Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_2002.131.10ON1641644234e-53
KNAG0C002701.10ON174461513e-12
KAFR0D001901.10ON185461341e-09
NCAS0B090601.10ON167441224e-08
TDEL0C069301.10ON184381201e-07
ZYRO0F18370g1.10ON220381211e-07
NDAI0A001901.10ON171431172e-07
TBLA0A049701.10ON181361084e-06
KLLA0C00594g1.10ON194371015e-05
Kwal_33.130231.10ON19342962e-04
SAKL0C00572g1.10ON33839973e-04
TPHA0E039601.10ON17743900.001
KLTH0F00572g1.10ON19542750.15
NOTE: 5 genes in the same pillar as Kpol_2002.13 were not hit in these BLAST results
LIST: Skud_3.8 Smik_3.19 YCL056C Suva_3.157 Ecym_1012

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_2002.13
         (164 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON...   167   4e-53
KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON} ...    63   3e-12
KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON} ...    56   1e-09
NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON} Anc_1....    52   4e-08
TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON} Anc_1....    51   1e-07
ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON} conse...    51   1e-07
NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON} ...    50   2e-07
TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa] {...    46   4e-06
KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}...    44   5e-05
Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}...    42   2e-04
SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON...    42   3e-04
TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10...    39   0.001
KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}...    33   0.15 

>Kpol_2002.13 s2002 complement(23954..24448) [495 bp, 164 aa] {ON}
           complement(23954..24448) [495 nt, 165 aa]
          Length = 164

 Score =  167 bits (423), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 97/164 (59%), Positives = 97/164 (59%)

Query: 1   MASLGWEDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKIIQNNFSXXXXXXXXXXX 60
           MASLGWEDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKIIQNNFS           
Sbjct: 1   MASLGWEDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKIIQNNFSLKLWLATLLLI 60

Query: 61  XXXXXXXXFQNYKILRFLKIELKQXXXXXXXXXXXXXXXSILLEKLNKKINQHYNFIKXX 120
                   FQNYKILRFLKIELKQ               SILLEKLNKKINQHYNFIK  
Sbjct: 61  IKKLVVKLFQNYKILRFLKIELKQHINNNNNNNKNNHINSILLEKLNKKINQHYNFIKLN 120

Query: 121 XXXXXXXXXYCAXXXXXXXXXXXXXXXXXXXXXXANSITIVKHI 164
                    YCA                      ANSITIVKHI
Sbjct: 121 LLDLIQNLLYCAIVIIELLKLKISKKSKFILELLANSITIVKHI 164

>KNAG0C00270 Chr3 complement(41823..42347) [525 bp, 174 aa] {ON}
          Anc_1.10 YCL056C
          Length = 174

 Score = 62.8 bits (151), Expect = 3e-12,   Method: Compositional matrix adjust.
 Identities = 27/46 (58%), Positives = 38/46 (82%)

Query: 2  ASLGWEDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKIIQNN 47
          ASL WED++L  LE ICS+FD+IY +K+LGII+ ++FLYRK+ + N
Sbjct: 5  ASLSWEDVLLGKLESICSIFDNIYLLKSLGIISKENFLYRKLNKGN 50

>KAFR0D00190 Chr4 complement(21149..21706) [558 bp, 185 aa] {ON}
          Anc_1.10 YCL056C
          Length = 185

 Score = 56.2 bits (134), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 23/46 (50%), Positives = 37/46 (80%)

Query: 3  SLGWEDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKIIQNNF 48
          S+  EDI++D LEGIC++FD+IYF+K LG+I + +F+Y+K+ + N 
Sbjct: 16 SITLEDILIDKLEGICTVFDNIYFLKNLGVIKEDNFIYKKLNKGNL 61

>NCAS0B09060 Chr2 (1741161..1741664) [504 bp, 167 aa] {ON}
          Anc_1.10 YCL056C
          Length = 167

 Score = 51.6 bits (122), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 20/44 (45%), Positives = 35/44 (79%)

Query: 5  GWEDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKIIQNNF 48
          G ED VL+ LE IC++FD++YF K++G++++K+ LYR + + +F
Sbjct: 3  GLEDNVLNALESICNIFDNVYFFKSIGVLSEKNILYRTLNKGDF 46

>TDEL0C06930 Chr3 (1260938..1261492) [555 bp, 184 aa] {ON}
          Anc_1.10 YCL056C
          Length = 184

 Score = 50.8 bits (120), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 31/38 (81%)

Query: 6  WEDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKI 43
          +ED ++ GLE +CS FD++YF K+LGII + +FLYR++
Sbjct: 22 FEDNLIAGLESVCSFFDNVYFAKSLGIIGENNFLYRRL 59

>ZYRO0F18370g Chr6 (1518178..1518840) [663 bp, 220 aa] {ON}
          conserved hypothetical protein
          Length = 220

 Score = 51.2 bits (121), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 20/38 (52%), Positives = 31/38 (81%)

Query: 6  WEDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKI 43
          +ED ++ GLE IC LFD++Y +KTLGII++ + LYR++
Sbjct: 57 FEDTLIAGLESICGLFDNVYLLKTLGIISEDNLLYRRL 94

>NDAI0A00190 Chr1 complement(17031..17546) [516 bp, 171 aa] {ON}
          Anc_1.10 YCL056C
          Length = 171

 Score = 49.7 bits (117), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 20/43 (46%), Positives = 33/43 (76%)

Query: 7  EDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKIIQNNFS 49
          ED ++ GLE IC++FD++Y +K+LGII++ + LYR + + NF 
Sbjct: 6  EDSIIGGLEYICNIFDNVYLLKSLGIISENNLLYRNLNKGNFG 48

>TBLA0A04970 Chr1 complement(1220824..1221369) [546 bp, 181 aa]
          {ON} Anc_1.10 YCL056C
          Length = 181

 Score = 46.2 bits (108), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 18/36 (50%), Positives = 29/36 (80%)

Query: 6  WEDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYR 41
          W+  +L GLE ICS+FD+IYF++++G+I+D +  YR
Sbjct: 9  WKFDILYGLESICSVFDNIYFLRSIGLISDTNLFYR 44

>KLLA0C00594g Chr3 complement(44220..44804) [585 bp, 194 aa] {ON}
          conserved hypothetical protein
          Length = 194

 Score = 43.5 bits (101), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 28/37 (75%)

Query: 7  EDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKI 43
          ED+++D L  + S FD +Y +++ GII+D +FLY+K+
Sbjct: 34 EDLLIDSLTSVSSFFDDLYLLRSFGIISDTNFLYQKL 70

>Kwal_33.13023 s33 complement(43697..44278) [582 bp, 193 aa] {ON}
          [contig 123] FULL
          Length = 193

 Score = 41.6 bits (96), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 30/42 (71%)

Query: 7  EDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKIIQNNF 48
          E+  + G+E +  LFD I+ +K+ GII++ +++YRK+ ++ F
Sbjct: 34 ENFCISGMESVAGLFDDIHLLKSFGIISESNYVYRKLNKSGF 75

>SAKL0C00572g Chr3 complement(51031..52047) [1017 bp, 338 aa] {ON}
           conserved hypothetical protein
          Length = 338

 Score = 42.0 bits (97), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 16/39 (41%), Positives = 28/39 (71%)

Query: 5   GWEDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKI 43
            +EDI++ GLE + ++FD +Y +K  GII + +F+YR +
Sbjct: 175 SFEDILIGGLESLTNVFDDVYLLKNFGIIGETNFVYRHL 213

>TPHA0E03960 Chr5 (833382..833915) [534 bp, 177 aa] {ON} Anc_1.10
          YCL056C
          Length = 177

 Score = 39.3 bits (90), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 15/43 (34%), Positives = 31/43 (72%)

Query: 5  GWEDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKIIQNN 47
          G+E  +L+ LE I ++FD ++F+++ G+I + +F YR + ++N
Sbjct: 16 GFESTLLNYLESITNIFDLVFFLRSTGLIKENNFFYRNLNRSN 58

>KLTH0F00572g Chr6 complement(42946..43533) [588 bp, 195 aa] {ON}
          conserved hypothetical protein
          Length = 195

 Score = 33.5 bits (75), Expect = 0.15,   Method: Compositional matrix adjust.
 Identities = 12/42 (28%), Positives = 26/42 (61%)

Query: 7  EDIVLDGLEGICSLFDSIYFIKTLGIITDKSFLYRKIIQNNF 48
          E  ++ GLE I  +FD +  +++ G+I + +  Y+K+ ++ F
Sbjct: 34 ESALVSGLETIAGIFDDLQLLRSFGVIGENNVFYQKLNKSGF 75

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.328    0.144    0.419 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,588,687
Number of extensions: 246581
Number of successful extensions: 466
Number of sequences better than 10.0: 13
Number of HSP's gapped: 466
Number of HSP's successfully gapped: 13
Length of query: 164
Length of database: 53,481,399
Length adjustment: 101
Effective length of query: 63
Effective length of database: 41,900,133
Effective search space: 2639708379
Effective search space used: 2639708379
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.7 bits)
S2: 61 (28.1 bits)