066W (HMLALPHA1)1.1ON175702285e-23
Smik_92.1singletonON156662275e-23
Skud_3.1191.120ON174652154e-21
Skud_71.1singletonON155612119e-21
CAGL0B01243g1.120ON1431082056e-20
CAGL0B00242g1.1ON1841482078e-20
Suva_69.2singletonON145591994e-19
Ecym_10031.1ON263691495e-11
Ecym_11141.120ON263691495e-11
KAFR0D007101.120ON172551457e-11
NCAS0B091501.1ON150751322e-09
KNAG0C001501.1ON145491304e-09
KLLA0C00352g1.1ON2611681195e-07
Kwal_33.matalpha1singletonOFF244751133e-06
Kwal_33.12992singletonOFF244751133e-06
Kwal_YGOB_matalpha11.120ON244751133e-06
Kwal_YGOB_HMalpha11.1ON244751133e-06
NDAI0A001001.1ON13561962e-04
Kwal_33.13240singletonOFF16847750.19
Suva_3.140singletonON3120670.29
Smik_3.1441.120ON5422680.34
Smik_88.1singletonON3518640.80
Skud_80.1singletonON3216611.8
Suva_3.791.120ON3517612.2
TDEL0B070602.613ON79897673.2
TBLA0A101902.613ON80793664.7
KLLA0B07667g1.144ON199992656.2
NOTE: 1 genes in the same pillar as Kpol_2002.2 were not hit in these BLAST results
LIST: KLTH0F00374g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_2002.2
         (209 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON} c...   366   e-130
TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {...   147   3e-44
TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {...   147   3e-44
TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.12...   147   5e-44
TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenc...   147   5e-44
ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} simil...   142   3e-42
ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} simil...   142   3e-42
TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1....   139   1e-40
Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W (...    94   1e-23
YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}  MATALPHA1Tr...    92   5e-23
YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}  HMLALPHA1Sile...    92   5e-23
Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W...    92   5e-23
Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W (...    87   4e-21
Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W...    86   9e-21
CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {O...    84   6e-20
CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}...    84   8e-20
Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)        81   4e-19
Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to Sac...    62   5e-11
Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON} ...    62   5e-11
KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON...    60   7e-11
NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1      55   2e-09
KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON} ...    55   4e-09
KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}...    50   5e-07
Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa...    48   3e-06
Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF...    48   3e-06
Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 ...    48   3e-06
Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]...    48   3e-06
NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON} Anc...    42   2e-04
Kwal_33.13240 s33 complement(134062..134568) [507 bp, 168 aa] {O...    33   0.19 
Suva_3.140 Chr3 (212396..212488) [93 bp, 31 aa] {ON} YCR040W (REAL)    30   0.29 
Smik_3.144 Chr3 (198300..198334,198763..198892) [165 bp, 54 aa] ...    31   0.34 
Smik_88.1 Chr88 complement(3..72,501..535) [105 bp, 35 aa] {ON} ...    29   0.80 
Skud_80.1 Chr80 complement(3..98) [96 bp, 32 aa] {ON} YCR040W (R...    28   1.8  
Suva_3.79 Chr3 (114117..114221) [105 bp, 35 aa] {ON} YCR040W (REAL)    28   2.2  
TDEL0B07060 Chr2 complement(1243893..1246289) [2397 bp, 798 aa] ...    30   3.2  
TBLA0A10190 Chr1 complement(2515833..2518256) [2424 bp, 807 aa] ...    30   4.7  
KLLA0B07667g Chr2 (667863..673862) [6000 bp, 1999 aa] {ON} some ...    30   6.2  

>Kpol_2002.2 s2002 complement(3611..4240) [630 bp, 209 aa] {ON}
           complement(3611..4240) [630 nt, 210 aa]
          Length = 209

 Score =  366 bits (939), Expect = e-130,   Method: Compositional matrix adjust.
 Identities = 183/209 (87%), Positives = 183/209 (87%)

Query: 1   MSTKSRSWTSQPLFKVXXXXXXXXXXXXXXGIAINKLANSAGKLSQKANVNVFITNSLVT 60
           MSTKSRSWTSQPLFKV              GIAINKLANSAGKLSQKANVNVFITNSLVT
Sbjct: 1   MSTKSRSWTSQPLFKVKLNKSNKIEKQKKKGIAINKLANSAGKLSQKANVNVFITNSLVT 60

Query: 61  KIPFPPSSLLLGIDXXXXXXXXXXXXINIQNDTNILNFSSSWDEDDLFLSDTETEYDLLS 120
           KIPFPPSSLLLGID            INIQNDTNILNFSSSWDEDDLFLSDTETEYDLLS
Sbjct: 61  KIPFPPSSLLLGIDEETKKMKSKKTSINIQNDTNILNFSSSWDEDDLFLSDTETEYDLLS 120

Query: 121 TSPNSVIEVDTSSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKWTVL 180
           TSPNSVIEVDTSSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKWTVL
Sbjct: 121 TSPNSVIEVDTSSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKWTVL 180

Query: 181 SQQFNFVKPKCGFVEWVGQTYEREMMWCN 209
           SQQFNFVKPKCGFVEWVGQTYEREMMWCN
Sbjct: 181 SQQFNFVKPKCGFVEWVGQTYEREMMWCN 209

>TBLA0A07040 Chr1 complement(1727988..1728593) [606 bp, 201 aa] {ON}
            MATalpha1 gene at MAT locus
          Length = 201

 Score =  147 bits (372), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 115/208 (55%), Gaps = 14/208 (6%)

Query: 1   MSTKSRSWTSQPLFKVXXXXXXXXXXXXXXGIAINKLANSAGKLSQKANVNVFITNSLVT 60
           MS K+ + T + LFKV                  NK   + G       +++ +  +   
Sbjct: 1   MSNKTMNHTKKALFKVNLKLNKNIRMKTNSKSMRNKFNETRG-------ISILLYKNHNI 53

Query: 61  KIPFPPSSLLLGIDXXXXXXXXXXXXIN---IQNDTNILNFSSSWDEDDLFLSDTETEYD 117
           KIPFPP++LL  I+            +N   + ND N L  S  + ED+   +D  + +D
Sbjct: 54  KIPFPPTTLLYNIEVEKQKIISTQHMLNEYTMDNDDNYL--SDLFYEDEY--NDNNSLFD 109

Query: 118 LLSTSPNSVIEVDTSSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKW 177
               +  +      +S++ LNGF+AFRAYNSQFGYGLKQ ILSSLLS AWH +P QQ  W
Sbjct: 110 NGFPNNVNSNPNPVNSERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVW 169

Query: 178 TVLSQQFNFVKPKCGFVEWVGQTYEREM 205
              SQ++NFVKPKCGFVEW+GQTYEREM
Sbjct: 170 NFFSQEYNFVKPKCGFVEWLGQTYEREM 197

>TBLA0A07590 Chr1 complement(1881757..1882362) [606 bp, 201 aa] {ON}
           Anc_1.1 YCL066W silenced copy of alpha1 gene at HML
           locus
          Length = 201

 Score =  147 bits (372), Expect = 3e-44,   Method: Compositional matrix adjust.
 Identities = 86/208 (41%), Positives = 115/208 (55%), Gaps = 14/208 (6%)

Query: 1   MSTKSRSWTSQPLFKVXXXXXXXXXXXXXXGIAINKLANSAGKLSQKANVNVFITNSLVT 60
           MS K+ + T + LFKV                  NK   + G       +++ +  +   
Sbjct: 1   MSNKTMNHTKKALFKVNLKLNKNIRMKTNSKSMRNKFNETRG-------ISILLYKNHNI 53

Query: 61  KIPFPPSSLLLGIDXXXXXXXXXXXXIN---IQNDTNILNFSSSWDEDDLFLSDTETEYD 117
           KIPFPP++LL  I+            +N   + ND N L  S  + ED+   +D  + +D
Sbjct: 54  KIPFPPTTLLYNIEVEKQKIISTQHMLNEYTMDNDDNYL--SDLFYEDEY--NDNNSLFD 109

Query: 118 LLSTSPNSVIEVDTSSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKW 177
               +  +      +S++ LNGF+AFRAYNSQFGYGLKQ ILSSLLS AWH +P QQ  W
Sbjct: 110 NGFPNNVNSNPNPVNSERVLNGFIAFRAYNSQFGYGLKQNILSSLLSTAWHENPNQQNVW 169

Query: 178 TVLSQQFNFVKPKCGFVEWVGQTYEREM 205
              SQ++NFVKPKCGFVEW+GQTYEREM
Sbjct: 170 NFFSQEYNFVKPKCGFVEWLGQTYEREM 197

>TPHA0E03620 Chr5 (766068..766655) [588 bp, 195 aa] {ON} Anc_1.121
           YCR040W MATalpha1 gene at MAT locus
          Length = 195

 Score =  147 bits (371), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 116/202 (57%), Gaps = 14/202 (6%)

Query: 7   SWTSQPLFKVXXXXXXXXXXXXXXGIAINKLANSAGKLSQKANVNVFITNSLVTKIPFPP 66
           +W+ QPLFKV               I I    N+     Q+++   FI  +   KIP+PP
Sbjct: 6   TWSKQPLFKVSLNKKRIR------SIKIKTHKNNVQLKKQRSHQ--FIAENFKLKIPYPP 57

Query: 67  SSLLLGIDXXXXXXXXXXXXINIQNDTNILNFSSSWDEDDLFLSDTETEYDLLSTSPNSV 126
           + LL  ID            +  Q+  ++ N   +WDED++ LSD +   D+   + +S 
Sbjct: 58  TCLLRSIDAELRRIEIKKSIV-AQDVNSLFNVELTWDEDNV-LSDDDINDDIAYINYSS- 114

Query: 127 IEVDTSSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKWTVLSQQFNF 186
            E +   KKSLN F+AFRAYN+QFG GL Q +LS LLS AWHS PEQ   W V +QQFNF
Sbjct: 115 -EEELLFKKSLNSFIAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNF 173

Query: 187 VKPKCGFVEWVGQTYEREMMWC 208
           VKPKCGFVEWVGQTYERE  WC
Sbjct: 174 VKPKCGFVEWVGQTYERE--WC 193

>TPHA0E04080 Chr5 (850045..850632) [588 bp, 195 aa] {ON}   silenced
           copy of alpha1 at HMLalpha locus
          Length = 195

 Score =  147 bits (371), Expect = 5e-44,   Method: Compositional matrix adjust.
 Identities = 91/202 (45%), Positives = 116/202 (57%), Gaps = 14/202 (6%)

Query: 7   SWTSQPLFKVXXXXXXXXXXXXXXGIAINKLANSAGKLSQKANVNVFITNSLVTKIPFPP 66
           +W+ QPLFKV               I I    N+     Q+++   FI  +   KIP+PP
Sbjct: 6   TWSKQPLFKVSLNKKRIR------SIKIKTHKNNVQLKKQRSHQ--FIAENFKLKIPYPP 57

Query: 67  SSLLLGIDXXXXXXXXXXXXINIQNDTNILNFSSSWDEDDLFLSDTETEYDLLSTSPNSV 126
           + LL  ID            +  Q+  ++ N   +WDED++ LSD +   D+   + +S 
Sbjct: 58  TCLLRSIDAELRRIEIKKSIV-AQDVNSLFNVELTWDEDNV-LSDDDINDDIAYINYSS- 114

Query: 127 IEVDTSSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKWTVLSQQFNF 186
            E +   KKSLN F+AFRAYN+QFG GL Q +LS LLS AWHS PEQ   W V +QQFNF
Sbjct: 115 -EEELLFKKSLNSFIAFRAYNAQFGNGLNQHLLSHLLSLAWHSAPEQHHVWDVFAQQFNF 173

Query: 187 VKPKCGFVEWVGQTYEREMMWC 208
           VKPKCGFVEWVGQTYERE  WC
Sbjct: 174 VKPKCGFVEWVGQTYERE--WC 193

>ZYRO0F18590g Chr6 (1533781..1534383) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score =  142 bits (359), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 113/211 (53%), Gaps = 21/211 (9%)

Query: 1   MSTKS-RSWTS-QPLFKVXXXXXXXXXXXXXXGIAINKLANSAGKLSQKANVNVFITNSL 58
           M+TKS R + S QPLFKV                        AGK  +   VNVF+T S 
Sbjct: 1   MNTKSFRGFKSNQPLFKVKVEKKGRSKRPTLQDTTQTSKC-IAGKCIEDQQVNVFMTVSK 59

Query: 59  VTKIPFPPSSLLLGIDXXXXXXXXXXXXINIQNDTNILNFSSSWDE-----DDLFLSDTE 113
           + KIP PP  LL  I+               ++D N+ N    WD      +  F S  +
Sbjct: 60  LIKIPSPPEVLLRKIEEEKHKLK--------KDDFNMDNILL-WDPYVYWGEGYFFSIAD 110

Query: 114 TEYDLLSTSPNSVIEVDTSSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQ 173
           +  + LST  +        S+K LN FMAFRAYNSQFG GLKQ ILSSLL+ AWHS PEQ
Sbjct: 111 SSLNNLSTKGSR----KGCSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQ 166

Query: 174 QKKWTVLSQQFNFVKPKCGFVEWVGQTYERE 204
           QK W   +QQFNFVKPKCGFVEWV Q YERE
Sbjct: 167 QKIWDTFAQQFNFVKPKCGFVEWVDQRYERE 197

>ZYRO0F15840g Chr6 (1303842..1304444) [603 bp, 200 aa] {ON} similar
           to uniprot|P01365 Saccharomyces cerevisiae YCR040W
           MATALPHA1 Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression
           targets the transcription factor Mcm1p to the promoters
           of alpha- specific genes one of two genes encoded by the
           alpha mating type cassette
          Length = 200

 Score =  142 bits (359), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 96/211 (45%), Positives = 113/211 (53%), Gaps = 21/211 (9%)

Query: 1   MSTKS-RSWTS-QPLFKVXXXXXXXXXXXXXXGIAINKLANSAGKLSQKANVNVFITNSL 58
           M+TKS R + S QPLFKV                        AGK  +   VNVF+T S 
Sbjct: 1   MNTKSFRGFKSNQPLFKVKVEKKGRSKRPTLQDTTQTSKC-IAGKCIEDQQVNVFMTVSK 59

Query: 59  VTKIPFPPSSLLLGIDXXXXXXXXXXXXINIQNDTNILNFSSSWDE-----DDLFLSDTE 113
           + KIP PP  LL  I+               ++D N+ N    WD      +  F S  +
Sbjct: 60  LIKIPSPPEVLLRKIEEEKHKLK--------KDDFNMDNILL-WDPYVYWGEGYFFSIAD 110

Query: 114 TEYDLLSTSPNSVIEVDTSSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQ 173
           +  + LST  +        S+K LN FMAFRAYNSQFG GLKQ ILSSLL+ AWHS PEQ
Sbjct: 111 SSLNNLSTKGSR----KGCSEKPLNSFMAFRAYNSQFGNGLKQNILSSLLAAAWHSHPEQ 166

Query: 174 QKKWTVLSQQFNFVKPKCGFVEWVGQTYERE 204
           QK W   +QQFNFVKPKCGFVEWV Q YERE
Sbjct: 167 QKIWDTFAQQFNFVKPKCGFVEWVDQRYERE 197

>TDEL0C07010 Chr3 (1274648..1275265) [618 bp, 205 aa] {ON} Anc_1.121
           YCR040W silenced copy of alpha1 gene at T. delbrueckii
           HML locus
          Length = 205

 Score =  139 bits (349), Expect = 1e-40,   Method: Compositional matrix adjust.
 Identities = 79/165 (47%), Positives = 95/165 (57%), Gaps = 11/165 (6%)

Query: 41  AGKLSQKANVNVFITNSLVTKIPFPPSSLLLGIDXXXXXXXXXXX-XINIQNDTNILNFS 99
           +G+L ++ +V  F+      KIP PP+ LL  I+             I    D+ I    
Sbjct: 50  SGRLEER-HVKTFVVILRPIKIPLPPNILLEKIEQEKRKVYSETSPEIGSLWDSPI---- 104

Query: 100 SSWDEDDLFLSDTETEYDLLSTSPNSVIEVDTSSKKSLNGFMAFRAYNSQFGYGLKQEIL 159
            +WD +DL  S        +   P      +T+S K LN FMAFRAYNSQFGYGLKQ IL
Sbjct: 105 -AWDNEDLLFSIASDVLGNIYKKPAR----ETASNKPLNSFMAFRAYNSQFGYGLKQNIL 159

Query: 160 SSLLSEAWHSDPEQQKKWTVLSQQFNFVKPKCGFVEWVGQTYERE 204
           SSLL+ AWHS PEQQ  W   +QQFNFVKPKCGFVEWV Q YERE
Sbjct: 160 SSLLASAWHSHPEQQGIWDTFAQQFNFVKPKCGFVEWVDQRYERE 204

>Suva_3.148 Chr3 (222811..223338) [528 bp, 175 aa] {ON} YCL066W
           (REAL)
          Length = 175

 Score = 94.4 bits (233), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 44/71 (61%), Positives = 50/71 (70%)

Query: 131 TSSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKWTVLSQQFNFVKPK 190
           T SKK LN FMAFRAY SQFG G+KQ ILSSLLSE WH+D  Q   W   +QQ+NF+ P 
Sbjct: 87  TPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPG 146

Query: 191 CGFVEWVGQTY 201
            GFVEW+   Y
Sbjct: 147 FGFVEWLTNNY 157

>YCR040W Chr3 (200442..200969) [528 bp, 175 aa] {ON}
           MATALPHA1Transcriptional co-activator involved in
           regulation of mating-type-specific gene expression;
           targets the transcription factor Mcm1p to the promoters
           of alpha-specific genes; one of two genes encoded by the
           MATalpha mating type cassette
          Length = 175

 Score = 92.4 bits (228), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 50/70 (71%)

Query: 132 SSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKWTVLSQQFNFVKPKC 191
           SSKK LN FMAFRAY SQFG G+KQ +LSSLL+E WH+D  Q   W   +QQ+NF+ P  
Sbjct: 88  SSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGF 147

Query: 192 GFVEWVGQTY 201
           GFVEW+   Y
Sbjct: 148 GFVEWLTNNY 157

>YCL066W Chr3 (13282..13809) [528 bp, 175 aa] {ON}
           HMLALPHA1Silenced copy of ALPHA1 at HML, encoding a
           transcriptional coactivator involved in the regulation
           of mating-type alpha-specific gene expression
          Length = 175

 Score = 92.4 bits (228), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 42/70 (60%), Positives = 50/70 (71%)

Query: 132 SSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKWTVLSQQFNFVKPKC 191
           SSKK LN FMAFRAY SQFG G+KQ +LSSLL+E WH+D  Q   W   +QQ+NF+ P  
Sbjct: 88  SSKKYLNSFMAFRAYYSQFGSGVKQNVLSSLLAEEWHADKMQHGIWDYFAQQYNFINPGF 147

Query: 192 GFVEWVGQTY 201
           GFVEW+   Y
Sbjct: 148 GFVEWLTNNY 157

>Smik_92.1 Chr92 complement(3..470) [468 bp, 156 aa] {ON} YCR040W
           (REAL)
          Length = 156

 Score = 92.0 bits (227), Expect = 5e-23,   Method: Compositional matrix adjust.
 Identities = 42/66 (63%), Positives = 49/66 (74%)

Query: 132 SSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKWTVLSQQFNFVKPKC 191
           S+KK LN FMAFRAY SQFG G+KQ ILSSLLSE WH+D  Q   W   +QQ+NF+ P  
Sbjct: 88  STKKYLNSFMAFRAYYSQFGSGVKQNILSSLLSEEWHADKTQHGIWDYFAQQYNFINPGF 147

Query: 192 GFVEWV 197
           GFVEW+
Sbjct: 148 GFVEWL 153

>Skud_3.119 Chr3 (184941..185465) [525 bp, 174 aa] {ON} YCR040W
           (REAL)
          Length = 174

 Score = 87.4 bits (215), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 39/65 (60%), Positives = 46/65 (70%)

Query: 137 LNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKWTVLSQQFNFVKPKCGFVEW 196
           +N FMAFRAY SQFG G+KQ ILSSLLSE WH+D  Q   W   +QQ+NF+ P  GFVEW
Sbjct: 92  INSFMAFRAYYSQFGSGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVEW 151

Query: 197 VGQTY 201
           +   Y
Sbjct: 152 LTNNY 156

>Skud_71.1 Chr71 complement(3..467) [465 bp, 155 aa] {ON} YCR040W
           (REAL)
          Length = 155

 Score = 85.9 bits (211), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 38/61 (62%), Positives = 45/61 (73%)

Query: 137 LNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKWTVLSQQFNFVKPKCGFVEW 196
           +N FMAFRAY SQFG G+KQ ILSSLLSE WH+D  Q   W   +QQ+NF+ P  GFVEW
Sbjct: 92  INSFMAFRAYYSQFGSGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINPGFGFVEW 151

Query: 197 V 197
           +
Sbjct: 152 L 152

>CAGL0B01243g Chr2 complement(112831..113262) [432 bp, 143 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 expressed copy at MAT locus
           or uniprot|P01365 Saccharomyces cerevisiae YCL066w
           HMLALPHA1 silenced copy at HML
          Length = 143

 Score = 83.6 bits (205), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 43/108 (39%), Positives = 65/108 (60%), Gaps = 6/108 (5%)

Query: 90  QNDTNILNFSSSWDEDDLFLSDTETEYDLLSTSPNSVIEVDTSSKKSLNGFMAFRAYNSQ 149
           ++  NI++  +SW E D F+S     +   ++  N +    +S K+ +N FMAFR Y +Q
Sbjct: 34  ESGINIIDIETSW-EIDKFIS-----HHFNTSIGNVLKSKSSSKKRPMNAFMAFRTYYAQ 87

Query: 150 FGYGLKQEILSSLLSEAWHSDPEQQKKWTVLSQQFNFVKPKCGFVEWV 197
            G GLKQ  LS +LSEAW++    Q  W + +QQFNF  P+CGFV ++
Sbjct: 88  LGTGLKQNTLSVILSEAWNAPETDQNIWDIFAQQFNFASPRCGFVNYI 135

>CAGL0B00242g Chr2 complement(10582..11136) [555 bp, 184 aa] {ON}
           some similarities with uniprot|P01365 Saccharomyces
           cerevisiae YCR040w MATALPHA1 mating type regulatory
           protein or uniprot|P01365 Saccharomyces cerevisiae
           YCL066w HMLALPHA1
          Length = 184

 Score = 84.3 bits (207), Expect = 8e-20,   Method: Compositional matrix adjust.
 Identities = 51/148 (34%), Positives = 78/148 (52%), Gaps = 11/148 (7%)

Query: 50  VNVFITNSLVTKIPFPPSSLLLGIDXXXXXXXXXXXXINIQNDTNILNFSSSWDEDDLFL 109
           +N+ +T     +IP P   LL  I              + ++  NI++  +SW E D F+
Sbjct: 40  LNMLLTKPNKFQIPPPHPVLLKRIREERMKLTS-----SFESGINIIDIETSW-EIDKFI 93

Query: 110 SDTETEYDLLSTSPNSVIEVDTSSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHS 169
           S     +   ++  N +    +S K+ +N FMAFR Y +Q G GLKQ  LS +LSEAW++
Sbjct: 94  S-----HHFNTSIGNVLKSKSSSKKRPMNAFMAFRTYYAQLGTGLKQNTLSVILSEAWNA 148

Query: 170 DPEQQKKWTVLSQQFNFVKPKCGFVEWV 197
               Q  W + +QQFNF  P+CGFV ++
Sbjct: 149 PETDQNIWDIFAQQFNFASPRCGFVNYI 176

>Suva_69.2 Chr69 (369..803) [435 bp, 145 aa] {ON} YCL066W (REAL)
          Length = 145

 Score = 81.3 bits (199), Expect = 4e-19,   Method: Compositional matrix adjust.
 Identities = 38/59 (64%), Positives = 43/59 (72%)

Query: 131 TSSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKWTVLSQQFNFVKP 189
           T SKK LN FMAFRAY SQFG G+KQ ILSSLLSE WH+D  Q   W   +QQ+NF+ P
Sbjct: 87  TPSKKYLNSFMAFRAYYSQFGAGVKQNILSSLLSEEWHADKMQHGIWDYFAQQYNFINP 145

>Ecym_1003 Chr1 (6314..7105) [792 bp, 263 aa] {ON} similar to
           Saccharomyces cerevisiae YCL066W HMLALPHA1
          Length = 263

 Score = 62.0 bits (149), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 45/69 (65%), Gaps = 1/69 (1%)

Query: 134 KKSLNGFMAFRAYNSQFGYGLKQEI-LSSLLSEAWHSDPEQQKKWTVLSQQFNFVKPKCG 192
           +K +N FMAFR+Y S+F  G+  ++ LS +L++ WH  P+ ++ W + ++ +N  +P   
Sbjct: 110 RKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQS 169

Query: 193 FVEWVGQTY 201
           F EW+ +TY
Sbjct: 170 FPEWLEKTY 178

>Ecym_1114 Chr1 complement(236238..237029) [792 bp, 263 aa] {ON}
           similar to YCL066W HMLALPHA1
          Length = 263

 Score = 62.0 bits (149), Expect = 5e-11,   Method: Compositional matrix adjust.
 Identities = 25/69 (36%), Positives = 45/69 (65%), Gaps = 1/69 (1%)

Query: 134 KKSLNGFMAFRAYNSQFGYGLKQEI-LSSLLSEAWHSDPEQQKKWTVLSQQFNFVKPKCG 192
           +K +N FMAFR+Y S+F  G+  ++ LS +L++ WH  P+ ++ W + ++ +N  +P   
Sbjct: 110 RKKINEFMAFRSYYSRFFRGIVPQLELSRILAQLWHEKPKMKRTWEMFAEHYNMEQPDQS 169

Query: 193 FVEWVGQTY 201
           F EW+ +TY
Sbjct: 170 FPEWLEKTY 178

>KAFR0D00710 Chr4 complement(127819..128337) [519 bp, 172 aa] {ON}
           mating type gene MATalpha1
          Length = 172

 Score = 60.5 bits (145), Expect = 7e-11,   Method: Compositional matrix adjust.
 Identities = 26/55 (47%), Positives = 39/55 (70%)

Query: 129 VDTSSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKWTVLSQQ 183
           ++    ++LN FMAFR+Y SQ+  GLKQ  LS +L++AWHSD ++Q  W  L+Q+
Sbjct: 113 IEICQNRNLNPFMAFRSYYSQYAQGLKQIELSEVLAKAWHSDTKEQNYWISLTQK 167

>NCAS0B09150 Chr2 (1755595..1756047) [453 bp, 150 aa] {ON} Anc_1.1
          Length = 150

 Score = 55.5 bits (132), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 28/75 (37%), Positives = 43/75 (57%), Gaps = 2/75 (2%)

Query: 123 PNSVIEVDTSSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKWTVLSQ 182
           P    +V ++  K +NGF+ FR+Y S++GYG+KQ +LS LL++ W S    Q  W   + 
Sbjct: 78  PKPRKQVTSNPSKPINGFILFRSYYSRWGYGIKQTMLSQLLAKFWKSSDTDQALWDYFAL 137

Query: 183 QFNFVKPKCGFVEWV 197
           Q++ V   C    WV
Sbjct: 138 QYSTV--GCEMGVWV 150

>KNAG0C00150 Chr3 complement(24902..25339) [438 bp, 145 aa] {ON}
           Anc_1.1 YCL066W silent copy of mating type alpha1 gene
           at HML locus
          Length = 145

 Score = 54.7 bits (130), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 26/49 (53%), Positives = 34/49 (69%)

Query: 136 SLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKWTVLSQQF 184
           SLN F+AFRAY SQF  G+ Q  LSS+LS+ W S+  QQ  W  L++Q+
Sbjct: 91  SLNSFIAFRAYYSQFANGINQNKLSSILSKFWKSNQSQQTFWDRLTEQY 139

>KLLA0C00352g Chr3 complement(24124..24909) [786 bp, 261 aa] {ON}
           uniprot|Q08398 Kluyveromyces lactis HMLAPLHA1 Mating-
           type protein ALPHA1
          Length = 261

 Score = 50.4 bits (119), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 40/168 (23%), Positives = 73/168 (43%), Gaps = 29/168 (17%)

Query: 41  AGKLSQKANVNVFITNSLVTKIPFPPSSLLLGIDXXXXXXXXXXXXINIQNDTNILNFSS 100
           + +  +   VN++++    T IP PP  L+  I             +   N + +L   S
Sbjct: 38  SSRYRKHEGVNLYMSKVTPTSIPAPPQVLVAYI----------KEKVKTLNKSEVL--MS 85

Query: 101 SWDEDDLFLSDTETEYDLLSTSPNSVIEVDTSSKKSLNGFMAFRAYNSQFGYG-LKQEIL 159
             + + L   D +T+                + KK +N F+AFR+Y S+   G L Q  L
Sbjct: 86  LGNSNQLSSRDVKTK----------------TKKKQINDFIAFRSYYSRLLNGILTQTEL 129

Query: 160 SSLLSEAWHSDPEQQKKWTVLSQQFNFVKPKCGFVEWVGQTYEREMMW 207
           S+++S+ W  D + +K W +++Q++N       F  W+   Y  +  W
Sbjct: 130 STIISKHWTVDKQTRKNWELIAQEYNCDASGKHFFNWLEVNYGIDKQW 177

>Kwal_33.matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {OFF} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 132 SSKKSLNGFMAFRAYNSQFGYG-LKQEILSSLLSEAWHSDPEQQKKWTVLSQQFNFVKPK 190
           +SKK +N F+ FR+Y ++   G ++Q+ LS++LS+ W S  +  K W   ++ +N     
Sbjct: 93  TSKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTV 152

Query: 191 CGFVEWVGQTYEREM 205
             F EW+ + Y+ E+
Sbjct: 153 MCFTEWLEKNYKPEI 167

>Kwal_33.12992 s33 complement(31018..31752) [735 bp, 244 aa] {OFF}
           YCR040W (MATALPHA1) - transcription factor involved in
           the regulation of alpha-specific genes [contig 123] FULL
          Length = 244

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 132 SSKKSLNGFMAFRAYNSQFGYG-LKQEILSSLLSEAWHSDPEQQKKWTVLSQQFNFVKPK 190
           +SKK +N F+ FR+Y ++   G ++Q+ LS++LS+ W S  +  K W   ++ +N     
Sbjct: 93  TSKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTV 152

Query: 191 CGFVEWVGQTYEREM 205
             F EW+ + Y+ E+
Sbjct: 153 MCFTEWLEKNYKPEI 167

>Kwal_YGOB_matalpha1 s33 complement(283160..283894) [735 bp, 244 aa]
           {ON} (matalpha1) - mating type alpha1 protein [contig
           MAT] FULL
          Length = 244

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 132 SSKKSLNGFMAFRAYNSQFGYG-LKQEILSSLLSEAWHSDPEQQKKWTVLSQQFNFVKPK 190
           +SKK +N F+ FR+Y ++   G ++Q+ LS++LS+ W S  +  K W   ++ +N     
Sbjct: 93  TSKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTV 152

Query: 191 CGFVEWVGQTYEREM 205
             F EW+ + Y+ E+
Sbjct: 153 MCFTEWLEKNYKPEI 167

>Kwal_YGOB_HMalpha1 s33 complement(31018..31752) [735 bp, 244 aa]
           {ON} ANNOTATED BY YGOB - This is Kwal_33.12992
          Length = 244

 Score = 48.1 bits (113), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 44/75 (58%), Gaps = 1/75 (1%)

Query: 132 SSKKSLNGFMAFRAYNSQFGYG-LKQEILSSLLSEAWHSDPEQQKKWTVLSQQFNFVKPK 190
           +SKK +N F+ FR+Y ++   G ++Q+ LS++LS+ W S  +  K W   ++ +N     
Sbjct: 93  TSKKKINPFIGFRSYYARIVKGRIRQQELSTILSQYWLSHHQVHKTWEFFTEHYNRDNTV 152

Query: 191 CGFVEWVGQTYEREM 205
             F EW+ + Y+ E+
Sbjct: 153 MCFTEWLEKNYKPEI 167

>NDAI0A00100 Chr1 complement(783..1190) [408 bp, 135 aa] {ON}
           Anc_1.1  silent copy of MATalpha1 gene at HMLalpha
           possible pseudogene; contains 2 copies of a 20 bp direct
           repeat, causing a frameshft; synthetic translation made
           by ignoring one copy.
          Length = 135

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/61 (47%), Positives = 39/61 (63%)

Query: 135 KSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPEQQKKWTVLSQQFNFVKPKCGFV 194
           KS+NGFM FR+Y SQ+G GLKQ +LS LLS+ W++    Q  W   +QQ N +  + G  
Sbjct: 61  KSINGFMLFRSYYSQYGKGLKQSLLSPLLSKLWNAHETDQLLWDQFAQQCNAIGHEGGIC 120

Query: 195 E 195
           E
Sbjct: 121 E 121

>Kwal_33.13240 s33 complement(134062..134568) [507 bp, 168 aa] {OFF}
           [contig 119] FULL
          Length = 168

 Score = 33.5 bits (75), Expect = 0.19,   Method: Compositional matrix adjust.
 Identities = 15/47 (31%), Positives = 22/47 (46%), Gaps = 3/47 (6%)

Query: 161 SLLSEAWHSDPEQQKKW---TVLSQQFNFVKPKCGFVEWVGQTYERE 204
           +LL   WH  P Q ++     VL QQF  + P+C  +   G+   R 
Sbjct: 55  TLLRSPWHRLPRQVRQRLAAAVLKQQFVVIIPQCQIIRQAGRAVNRR 101

>Suva_3.140 Chr3 (212396..212488) [93 bp, 31 aa] {ON} YCR040W (REAL)
          Length = 31

 Score = 30.4 bits (67), Expect = 0.29,   Method: Composition-based stats.
 Identities = 11/20 (55%), Positives = 14/20 (70%)

Query: 182 QQFNFVKPKCGFVEWVGQTY 201
           QQ+NF+ P  GFVEW+   Y
Sbjct: 1   QQYNFINPGFGFVEWLTNNY 20

>Smik_3.144 Chr3 (198300..198334,198763..198892) [165 bp, 54 aa]
           {ON} YCR040W (REAL)
          Length = 54

 Score = 30.8 bits (68), Expect = 0.34,   Method: Compositional matrix adjust.
 Identities = 11/22 (50%), Positives = 14/22 (63%)

Query: 180 LSQQFNFVKPKCGFVEWVGQTY 201
             QQ+NF+ P  GFVEW+   Y
Sbjct: 15  FPQQYNFINPGFGFVEWLTNNY 36

>Smik_88.1 Chr88 complement(3..72,501..535) [105 bp, 35 aa] {ON}
           YCL066W (REAL)
          Length = 35

 Score = 29.3 bits (64), Expect = 0.80,   Method: Compositional matrix adjust.
 Identities = 10/18 (55%), Positives = 13/18 (72%)

Query: 180 LSQQFNFVKPKCGFVEWV 197
             QQ+NF+ P  GFVEW+
Sbjct: 15  FPQQYNFINPGFGFVEWL 32

>Skud_80.1 Chr80 complement(3..98) [96 bp, 32 aa] {ON} YCR040W
           (REAL)
          Length = 32

 Score = 28.1 bits (61), Expect = 1.8,   Method: Composition-based stats.
 Identities = 10/16 (62%), Positives = 13/16 (81%)

Query: 182 QQFNFVKPKCGFVEWV 197
           QQ+NF+ P  GFVEW+
Sbjct: 14  QQYNFINPGFGFVEWL 29

>Suva_3.79 Chr3 (114117..114221) [105 bp, 35 aa] {ON} YCR040W (REAL)
          Length = 35

 Score = 28.1 bits (61), Expect = 2.2,   Method: Composition-based stats.
 Identities = 10/17 (58%), Positives = 14/17 (82%)

Query: 181 SQQFNFVKPKCGFVEWV 197
           +QQ+NF+ P  GFVEW+
Sbjct: 16  AQQYNFINPGFGFVEWL 32

>TDEL0B07060 Chr2 complement(1243893..1246289) [2397 bp, 798 aa]
           {ON} Anc_2.613 YMR049C
          Length = 798

 Score = 30.4 bits (67), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 45/97 (46%), Gaps = 7/97 (7%)

Query: 110 SDTETEYDLLSTSPNSVIEVDTSSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAW-H 168
           S  + +YDL   S  S   V T     L       +YN    Y     ++S    EAW +
Sbjct: 299 SAADYKYDLWGDSNESTDHVMTLRAPKLPPPTNDESYNPPAEY-----LMSPEEKEAWNN 353

Query: 169 SDPEQQKKWTVLSQQFNFVKPKCGFVEWVGQTYEREM 205
           +DPE ++K   + Q+++ ++   G+ E V + +ER +
Sbjct: 354 ADPEDREK-NFVPQKYSALRKVPGYTEAVRERFERSL 389

>TBLA0A10190 Chr1 complement(2515833..2518256) [2424 bp, 807 aa]
           {ON} Anc_2.613 YMR049C
          Length = 807

 Score = 30.0 bits (66), Expect = 4.7,   Method: Compositional matrix adjust.
 Identities = 22/93 (23%), Positives = 39/93 (41%), Gaps = 5/93 (5%)

Query: 113 ETEYDLLSTSPNSVIEVDTSSKKSLNGFMAFRAYNSQFGYGLKQEILSSLLSEAWHSDPE 172
           E +YDL   +P     V T     L       +YN    Y     +LS    E W +   
Sbjct: 309 EFQYDLWGDAPEMEDHVMTLRAPKLPPPTNDESYNPPEEY-----LLSPEEKEDWENTEH 363

Query: 173 QQKKWTVLSQQFNFVKPKCGFVEWVGQTYEREM 205
            +++   + Q++N ++   G+ E V + +ER +
Sbjct: 364 SERERNFVPQKYNALRKVPGYTESVRERFERSL 396

>KLLA0B07667g Chr2 (667863..673862) [6000 bp, 1999 aa] {ON} some
            similarities with uniprot|P25356 Saccharomyces cerevisiae
            YCR032W BPH1
          Length = 1999

 Score = 29.6 bits (65), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 21/92 (22%), Positives = 44/92 (47%), Gaps = 2/92 (2%)

Query: 93   TNILNFSSSWDEDDLFLSDTETEYDLLST-SPNSVIEVDTSSKKSLNGFMAFRAYNSQFG 151
            T+IL F    DE D  + D+ + Y L    + N   ++    ++ LN ++A   Y  + G
Sbjct: 1085 THIL-FKERTDEYDRSIIDSNSIYALFKKDNVNLTKKMVLIEERRLNDYLADDRYQKEAG 1143

Query: 152  YGLKQEILSSLLSEAWHSDPEQQKKWTVLSQQ 183
            Y     ++  + S A+  D +  ++W + +++
Sbjct: 1144 YACALRVIRKVASTAYLRDFKSTREWYLAARE 1175

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.129    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 19,963,203
Number of extensions: 742000
Number of successful extensions: 2582
Number of sequences better than 10.0: 46
Number of HSP's gapped: 2595
Number of HSP's successfully gapped: 46
Length of query: 209
Length of database: 53,481,399
Length adjustment: 105
Effective length of query: 104
Effective length of database: 41,441,469
Effective search space: 4309912776
Effective search space used: 4309912776
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 63 (28.9 bits)