Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_2002.121.9ON73973937220.0
TPHA0E039701.9ON74773426530.0
ZYRO0F18392g1.9ON72571626280.0
NCAS0B090701.9ON73071626060.0
TBLA0A075601.9ON74168425900.0
SAKL0C00550g1.9ON73272425630.0
KAFR0D001801.9ON72372525590.0
KNAG0C002601.9ON74468724950.0
KLLA0C00572g1.9ON71271024530.0
NDAI0A001801.9ON74069524530.0
YCL057W (PRD1)1.9ON71270923080.0
CAGL0B00418g1.9ON74370023060.0
Skud_3.71.9ON71270922880.0
Suva_3.1561.9ON71270822860.0
Smik_3.181.9ON71270922530.0
Ecym_1011na 1ON71671621050.0
AGR406C1.9ON68368817930.0
AGR405Cna 1ON71768416940.0
ABR185WsingletonON4574169751e-124
KAFR0D029502.432ON7776764257e-43
NDAI0E020102.432ON7786834257e-43
SAKL0E03938g2.432ON7676804212e-42
KNAG0A062002.432ON7895564204e-42
TBLA0I007102.432ON7736473973e-39
ZYRO0G20130g2.432ON7866793955e-39
CAGL0D02112g2.432ON7615573955e-39
Skud_11.932.432ON7726763893e-38
Ecym_60992.432ON7736933803e-37
NCAS0A042802.432ON7735703804e-37
AFR198W2.432ON7767043796e-37
Kpol_297.82.432ON7876813752e-36
Kwal_26.76162.432ON7705503742e-36
Smik_11.1022.432ON7725513723e-36
Suva_11.912.432ON7755513724e-36
KLTH0D04730g2.432ON7725623715e-36
YKL134C (OCT1)2.432ON7726773681e-35
TPHA0G023902.432ON7956783592e-34
KLLA0B12397g2.432ON7795623458e-33
TDEL0A020802.432ON7875533422e-32
TPHA0L016608.539ON547157820.35
NCAS0G010206.291ON405102780.97
TBLA0H035908.539ON60078743.1
KAFR0J006505.191ON1832137725.1
TPHA0H012405.59ON87739725.4
KAFR0L005807.151ON49888708.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_2002.12
         (739 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON} (21544....  1438   0.0  
TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {O...  1026   0.0  
ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]...  1016   0.0  
NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa] ...  1008   0.0  
TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa] ...  1002   0.0  
SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly s...   991   0.0  
KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9 Y...   990   0.0  
KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9 Y...   965   0.0  
KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar ...   949   0.0  
NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9        949   0.0  
YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc met...   893   0.0  
CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar ...   892   0.0  
Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)    885   0.0  
Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W ...   885   0.0  
Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)   872   0.0  
Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to ...   815   0.0  
AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}...   695   0.0  
AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}...   657   0.0  
ABR185W Chr2 (758126..758380,758380..758709,758709..759029,75903...   380   e-124
KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {O...   168   7e-43
NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {O...   168   7e-43
SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} simila...   166   2e-42
KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {O...   166   4e-42
TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.4...   157   3e-39
ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} simi...   156   5e-39
CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {...   156   5e-39
Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {O...   154   3e-38
Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}...   150   3e-37
NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {O...   150   4e-37
AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic ho...   150   6e-37
Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON} ...   149   2e-36
Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C...   148   2e-36
Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {...   147   3e-36
Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {O...   147   4e-36
KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} simila...   147   5e-36
YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON} ...   146   1e-35
TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {O...   142   2e-34
KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]...   137   8e-33
TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {O...   136   2e-32
TPHA0L01660 Chr12 complement(348715..350358) [1644 bp, 547 aa] {...    36   0.35 
NCAS0G01020 Chr7 (176788..178005) [1218 bp, 405 aa] {ON} Anc_6.2...    35   0.97 
TBLA0H03590 Chr8 complement(874695..876497) [1803 bp, 600 aa] {O...    33   3.1  
KAFR0J00650 Chr10 (112487..117985) [5499 bp, 1832 aa] {ON} Anc_5...    32   5.1  
TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.5...    32   5.4  
KAFR0L00580 Chr12 complement(106812..108308) [1497 bp, 498 aa] {...    32   8.9  

>Kpol_2002.12 s2002 (21544..23763) [2220 bp, 739 aa] {ON}
           (21544..23763) [2220 nt, 740 aa]
          Length = 739

 Score = 1438 bits (3722), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 702/739 (94%), Positives = 702/739 (94%)

Query: 1   MFKAITTGLRXXXXXXXXXXXGKTLKNRKTRIVSFFAVPAIAFTILKYSTMTNSSLLIAP 60
           MFKAITTGLR           GKTLKNRKTRIVSFFAVPAIAFTILKYSTMTNSSLLIAP
Sbjct: 1   MFKAITTGLRNSNKNSNSIISGKTLKNRKTRIVSFFAVPAIAFTILKYSTMTNSSLLIAP 60

Query: 61  QPAPTWNWTPEGIVKDAESLIKDSNRIFDNLAAISSPTVENFIVPYMNHENKVSPLINQL 120
           QPAPTWNWTPEGIVKDAESLIKDSNRIFDNLAAISSPTVENFIVPYMNHENKVSPLINQL
Sbjct: 61  QPAPTWNWTPEGIVKDAESLIKDSNRIFDNLAAISSPTVENFIVPYMNHENKVSPLINQL 120

Query: 121 TFLQHVSADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNEKSDSK 180
           TFLQHVSADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNEKSDSK
Sbjct: 121 TFLQHVSADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNEKSDSK 180

Query: 181 NYESYRFIEKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKEFIAFTKE 240
           NYESYRFIEKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKEFIAFTKE
Sbjct: 181 NYESYRFIEKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKEFIAFTKE 240

Query: 241 ELDGVSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVP 300
           ELDGVSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVP
Sbjct: 241 ELDGVSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVP 300

Query: 301 ENEALFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXXXXX 360
           ENEALFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRP      
Sbjct: 301 ENEALFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPLGLKEI 360

Query: 361 XXXXXXXXXDMKELNLPYDNHYYIWDHRYYDNKYLKDNFNVDLEKISEYYPIESSIDGML 420
                    DMKELNLPYDNHYYIWDHRYYDNKYLKDNFNVDLEKISEYYPIESSIDGML
Sbjct: 361 EILKQLKEKDMKELNLPYDNHYYIWDHRYYDNKYLKDNFNVDLEKISEYYPIESSIDGML 420

Query: 421 KIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGH 480
           KIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGH
Sbjct: 421 KIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGH 480

Query: 481 AANFGISSSYVDENDKRSYPVTALVCNFSKPTSDKPSLLKHNELTTFFHELGHGIHDLVG 540
           AANFGISSSYVDENDKRSYPVTALVCNFSKPTSDKPSLLKHNELTTFFHELGHGIHDLVG
Sbjct: 481 AANFGISSSYVDENDKRSYPVTALVCNFSKPTSDKPSLLKHNELTTFFHELGHGIHDLVG 540

Query: 541 ANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKHYKTGEKIPESLIESLVSTK 600
           ANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKHYKTGEKIPESLIESLVSTK
Sbjct: 541 ANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKHYKTGEKIPESLIESLVSTK 600

Query: 601 HVNGALFALRQLHFSTFDMEVHTAEDVSKLNLLELWNGLREQICLVENGDEMSKGYDSFG 660
           HVNGALFALRQLHFSTFDMEVHTAEDVSKLNLLELWNGLREQICLVENGDEMSKGYDSFG
Sbjct: 601 HVNGALFALRQLHFSTFDMEVHTAEDVSKLNLLELWNGLREQICLVENGDEMSKGYDSFG 660

Query: 661 HIMXXXXXXXXXXXMWAEVFATDMYYTKFAADPLNSKSGVEYRDIILSRGGIYEVNDNLE 720
           HIM           MWAEVFATDMYYTKFAADPLNSKSGVEYRDIILSRGGIYEVNDNLE
Sbjct: 661 HIMSGAYSAGYYGYMWAEVFATDMYYTKFAADPLNSKSGVEYRDIILSRGGIYEVNDNLE 720

Query: 721 EFLGREPNNSAFLKEMGLN 739
           EFLGREPNNSAFLKEMGLN
Sbjct: 721 EFLGREPNNSAFLKEMGLN 739

>TPHA0E03970 Chr5 complement(834023..836266) [2244 bp, 747 aa] {ON}
           Anc_1.9 YCL057W
          Length = 747

 Score = 1026 bits (2653), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 489/734 (66%), Positives = 595/734 (81%), Gaps = 18/734 (2%)

Query: 22  GKTLKNRKTRIVSFFAVPAIAFTI-------LKYSTMT----NSSLLIAPQPAPTWNWTP 70
           GK+ KN K+ ++S  A+PA+A  I       L++ T +    N +  IAPQ +P W+++P
Sbjct: 14  GKSFKN-KSILLSLVAIPAVAIGIYHQNNQGLRFYTASQVKMNEAAFIAPQLSPKWDFSP 72

Query: 71  EGIVKDAESLIKDSNRIFDNLAAISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADK 130
           E I+ DA+ +I  SN  ++ + AI +P++ENF++P +N EN+ S  INQLTFLQHVS DK
Sbjct: 73  ERILSDAKKIIDTSNDFYNAMVAIENPSIENFVIPSINFENENSLAINQLTFLQHVSKDK 132

Query: 131 DIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNE--KSDSKNYESYRFI 188
            IRD+S++ATELI NF+IE SLR D+F QFDKI+ D+KDN ++N+   +  K+YE ++++
Sbjct: 133 LIRDASLEATELITNFDIEISLRYDMFKQFDKIFNDLKDNKKYNDLKTATPKDYEIFKYV 192

Query: 189 EKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDA 248
           EKCHKD++RSGLNLS+EKR  +K+I+K+IA NSL FSKNLGEQ EF+AFTKEEL+GVSD 
Sbjct: 193 EKCHKDYVRSGLNLSEEKRNEIKEIKKRIALNSLQFSKNLGEQNEFVAFTKEELEGVSDD 252

Query: 249 VMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVD 308
           VM+QFE + DE+TGE+KFKVTFKYPDI PVLK+AKNPNTRK+AFNADQNKVPENE LF+D
Sbjct: 253 VMKQFETYTDEQTGEQKFKVTFKYPDIFPVLKTAKNPNTRKIAFNADQNKVPENEKLFID 312

Query: 309 TLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXXXXXXX 368
           TLKLR  L  +L Y  YANYNL++KMAKN+ETV  FL DLK KL+P              
Sbjct: 313 TLKLRYQLGKILGYDTYANYNLDIKMAKNQETVMEFLVDLKDKLKPLAEKEIEVLKAIKK 372

Query: 369 XDMKELNLPYDNHYYIWDHRYYDNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMK 428
            + +ELN+ YD+HYYIWDHRYYDNKYLKD FNVDLEKISEYYP+ES+I GMLKIYETVM 
Sbjct: 373 TEAQELNMAYDDHYYIWDHRYYDNKYLKDKFNVDLEKISEYYPVESTIQGMLKIYETVMN 432

Query: 429 LKFVEETDPAKRNVWH-EDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGIS 487
           LKF+EETD   ++ W  +DVKQL+VWKMD+P  PEF+GWIYFDLHPR+GKYGHAANFG++
Sbjct: 433 LKFIEETDKDLKSTWAGDDVKQLAVWKMDDPSKPEFVGWIYFDLHPREGKYGHAANFGMA 492

Query: 488 SSYVDENDKRSYPVTALVCNFSKPTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRL 547
            SY+D++ KR YPVTALVCNFS  T+DKP+LLKHNE+TTFFHELGHGIHDLVG N   R 
Sbjct: 493 PSYIDKDSKRIYPVTALVCNFSAATADKPALLKHNEITTFFHELGHGIHDLVGNNGIGRF 552

Query: 548 NGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALF 607
           NGPG+VPWDFVEAPSQMLEFWTWNKNEL+SLSKHYKTGEKIPESL+ESL++TKHVNGALF
Sbjct: 553 NGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPESLLESLIATKHVNGALF 612

Query: 608 ALRQLHFSTFDMEVHTAED---VSKLNLLELWNGLREQICLVENGDEMSKGYDSFGHIMX 664
           ALRQLHF  FDM+VHT  D   +  ++L++LWNGLRE+I LVENGDEM+KGYDSFGHIM 
Sbjct: 613 ALRQLHFGLFDMKVHTTTDDNQIDNMDLVQLWNGLREEISLVENGDEMNKGYDSFGHIMS 672

Query: 665 XXXXXXXXXXMWAEVFATDMYYTKFAADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLG 724
                     MWAEVFATDMYY+KFA DPLN+KSG+EYRDIIL+RGGI E NDNL+EFLG
Sbjct: 673 DSYSAGYYGYMWAEVFATDMYYSKFAKDPLNTKSGIEYRDIILARGGIRETNDNLKEFLG 732

Query: 725 REPNNSAFLKEMGL 738
           REP+  AFLKE+GL
Sbjct: 733 REPSKEAFLKELGL 746

>ZYRO0F18392g Chr6 complement(1518902..1521079) [2178 bp, 725 aa]
           {ON} similar to uniprot|P25375 Saccharomyces cerevisiae
           YCL057W PRD1 Zinc metalloendopeptidase found in the
           cytoplasm and intermembrane space of mitochondria
          Length = 725

 Score = 1016 bits (2628), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 475/716 (66%), Positives = 583/716 (81%), Gaps = 9/716 (1%)

Query: 29  KTRIVSFFAVPAIAFTI-----LKYSTMTNSSLLIAPQPAPTWNWTPEGIVKDAESLIKD 83
           +  I S  AVPA+A  I      +YSTM++ +L IAPQ AP+W +TP+ ++ +   LI+ 
Sbjct: 14  RKSIFSVVAVPALAIGIYRVSKFQYSTMSSPNLFIAPQSAPSWAFTPQSLLDETHRLIES 73

Query: 84  SNRIFDNLAAISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADKDIRDSSMKATELI 143
           S + +D+LA +S+PTVEN + PYM+HEN V  + +QLTF Q VSADK+IRD+S++ATE +
Sbjct: 74  SKQFYDSLAQLSNPTVENLVKPYMHHENGVGLIESQLTFPQQVSADKEIRDASVQATEFL 133

Query: 144 QNFEIEASLRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRFIEKCHKDFIRSGLNLS 203
           QNF IE SLR DLF+QFDKIW ++KD S    +  S+ YE Y+++EK H+D+ R GL L 
Sbjct: 134 QNFGIEQSLRHDLFLQFDKIWNELKDKSF---EQGSQEYEIYKYVEKIHRDYTRDGLQLP 190

Query: 204 DEKREIVKDIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEKFKDEKTGE 263
           ++KR+ VK ++ KIA+NSL FSKNLGEQKEF+AFTKEELDGVS++VM+QFE+FKDE  G 
Sbjct: 191 EDKRDKVKQLKIKIAANSLEFSKNLGEQKEFVAFTKEELDGVSESVMDQFEQFKDE-NGT 249

Query: 264 EKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDTLKLRNDLSTVLDYS 323
            K+KVTFKYPDI PVLK+AKNP TRKLAF  DQ+KVP+NE LFV+TL+LRN+L+ +L YS
Sbjct: 250 TKYKVTFKYPDIFPVLKTAKNPKTRKLAFARDQDKVPQNEKLFVETLQLRNELADILGYS 309

Query: 324 NYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXXXXXXXXDMKELNLPYDNHYY 383
            YANYNLE+KMAKN++ V+ FL++LK KL+P               + + L LPYD HYY
Sbjct: 310 TYANYNLELKMAKNQDNVWKFLNELKDKLKPLGLKEAENLKQIKQKECESLGLPYDGHYY 369

Query: 384 IWDHRYYDNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEETDPAKRNVW 443
           +WDHRYYDNKYLKDN+NVDLEKISEYYPIES+I GML IYET++KLKFVEETDP KR+VW
Sbjct: 370 VWDHRYYDNKYLKDNYNVDLEKISEYYPIESTISGMLSIYETLLKLKFVEETDPEKRSVW 429

Query: 444 HEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSSYVDENDKRSYPVTA 503
           HEDVKQL+VWKMDNP  PEF+GWIYFDLHPRDGKYGHAANFGIS+SYV E+  RSYPVTA
Sbjct: 430 HEDVKQLAVWKMDNPSKPEFVGWIYFDLHPRDGKYGHAANFGISASYVKEDGTRSYPVTA 489

Query: 504 LVCNFSKPTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQ 563
           LVCNFSKP++ KPSLLKHNE++TFFHELGHGIHDLVG NR +  NGPG+VPWDFVEAPSQ
Sbjct: 490 LVCNFSKPSAKKPSLLKHNEISTFFHELGHGIHDLVGENRLTTFNGPGAVPWDFVEAPSQ 549

Query: 564 MLEFWTWNKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVHT 623
           MLEFWTWN+ EL  LS HY++GEKIP+ L++SL+STKHV+GALFALRQLHF  FDM VHT
Sbjct: 550 MLEFWTWNERELHELSSHYESGEKIPKDLLQSLISTKHVDGALFALRQLHFGLFDMYVHT 609

Query: 624 AEDVSKLNLLELWNGLREQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATD 683
           +++V+KL+LL+LWN LRE++ LVENGD  +KGYDSFGHIM           MWAEVFA D
Sbjct: 610 SKNVAKLDLLKLWNELREEVSLVENGDTFTKGYDSFGHIMSDSYSAGYYGYMWAEVFAAD 669

Query: 684 MYYTKFAADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLKEMGLN 739
           MY+T+FAADPL+SK+GV+YRDI+L RGG+YE NDNL EFLGREP+  AFLKE+GLN
Sbjct: 670 MYHTRFAADPLDSKAGVQYRDIVLGRGGLYETNDNLREFLGREPSEEAFLKELGLN 725

>NCAS0B09070 Chr2 complement(1741718..1743910) [2193 bp, 730 aa]
           {ON} Anc_1.9
          Length = 730

 Score = 1008 bits (2606), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/716 (66%), Positives = 589/716 (82%), Gaps = 9/716 (1%)

Query: 29  KTRIVSFFAVPAIAFTILK---YSTM-TNSSLLIAPQ-PAPTWNWTPEGIVKDAESLIKD 83
           K  ++S   +PA AF + +   Y T+ TN+ LL+AP   APTW W+PE I+   + +I +
Sbjct: 18  KKLLISAIVLPATAFILTRKSFYMTLPTNNKLLVAPTGTAPTWKWSPESILAKTKEVIDN 77

Query: 84  SNRIFDNLAAISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADKDIRDSSMKATELI 143
           +  ++D+LAAI  P+VE+ + PYM++EN    ++NQLTFLQHVSADK IRD+S++ATEL+
Sbjct: 78  ATNLYDSLAAIEEPSVESLVKPYMHYENDEGLIVNQLTFLQHVSADKLIRDASVEATELL 137

Query: 144 QNFEIEASLRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRFIEKCHKDFIRSGLNLS 203
           Q+F IEAS+R DLF QFDKIW  VKD+        SK++E+Y+FIEK HKD++R+GLNL 
Sbjct: 138 QDFSIEASMRLDLFQQFDKIWNQVKDDD----DLKSKDFETYKFIEKVHKDYVRNGLNLP 193

Query: 204 DEKREIVKDIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEKFKDEKTGE 263
           +EKR  VKDI+KKIASNSLN+SKNLGEQKE+++FTKE+L GVS++VMEQFEKF D KT E
Sbjct: 194 EEKRNQVKDIKKKIASNSLNYSKNLGEQKEYVSFTKEQLKGVSESVMEQFEKFVDPKTNE 253

Query: 264 EKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDTLKLRNDLSTVLDYS 323
           EK+KVTFKYPDI PVLK+A+ P TRKLA+ +DQNKVP+NEALFV+TLKLRN L+ +L YS
Sbjct: 254 EKYKVTFKYPDIFPVLKTAQVPKTRKLAYISDQNKVPQNEALFVETLKLRNQLAQLLGYS 313

Query: 324 NYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXXXXXXXXDMKELNLPYDNHYY 383
            YANYNL++KMAKN+ETVF+F+++LK KL+P               D +EL L YD+HYY
Sbjct: 314 TYANYNLDIKMAKNQETVFDFVNNLKDKLKPLGQKEIETLKTLKKKDCEELGLAYDDHYY 373

Query: 384 IWDHRYYDNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEETDPAKRNVW 443
           IWDHRYYDNK+LKDN+NVDLE+ISEYYP+ES+I GML IYET++KLKFV+ET+P  ++VW
Sbjct: 374 IWDHRYYDNKFLKDNYNVDLEQISEYYPLESTIKGMLGIYETLLKLKFVDETNPKIKDVW 433

Query: 444 HEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSSYVDENDKRSYPVTA 503
           HEDVKQL+VWKMD+   PEFIGWIYFDLHPRDGKY HAANFGISSSY+ ++  RS+PVTA
Sbjct: 434 HEDVKQLAVWKMDDEKNPEFIGWIYFDLHPRDGKYSHAANFGISSSYITQDGDRSFPVTA 493

Query: 504 LVCNFSKPTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQ 563
           LVCNFSK T  KPSLLKHNE+TTFFHELGHGIHDLVG N+C+R NGPG+ PWDFVEAPSQ
Sbjct: 494 LVCNFSKSTDKKPSLLKHNEITTFFHELGHGIHDLVGKNKCARFNGPGATPWDFVEAPSQ 553

Query: 564 MLEFWTWNKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVHT 623
           MLEFWTWNKNEL+SLS HY+TGEKI E L++SL++TKHVNGALFALRQLHF  FDM VHT
Sbjct: 554 MLEFWTWNKNELLSLSGHYQTGEKISEDLLDSLIATKHVNGALFALRQLHFGLFDMTVHT 613

Query: 624 AEDVSKLNLLELWNGLREQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATD 683
            ++V  LNLL+LWN LRE+ICLVENG+E++KGYDSFGHIM           MWAEVFA D
Sbjct: 614 TKNVEDLNLLKLWNELREKICLVENGNELTKGYDSFGHIMSDSYSAGYYGYMWAEVFAAD 673

Query: 684 MYYTKFAADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLKEMGLN 739
           MYYTKFA+DPLNS++GV+YRDI+L+ GG+YE+ D L+EFLGREP N AFLKE+GL+
Sbjct: 674 MYYTKFASDPLNSQAGVQYRDIVLANGGLYEIADKLKEFLGREPTNDAFLKELGLH 729

>TBLA0A07560 Chr1 complement(1871629..1873854) [2226 bp, 741 aa]
           {ON} Anc_1.9 YCL057W
          Length = 741

 Score = 1002 bits (2590), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 478/684 (69%), Positives = 567/684 (82%), Gaps = 2/684 (0%)

Query: 57  LIAPQPAPTWNWTPEGIVKDAESLIKDSNRIFDNLAAISSPTVENFIVPYMNHENKVSPL 116
           L APQ APTWNWTP  +VKDAE LI  SN  +D L  + SP   NF+VPYMN+ENKV  L
Sbjct: 59  LNAPQAAPTWNWTPSQLVKDAEDLIDQSNHFYDALTNLKSPDFNNFLVPYMNYENKVGSL 118

Query: 117 INQLTFLQHVSADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNEK 176
           INQLTFLQHVS++KDIRD+S KAT+L+QNFEIE SLR  LF+QFDKIW  +KD+ +  EK
Sbjct: 119 INQLTFLQHVSSEKDIRDASFKATDLLQNFEIETSLRYGLFLQFDKIWNQIKDSKDKYEK 178

Query: 177 SDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKEFIA 236
            D K+ E+Y F+ K H+DF+R+GLNL + KRE +K+I+K IA+NSL F+ NLGEQ EF+A
Sbjct: 179 -DPKDLENYEFVRKVHRDFVRAGLNLDESKREKIKEIKKAIANNSLKFATNLGEQTEFVA 237

Query: 237 FTKEELDGVSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQ 296
           FTKEELDGVSD+VMEQFEKF DEKTG+E +KVTFKYPDI PVLK+A+NP TRK AF  DQ
Sbjct: 238 FTKEELDGVSDSVMEQFEKFNDEKTGKEMYKVTFKYPDIFPVLKTARNPETRKKAFAGDQ 297

Query: 297 NKVPENEALFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPXX 356
           NKV EN  LF +TLKLRN L+ +L YS YANYNLE+KMAK +++VF FL+DL  +L+P  
Sbjct: 298 NKVSENTVLFTNTLKLRNQLADILGYSTYANYNLELKMAKAQDSVFKFLEDLIDRLKPLG 357

Query: 357 XXXXXXXXXXXXXDMKELNLPYDNHYYIWDHRYYDNKYLKDNFNVDLEKISEYYPIESSI 416
                        + KELNLP+DNHYY+WDHRYYDNKYLKDN+NVDLEKISEYYP++S+I
Sbjct: 358 SKEIEILKSIKEKEFKELNLPFDNHYYVWDHRYYDNKYLKDNYNVDLEKISEYYPLDSTI 417

Query: 417 DGMLKIYETVMKLKFVEETDPAK-RNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRD 475
           +GML IYET++ LKF+EE D +K +NVWH++VKQL+VWKMDNP+ PEF+GWIYFDLHPRD
Sbjct: 418 EGMLNIYETLLNLKFIEEKDDSKNKNVWHKEVKQLAVWKMDNPENPEFVGWIYFDLHPRD 477

Query: 476 GKYGHAANFGISSSYVDENDKRSYPVTALVCNFSKPTSDKPSLLKHNELTTFFHELGHGI 535
           GKYGHAANFGISSSY+  N++RSYPVTALVCNFSK T+DKP+LLKHNE+TTFFHELGHGI
Sbjct: 478 GKYGHAANFGISSSYIKPNNERSYPVTALVCNFSKVTADKPALLKHNEITTFFHELGHGI 537

Query: 536 HDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKHYKTGEKIPESLIES 595
           HDLVG N  SR NGPG+VPWDFVEAPSQMLEFWTWNKNEL+SLSKHYKTGEKIP  L+ S
Sbjct: 538 HDLVGKNNNSRFNGPGAVPWDFVEAPSQMLEFWTWNKNELLSLSKHYKTGEKIPTELLNS 597

Query: 596 LVSTKHVNGALFALRQLHFSTFDMEVHTAEDVSKLNLLELWNGLREQICLVENGDEMSKG 655
           LV+TKHVNGALFALRQLHF  FDM+VHT++D+  L+ L+LWN LRE++ LVENGD  +KG
Sbjct: 598 LVATKHVNGALFALRQLHFGLFDMKVHTSKDLENLDFLKLWNELREEVSLVENGDLFTKG 657

Query: 656 YDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFAADPLNSKSGVEYRDIILSRGGIYEV 715
           YDSFGHIM           MWAEVFATDMYYTKFAA+PL +K GVEYRD +L+RGG+YE+
Sbjct: 658 YDSFGHIMSDSYSAGYYGYMWAEVFATDMYYTKFAANPLETKVGVEYRDWVLARGGLYEI 717

Query: 716 NDNLEEFLGREPNNSAFLKEMGLN 739
            DNL +FLGR+P+N AFLKE+GLN
Sbjct: 718 EDNLIQFLGRKPSNEAFLKELGLN 741

>SAKL0C00550g Chr3 (48410..50608) [2199 bp, 732 aa] {ON} highly
           similar to gnl|GLV|KLLA0C00572g Kluyveromyces lactis
           KLLA0C00572g and similar to YCL057W uniprot|P25375
           Saccharomyces cerevisiae YCL057W PRD1 Zinc
           metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 732

 Score =  991 bits (2563), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 464/724 (64%), Positives = 574/724 (79%), Gaps = 23/724 (3%)

Query: 33  VSFFAVPAIAFTILK---------------YSTM--TNSSLLIAPQPAPTWNWTPEGIVK 75
            S  A+PA+AF                   YSTM  T S+ L+ PQ AP+W ++PE I++
Sbjct: 15  TSLLAIPALAFGAYSLLHSTNRTLRIPKSNYSTMSATMSATLVPPQAAPSWKYSPEDILQ 74

Query: 76  DAESLIKDSNRIFDNLAAISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADKDIRDS 135
                I  ++ + D LA + +PTVE+ + P++ HEN   PLINQLTFLQHVSADK++RD+
Sbjct: 75  LTNETIASTSALHDALAGVENPTVESLVKPFLEHENTTQPLINQLTFLQHVSADKEVRDA 134

Query: 136 SMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRFIEKCHKDF 195
           S KATEL+Q+FEIEASLR DLF+QFDK+W   KD+++F ++    ++E Y+F+EKCHKD+
Sbjct: 135 STKATELLQDFEIEASLRHDLFVQFDKVWQACKDDAKFKKE----HFELYKFVEKCHKDY 190

Query: 196 IRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEK 255
           +R+GLNL +EKR  VK++QKKI++NSL FSKNLGEQKEF+AFT EELDGVS +VM+QFEK
Sbjct: 191 VRAGLNLPEEKRNEVKELQKKISNNSLQFSKNLGEQKEFVAFTTEELDGVSASVMDQFEK 250

Query: 256 FKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDTLKLRND 315
           F D   G EK KV+FKYPDILPVLK+AKNP TRK AF  DQNKVP+NE LF++TL+LR++
Sbjct: 251 FTD-TDGVEKHKVSFKYPDILPVLKTAKNPETRKRAFGGDQNKVPQNEVLFLETLRLRDE 309

Query: 316 LSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXXXXXXXXDMKELN 375
           L+ +L YS YANYNL++KMAK +ETV  FL+DLK KL+P               D KEL 
Sbjct: 310 LAGLLGYSTYANYNLDIKMAKKQETVLAFLEDLKNKLKPLGVKEIEALKSLKEKDCKELA 369

Query: 376 LPYDNHYYIWDHRYYDNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEET 435
           +P+DNHYYIWD+RYYDNKYLK+N+NVD EKISEY+P+E +I GMLKIYETV+KLKFVEET
Sbjct: 370 IPFDNHYYIWDNRYYDNKYLKENYNVDEEKISEYFPLEPTIGGMLKIYETVLKLKFVEET 429

Query: 436 DPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSSYVDEND 495
           D  K+ VWHEDVKQL+VWK+D  ++PEF+GWIYFDLHPRDGKYGHAANFGI+SSYV  + 
Sbjct: 430 DAEKKQVWHEDVKQLAVWKVDKAESPEFVGWIYFDLHPRDGKYGHAANFGIASSYV-RDG 488

Query: 496 KRSYPVTALVCNFSKPTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPW 555
            RS+PVTALVCNFSKP++ KP+LLKH+E+TTFFHELGHGIHDLVG N   R NGPG+ PW
Sbjct: 489 ARSHPVTALVCNFSKPSAKKPALLKHSEITTFFHELGHGIHDLVGGNHIGRFNGPGATPW 548

Query: 556 DFVEAPSQMLEFWTWNKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFS 615
           DFVEAPSQMLEFWTWNKNEL +LS+HY+TGEKIPE L++SL++TKHVNGALFALRQL F 
Sbjct: 549 DFVEAPSQMLEFWTWNKNELSTLSQHYETGEKIPEQLLDSLIATKHVNGALFALRQLTFG 608

Query: 616 TFDMEVHTAEDVSKLNLLELWNGLREQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXM 675
            FDM VHT +D+  L++  LWN LR+++ LVENGD+++KG++SFGHIM           M
Sbjct: 609 LFDMTVHTCKDLESLDVTSLWNDLRQEVSLVENGDQVTKGFNSFGHIMSGAYSAGYYGYM 668

Query: 676 WAEVFATDMYYTKFAADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLKE 735
           WAEVFA DMY+TKFAADPLN   GV YRDI+LSRGG+YE++DNL EFLGREPNN AFLKE
Sbjct: 669 WAEVFAADMYHTKFAADPLNGDVGVRYRDIVLSRGGLYEIDDNLREFLGREPNNEAFLKE 728

Query: 736 MGLN 739
           +GL+
Sbjct: 729 LGLS 732

>KAFR0D00180 Chr4 (18900..21071) [2172 bp, 723 aa] {ON} Anc_1.9
           YCL057W
          Length = 723

 Score =  990 bits (2559), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/725 (66%), Positives = 582/725 (80%), Gaps = 18/725 (2%)

Query: 27  NRKTRIV--------SFFAVPAIAFTILK--YSTMTNSSLLIAPQPAPTWNWTPEGIVKD 76
           NR +R+V        S   +PA ++ +    YS MT S+  IAPQ AP+WNW P  ++ D
Sbjct: 3   NRLSRLVIPSRKSFLSLVCIPATSYLVYNRLYSNMTISAF-IAPQAAPSWNWNPSRLLFD 61

Query: 77  AESLIKDSNRIFDNLAAISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADKDIRDSS 136
           AE +I +SNR++D L+++  PTVEN + PYM HENK+SPLIN+L FLQHVS D  IR++S
Sbjct: 62  AECVIDNSNRLYDELSSLKKPTVENLVRPYMIHENKISPLINKLCFLQHVSEDPKIREAS 121

Query: 137 MKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSE-FNEKSDSKNYESYRFIEKCHKDF 195
           +KATEL+Q FEIEASLR DLF+QFDKIW ++ +  + F ++ D   +E+++FIEK HKD+
Sbjct: 122 LKATELLQKFEIEASLRHDLFLQFDKIWQEISEKKDDFVKEYD---FETWKFIEKVHKDY 178

Query: 196 IRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEK 255
           +RSGLNL ++KRE +K+I+ KI +NSL +SKNLGEQKE IAFT+EELDGVSDAV EQFEK
Sbjct: 179 VRSGLNLPEDKREKIKEIKIKIGNNSLQYSKNLGEQKELIAFTREELDGVSDAVFEQFEK 238

Query: 256 FKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDTLKLRND 315
           F DE+TGEEKFKVTFKYPDI PVLK+AKNP TR+ AF ADQNKVP+NE LFV+TLKLRN+
Sbjct: 239 FIDEETGEEKFKVTFKYPDIFPVLKTAKNPETRRKAFLADQNKVPQNEDLFVETLKLRNE 298

Query: 316 LSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXXXXXXXXDMKELN 375
           L+T L+YS YANYNLE KMAK +ETV +FL+DLK +L+P               + KELN
Sbjct: 299 LATTLNYSTYANYNLEEKMAKRQETVLDFLNDLKYRLKPLAMKEISILKDIKQKECKELN 358

Query: 376 LPYDNHYYIWDHRYYDNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEET 435
             YD+HYYI+DHRYYDNKYLKDNFNVDLE ISEYYP+E +I+GMLKIYE + KLKF EET
Sbjct: 359 REYDSHYYIYDHRYYDNKYLKDNFNVDLEAISEYYPLEHTINGMLKIYEELFKLKFNEET 418

Query: 436 DPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSSYVD-EN 494
               ++VWHEDVKQL+VWKMDNP+ PEF+GWIYFDLHPRDGKYGHAANFGISSSYVD E 
Sbjct: 419 --KNKSVWHEDVKQLAVWKMDNPEKPEFVGWIYFDLHPRDGKYGHAANFGISSSYVDIET 476

Query: 495 DKRSYPVTALVCNFSKPTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVP 554
            KRSYPVTALVCNFSK T+ +PSLLKHNE+TTFFHELGHGIHDLVG N+ SR NGPG+ P
Sbjct: 477 GKRSYPVTALVCNFSKSTATRPSLLKHNEITTFFHELGHGIHDLVGKNKLSRFNGPGATP 536

Query: 555 WDFVEAPSQMLEFWTWNKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHF 614
           WDFVEAPSQMLEFWTWN NEL SLS HY++ EKIP+ L+ SL+ TKHVNGALFALRQLHF
Sbjct: 537 WDFVEAPSQMLEFWTWNANELKSLSCHYESNEKIPDDLLTSLIKTKHVNGALFALRQLHF 596

Query: 615 STFDMEVHTAEDVSKLNLLELWNGLREQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXX 674
             FDM VHT  +V  LNLL+LWN LRE+ICLVE G E+SKGYDSFGHIM           
Sbjct: 597 GLFDMTVHTTNNVESLNLLKLWNELREEICLVETGHELSKGYDSFGHIMSDSYSAGYYGY 656

Query: 675 MWAEVFATDMYYTKFAADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLK 734
           MWAEVFA DMY+TKF+ +PL+S+ GV+YRDI+L+ GG+YE+ DNL +FLGREP+ +AFLK
Sbjct: 657 MWAEVFAADMYHTKFSPNPLDSEVGVQYRDIVLANGGLYEIADNLRDFLGREPSKNAFLK 716

Query: 735 EMGLN 739
           E+GL+
Sbjct: 717 ELGLD 721

>KNAG0C00260 Chr3 (39428..41662) [2235 bp, 744 aa] {ON} Anc_1.9
           YCL057W
          Length = 744

 Score =  965 bits (2495), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 454/687 (66%), Positives = 549/687 (79%), Gaps = 2/687 (0%)

Query: 54  SSLLIAPQPA-PTWNWTPEGIVKDAESLIKDSNRIFDNLAAISSPTVENFIVPYMNHENK 112
           S  L+ P  A P W +    I ++A  +I+ +N+ +D L  IS+P+++N + PYMNHEN 
Sbjct: 58  SPQLVPPAGALPRWEFPSAKIGEEATRIIESTNKFYDELVEISNPSIDNLVKPYMNHENS 117

Query: 113 VSPLINQLTFLQHVSADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSE 172
           +  ++NQL FLQHVS+DK+IR++S KATEL+QNFEIE SLR DLF+QFDKIW ++K   E
Sbjct: 118 IGLMVNQLCFLQHVSSDKEIREASNKATELLQNFEIETSLRHDLFLQFDKIWKELKPRKE 177

Query: 173 FNEKSDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQK 232
                D + +E Y+F+EKCHKDF+R+GLNLS+E R  VKDI+ KIASNSL FSKNLGEQK
Sbjct: 178 -EFSHDEEQFEIYKFVEKCHKDFVRAGLNLSEEDRNKVKDIKIKIASNSLEFSKNLGEQK 236

Query: 233 EFIAFTKEELDGVSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAF 292
           EF+ F+KE+LDGVSD VMEQFE+ KDE T E  +KVTFKYPDI PVLK AKN  TRK AF
Sbjct: 237 EFLLFSKEQLDGVSDTVMEQFEQVKDETTNETNYKVTFKYPDIFPVLKMAKNAETRKTAF 296

Query: 293 NADQNKVPENEALFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKL 352
             DQNKVP+NE LFV TLKLR++L+T+L Y  YANYNLE+KMAK + TVF FL+DLK KL
Sbjct: 297 CGDQNKVPQNEELFVATLKLRDELATLLGYDTYANYNLEIKMAKKQSTVFKFLNDLKDKL 356

Query: 353 RPXXXXXXXXXXXXXXXDMKELNLPYDNHYYIWDHRYYDNKYLKDNFNVDLEKISEYYPI 412
           +P               + KEL +P+D  YYIWDHRYYD KYLKDNFNVD E I+EYYPI
Sbjct: 357 KPLGEKEIGILKSIKEAECKELGVPFDGRYYIWDHRYYDTKYLKDNFNVDHEAIAEYYPI 416

Query: 413 ESSIDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLH 472
           +S+I+GMLKIYETV KLKFVEE D AK+NVW+EDVKQ++VWKMDN   P F+GWIYFDLH
Sbjct: 417 DSTIEGMLKIYETVFKLKFVEEKDTAKKNVWNEDVKQIAVWKMDNVKTPVFVGWIYFDLH 476

Query: 473 PRDGKYGHAANFGISSSYVDENDKRSYPVTALVCNFSKPTSDKPSLLKHNELTTFFHELG 532
           PRDGKYGHAANFGI+SSY+ E+  RSYPVTALVCNFSK ++ KPSLLKHNE+TTFFHELG
Sbjct: 477 PRDGKYGHAANFGIASSYIREDGSRSYPVTALVCNFSKSSATKPSLLKHNEITTFFHELG 536

Query: 533 HGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKHYKTGEKIPESL 592
           HGIHDLVG NR +R NGPG+ PWDFVEAPSQMLEF+TW+KN L SLSKHYKTGE+IPE L
Sbjct: 537 HGIHDLVGKNRAARFNGPGATPWDFVEAPSQMLEFYTWDKNALQSLSKHYKTGEQIPEKL 596

Query: 593 IESLVSTKHVNGALFALRQLHFSTFDMEVHTAEDVSKLNLLELWNGLREQICLVENGDEM 652
           ++SL++TKHVNGALFALRQLHF  FDM VHT++DV+ L+LL+LW  LR++I LVENG + 
Sbjct: 597 LDSLIATKHVNGALFALRQLHFGLFDMTVHTSKDVASLDLLKLWGDLRQEISLVENGGQY 656

Query: 653 SKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFAADPLNSKSGVEYRDIILSRGGI 712
           +KGYDSFGHIM           MWAEVFATDMY TKFA +PL+S  G++YRDI+L+ GG+
Sbjct: 657 TKGYDSFGHIMSDSYSAGYYGYMWAEVFATDMYRTKFAPNPLDSSVGMKYRDIVLANGGL 716

Query: 713 YEVNDNLEEFLGREPNNSAFLKEMGLN 739
           YE++DNL+EFLGREP+  AFLKE+GL 
Sbjct: 717 YEIDDNLKEFLGREPSKDAFLKELGLQ 743

>KLLA0C00572g Chr3 (42069..44207) [2139 bp, 712 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057W PRD1
           Zinc metalloendopeptidase found in the cytoplasm and
           intermembrane space of mitochondria
          Length = 712

 Score =  949 bits (2453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/710 (63%), Positives = 561/710 (79%), Gaps = 15/710 (2%)

Query: 33  VSFFAVPAIAFTILKY----STMTNSSLLIAPQPAPTWNWTPEGIVKDAESLIKDSNRIF 88
            S   +P +AF   ++    S MT +  ++ PQ AP+WN+T E ++K     I  SN + 
Sbjct: 14  TSLVVIPTLAFASFQFNAIRSIMTKTDFVV-PQAAPSWNYTTEELLKQTHEAIDSSNELL 72

Query: 89  DNLAAISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADKDIRDSSMKATELIQNFEI 148
           D+L +IS+P+VENF+ PY++HEN +SPL NQLTFLQHVS+DK++RD+S K TELI+NF I
Sbjct: 73  DSLESISNPSVENFVTPYLHHENTISPLFNQLTFLQHVSSDKELRDTSTKVTELIENFGI 132

Query: 149 EASLRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRFIEKCHKDFIRSGLNLSDEKRE 208
           E+SLR  LF QFD +W  +KD+++F  K D  ++E Y+F+EKCHKDF+RSGLNL +E+R+
Sbjct: 133 ESSLRFKLFRQFDIVWNQLKDDAQF--KKD--HFEIYKFVEKCHKDFLRSGLNLPEEQRD 188

Query: 209 IVKDIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEKFKDEKTGEEKFKV 268
            VK+I+KKI++NSL FSKNLGEQ EFI FTKEEL GVS+ VM+QFE   ++  G  K+KV
Sbjct: 189 KVKEIKKKISNNSLQFSKNLGEQNEFITFTKEELIGVSENVMKQFETVDED--GITKYKV 246

Query: 269 TFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDTLKLRNDLSTVLDYSNYANY 328
           TFKYPDI PVLKSAKN  TRK AF  DQNKVP+NEALF++TL+LRNDL+ +L+Y +YA+Y
Sbjct: 247 TFKYPDIFPVLKSAKNAETRKRAFIGDQNKVPQNEALFLETLQLRNDLAELLNYDSYADY 306

Query: 329 NLEMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXXXXXXXXDMKELNLPYDNHYYIWDHR 388
           NL++KMAK EE V  FL+DLK KL+P               + KELN PYD  YYIWD+R
Sbjct: 307 NLDIKMAKKEEAVLTFLNDLKNKLKPLGEKELTKLKNLKEEECKELNTPYDRRYYIWDNR 366

Query: 389 YYDNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEETDPAKRNVWHEDVK 448
           YYDN+YLK NF +D EKI+EY+P+ES+I GML+IYETV+KLKF+EE +    + WH DVK
Sbjct: 367 YYDNQYLKKNFQIDEEKIAEYFPLESTIKGMLQIYETVLKLKFIEEDNG---DTWHPDVK 423

Query: 449 QLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSSYVDENDKRSYPVTALVCNF 508
           +LSVWKMD+ + P F+GWIYFDLHPR+GKYGHAANFGISSS++  +  RSYPVTALVCNF
Sbjct: 424 KLSVWKMDD-NFPSFVGWIYFDLHPREGKYGHAANFGISSSFLKSDGSRSYPVTALVCNF 482

Query: 509 SKPTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFW 568
           SKPT DKP+LLKH+ELTTFFHELGHGIHDLVG N   R NGP + PWDFVEAPSQMLEFW
Sbjct: 483 SKPTKDKPALLKHSELTTFFHELGHGIHDLVGGNDIGRFNGPSATPWDFVEAPSQMLEFW 542

Query: 569 TWNKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVHTAEDVS 628
           TWNK EL SLSKHY+T EKIP+SL++SLV TKH+NGALFALRQLHF  FDM+VHT +D+S
Sbjct: 543 TWNKKELKSLSKHYQTEEKIPDSLLDSLVRTKHINGALFALRQLHFGLFDMKVHTTKDIS 602

Query: 629 KLNLLELWNGLREQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTK 688
           KLN+ ELWN LRE+ICL++NGD  +KG++SFGHIM           MWA+VFA+DMYYTK
Sbjct: 603 KLNVTELWNSLREEICLIDNGDIQTKGFNSFGHIMSDSYSAGYYGYMWADVFASDMYYTK 662

Query: 689 FAADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLKEMGL 738
           F  DPLNS  GV+YRDIIL+RGG+YE+ DNL EFLGR+PNN AFLKE+GL
Sbjct: 663 FLEDPLNSDVGVQYRDIILARGGLYEIEDNLTEFLGRKPNNKAFLKELGL 712

>NDAI0A00180 Chr1 (14692..16914) [2223 bp, 740 aa] {ON} Anc_1.9
          Length = 740

 Score =  949 bits (2453), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/695 (64%), Positives = 557/695 (80%), Gaps = 6/695 (0%)

Query: 45  ILKYSTMTNSSLLIAP-QPAPTWNWTPEGIVKDAESLIKDSNRIFDNLAAISSPTVENFI 103
           I+  +T+ N    IAP    P W WTP+ I+ + +S I+ +N+ +++++ I SP++EN I
Sbjct: 51  IMTNNTVNNKHGFIAPANTVPDWTWTPKQILDETKSYIEKTNKYYNSISEIESPSIENLI 110

Query: 104 VPYMNHENKVSPLINQLTFLQHVSADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDKI 163
           +PYMN+ENK+  LINQLTFLQHVSADK IRD+S++AT L+++ +I  SLR +++ QF+K+
Sbjct: 111 IPYMNYENKMGLLINQLTFLQHVSADKKIRDASLEATRLLEDHDILTSLRWEIWEQFEKV 170

Query: 164 WTDVKDNSEFNEKSDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSLN 223
           W  V+++ +F     +  +E+Y+FIEK HKD +R+GL    E+   +K I+ KI++++L 
Sbjct: 171 WETVQNDDDF---LKNHQFETYKFIEKIHKDSLRNGL--KSERNYQLKYIKGKISADALT 225

Query: 224 FSKNLGEQKEFIAFTKEELDGVSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAK 283
           FS NLGEQ E+++FTKEELDGVS+ VM+QFEKF D KT E+K+KVTFKYPDI PVLK+AK
Sbjct: 226 FSSNLGEQNEYVSFTKEELDGVSETVMDQFEKFIDPKTNEKKYKVTFKYPDIFPVLKTAK 285

Query: 284 NPNTRKLAFNADQNKVPENEALFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFN 343
           NP TRK+AF  DQNKVPENE L  + LKLR +L+  L YS YANYNL++KMAKN+ETV  
Sbjct: 286 NPKTRKIAFLGDQNKVPENEKLLCNVLKLRKELANTLGYSTYANYNLDIKMAKNQETVLK 345

Query: 344 FLDDLKTKLRPXXXXXXXXXXXXXXXDMKELNLPYDNHYYIWDHRYYDNKYLKDNFNVDL 403
           FL+DLK KL+P               + +EL +PYD HYYIWDHRYYDNKYLKDNFNVD+
Sbjct: 346 FLNDLKEKLKPLAEKEIKILKDLKKKECEELGIPYDGHYYIWDHRYYDNKYLKDNFNVDI 405

Query: 404 EKISEYYPIESSIDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEF 463
           EKISEYYP+ES+IDGMLKIYETV+ LKF+EETDP  +NVWH DVKQLSVW MD+   P F
Sbjct: 406 EKISEYYPLESTIDGMLKIYETVLNLKFIEETDPLAKNVWHPDVKQLSVWNMDDRANPAF 465

Query: 464 IGWIYFDLHPRDGKYGHAANFGISSSYVDENDKRSYPVTALVCNFSKPTSDKPSLLKHNE 523
           +GWIYFDL+PRDGKYGHAANFGI+SSY+ E +KRSYPVTALVCNFSKPT +KP+LLKH+E
Sbjct: 466 VGWIYFDLYPRDGKYGHAANFGIASSYITEENKRSYPVTALVCNFSKPTKNKPALLKHSE 525

Query: 524 LTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKHYK 583
           +TTFFHELGHGIHDLVG N+ +R NGPGSVPWDFVEAPSQMLEFWTWNKNEL+SLSKHYK
Sbjct: 526 ITTFFHELGHGIHDLVGQNKAARFNGPGSVPWDFVEAPSQMLEFWTWNKNELLSLSKHYK 585

Query: 584 TGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVHTAEDVSKLNLLELWNGLREQI 643
           TGEKIPE L++SL+STKHVNGALFALRQLHF  FDM VHT +D+  L+LL+LWN  RE+I
Sbjct: 586 TGEKIPEDLLDSLISTKHVNGALFALRQLHFGLFDMTVHTTKDIENLDLLKLWNESREEI 645

Query: 644 CLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFAADPLNSKSGVEYR 703
           CLVENG+  +KGY+SFGHI+           MWAEVFA DMY+TKFA +PL+   G++YR
Sbjct: 646 CLVENGENFTKGYNSFGHIISDSYSAGYYGYMWAEVFAADMYHTKFAPNPLDVSVGIKYR 705

Query: 704 DIILSRGGIYEVNDNLEEFLGREPNNSAFLKEMGL 738
           D+IL++GG+YE+NDNL EFLGREP+N  FLKE+GL
Sbjct: 706 DLILAKGGLYEINDNLLEFLGREPSNKPFLKELGL 740

>YCL057W Chr3 (24768..26906) [2139 bp, 712 aa] {ON}  PRD1Zinc
           metalloendopeptidase, found in the cytoplasm and
           intermembrane space of mitochondria; with Cym1p,
           involved in degradation of mitochondrial proteins and of
           presequence peptides cleaved from imported proteins
          Length = 712

 Score =  893 bits (2308), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 426/709 (60%), Positives = 545/709 (76%), Gaps = 10/709 (1%)

Query: 34  SFFAVPAIA---FTILKYSTMTNSSLLIAPQPAPTWNWTPEGIVKDAESLIKDSNRIFDN 90
           ++FA P I+   +T   YS    +S  IAPQ  P W++TP  I      +I +SN  +D+
Sbjct: 8   NWFASPVISPLLYTRSLYSMANTTSFPIAPQAPPNWSFTPSDISGKTNEIINNSNNFYDS 67

Query: 91  LAAISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADKDIRDSSMKATELIQNFEIEA 150
           ++ + SP+V NF+ P+M  EN++ P+INQLTFLQHVS+DK+IRD+S+ ++  +    I+ 
Sbjct: 68  MSKVESPSVSNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDL 127

Query: 151 SLRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIV 210
           SLR D+F+QF ++W DV+       K+DS   E+++++EK +KD+I SGL L +  R  +
Sbjct: 128 SLRHDIFLQFARVWQDVQ------SKADSVERETFKYVEKSYKDYIHSGLELDEGNRLKI 181

Query: 211 KDIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEKFKDEK-TGEEKFKVT 269
           K+I+KKI+ NS+NFSKNLGEQKE+I FTKE+L+GV D+++ QFE  K +K + E  +KVT
Sbjct: 182 KEIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSILTQFETIKSDKDSNETLYKVT 241

Query: 270 FKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDTLKLRNDLSTVLDYSNYANYN 329
           FKYPDI PV+K A +  TRK AF ADQNKVPENEA+ +DTLKLR++L+++L Y  YANYN
Sbjct: 242 FKYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYDTYANYN 301

Query: 330 LEMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXXXXXXXXDMKELNLPYDNHYYIWDHRY 389
           L  KMA++  TV NFL+DLK KL P               D+K+LN   D +YYIWDHRY
Sbjct: 302 LYDKMAEDSTTVMNFLNDLKDKLIPLGRKELQVLQDMKAEDVKKLNQGADPNYYIWDHRY 361

Query: 390 YDNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQ 449
           YDNKYL +NFNVDLEKISEY+P+E++I GML+IYET+  LKF+E  D   ++VWH+DVKQ
Sbjct: 362 YDNKYLLENFNVDLEKISEYFPLEATITGMLEIYETLFNLKFIETKDSQNKSVWHDDVKQ 421

Query: 450 LSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSSYVDENDKRSYPVTALVCNFS 509
           ++VW MD+P +P F+GWIYFDLHPRDGKYGHAANFG+SSS++ ++  RSYPVTALVCNFS
Sbjct: 422 IAVWNMDDPKSPNFVGWIYFDLHPRDGKYGHAANFGLSSSFMIDDTTRSYPVTALVCNFS 481

Query: 510 KPTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWT 569
           K T DKPSLLKHNE+ TFFHELGHGIHDLVG N+ SR NGPGSVPWDFVEAPSQMLEFWT
Sbjct: 482 KSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWT 541

Query: 570 WNKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVHTAEDVSK 629
           WNKNELI+LS HYKTGEKIPESLI SL+ TKHVNGALF LRQLHF  FDM+VHT +D+  
Sbjct: 542 WNKNELINLSSHYKTGEKIPESLINSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQN 601

Query: 630 LNLLELWNGLREQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKF 689
           L++ + WN LR+ I L+ NG  +SKGYDSFGHIM           +WAEVFATDMY+TKF
Sbjct: 602 LSICDTWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKF 661

Query: 690 AADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLKEMGL 738
           A DPLN+K+G++YRDI+L+RGG+Y++NDNL+EFLGREP+  AFLKE+GL
Sbjct: 662 AKDPLNAKNGIQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGL 710

>CAGL0B00418g Chr2 (26584..28815) [2232 bp, 743 aa] {ON} similar to
           uniprot|P25375 Saccharomyces cerevisiae YCL057w PRD1
           proteinase yscD
          Length = 743

 Score =  892 bits (2306), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 441/700 (63%), Positives = 540/700 (77%), Gaps = 11/700 (1%)

Query: 43  FTILKYSTMTNSSLLIAPQPAPTWNWTPEGIVKDAESLIKDSNRIFDNLAAISSPTVENF 102
           ++ L  +  TN   L  PQ  P+W + PE I+   +  I ++   +D+L AI +PT+EN 
Sbjct: 52  YSQLANTRFTNMPSLTPPQYPPSWEFKPEDILSQTKEFIANTKLFYDDLVAIDNPTIENL 111

Query: 103 IVPYMNHENKVSPLINQLTFLQHVSADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDK 162
           IVPY+NHEN+   LINQLTFLQHVS DK IRD+SM+AT L+Q+FEIE+  R DLF QFD 
Sbjct: 112 IVPYINHENENELLINQLTFLQHVSEDKTIRDASMEATMLLQDFEIESGSRVDLFKQFDL 171

Query: 163 IWTDVKDNSEFNEKSDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSL 222
           IW  +KD     +K + +++E +RF+EKCHKD++R+GLNL  +K E VK+I+KKIA N L
Sbjct: 172 IWNQIKD-----KKDEFEDFEIWRFVEKCHKDYVRAGLNLPADKLEKVKEIKKKIADNCL 226

Query: 223 NFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSA 282
            FSKNLGEQKE+I FT EEL GV ++V+EQFEK  DE  G +K KVT+KYPDI PVLK+A
Sbjct: 227 KFSKNLGEQKEYILFTAEELKGVPESVIEQFEKVNDE-FGIQKLKVTYKYPDIFPVLKNA 285

Query: 283 KNPNTRKLAFNADQNKVPENEALFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVF 342
           +NP TR  AF  DQNKVPENE LF DTLKLRN+L+ VL Y  YANYNL++KMAKN +TV 
Sbjct: 286 QNPETRMKAFMGDQNKVPENEHLFKDTLKLRNELALVLGYDTYANYNLDIKMAKNADTVL 345

Query: 343 NFLDDLKTKLR-PXXXXXXXXXXXXXXXDMKELNLPYDNHYYIWDHRYYDNKYLKDNFNV 401
           +F++DL  KL+ P                  E N+ YD  YYIWDHRYYDNKYLK+NFNV
Sbjct: 346 SFVNDLIVKLQDPAKKELDILKNLKKQEFENEFNMVYDGDYYIWDHRYYDNKYLKENFNV 405

Query: 402 DLEKISEYYPIESSIDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAP 461
           D EKI+EYYP+ES+IDGMLKIYET++KLKFVE  +  K   WH+DVKQL+VWK+D P+ P
Sbjct: 406 DEEKIAEYYPLESTIDGMLKIYETLLKLKFVEVKENKK--TWHDDVKQLAVWKLDTPENP 463

Query: 462 EFIGWIYFDLHPRDGKYGHAANFGISSSYVDENDKRSYPVTALVCNFSKPTSDKPSLLKH 521
           EF+GWI+FDLHPRDGKYGHAANFG+SSSY+  N  RSYP+TALVCNFSK T DKPSLLKH
Sbjct: 464 EFVGWIFFDLHPRDGKYGHAANFGLSSSYISANGTRSYPITALVCNFSKSTKDKPSLLKH 523

Query: 522 NELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKH 581
           +E+TTFFHELGHGIHDLVG NR  R NGPG+VPWDFVEAPSQMLEFWTWN  EL+SLS++
Sbjct: 524 SEITTFFHELGHGIHDLVGNNRIGRFNGPGAVPWDFVEAPSQMLEFWTWNTKELLSLSQN 583

Query: 582 YKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVH--TAEDVSKLNLLELWNGL 639
           YK   KI   L+ESL+ TKHVNGALFALRQLHF  FDM+VH  +AE++ KL++ +LWN L
Sbjct: 584 YKDNAKIDTKLLESLIKTKHVNGALFALRQLHFGLFDMKVHMMSAEELDKLDIKKLWNDL 643

Query: 640 REQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFAADPLNSKSG 699
           RE+ICL+ NGD+ + GY+SFGHIM           MWAEVFATDMYYTKF ADPLN + G
Sbjct: 644 REKICLISNGDQPTTGYNSFGHIMSGSYSAGYYGYMWAEVFATDMYYTKFKADPLNPEVG 703

Query: 700 VEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLKEMGLN 739
           V+YRDI+L+RGG+YE++DNLEEFLGR+P   AFL+E+GL+
Sbjct: 704 VKYRDIVLARGGLYEIDDNLEEFLGRKPAKDAFLEELGLH 743

>Skud_3.7 Chr3 (12763..14901) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  885 bits (2288), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 428/709 (60%), Positives = 544/709 (76%), Gaps = 10/709 (1%)

Query: 35  FFAVPAIAFTILK--YSTMTNS-SLLIAPQPAPTWNWTPEGIVKDAESLIKDSNRIFDNL 91
           +F  P I+  +     S MTN+ S  IAPQ  PTW++TP  I      +I  SN+ ++ +
Sbjct: 9   WFTSPVISPLLYTRCLSAMTNAASFPIAPQAPPTWSFTPTDIGGKTTEIIDKSNKFYELM 68

Query: 92  AAISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADKDIRDSSMKATELIQNFEIEAS 151
           + + SP+V NFI P+M  EN++ P+IN+LTFLQHVS+DK+IRD+S+ ++  +    I+ S
Sbjct: 69  SQVESPSVTNFIEPFMKFENELGPIINRLTFLQHVSSDKEIRDASVDSSMKLDELNIDLS 128

Query: 152 LRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIVK 211
           LR D+F+QF ++W D +       K+DS   E++++IEK +KDFI SGL L +  R  +K
Sbjct: 129 LRHDIFLQFARVWQDAQ------PKADSLKKETFKYIEKSYKDFIHSGLELDEANRLKIK 182

Query: 212 DIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEKFKDEKTGEEK-FKVTF 270
           +I+KKI+ NS+NFSKNLGEQKE+I FTKE+L+GV D+++ QFE  K EK GE+  +KVTF
Sbjct: 183 EIKKKISMNSINFSKNLGEQKEYITFTKEQLEGVPDSILAQFETTKSEKGGEDTLYKVTF 242

Query: 271 KYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDTLKLRNDLSTVLDYSNYANYNL 330
           KYPDI PV+K A +  TRK AF ADQNKVPENEA+ +DTLKLR++L+++L Y+ YA+YNL
Sbjct: 243 KYPDIFPVMKLASSAQTRKQAFLADQNKVPENEAILLDTLKLRDELASLLGYNTYADYNL 302

Query: 331 EMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXXXXXXXXDMKELNLPYDNHYYIWDHRYY 390
             KMAK+  TV +FL+DLK KL P               D++      D +YYIWDHRYY
Sbjct: 303 YDKMAKDSRTVMDFLNDLKGKLIPLGKKELQVLQDMKVKDVERSKKDEDPNYYIWDHRYY 362

Query: 391 DNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQL 450
           DNK+L +NFNVDLEKISEY+P+E++I GML+IYET+  LKF+E  +P  ++VWHEDVKQL
Sbjct: 363 DNKHLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIETKEPQNKSVWHEDVKQL 422

Query: 451 SVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSSYVDENDKRSYPVTALVCNFSK 510
           +VW MD+P +P FIGWIYFDLHPRDGKYGHAANFG+SSS++  + KRSYPVTALVCNFSK
Sbjct: 423 AVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMINDSKRSYPVTALVCNFSK 482

Query: 511 PTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTW 570
            T DKPSLLKHNE+ TFFHELGHGIHDLVG N+ SR NGPGSVPWDFVEAPSQMLEFWTW
Sbjct: 483 STKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTW 542

Query: 571 NKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVHTAEDVSKL 630
           NKNEL+SLS HYKTGE+IPESLI+SL+ TKHVNGALF LRQLHF  FDM+VHT +D+  L
Sbjct: 543 NKNELVSLSSHYKTGERIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLENL 602

Query: 631 NLLELWNGLREQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFA 690
           ++   WN LR++I L+ NG  +SKGYDSFGHIM           +WAEVFATDMY+TKFA
Sbjct: 603 SICHTWNQLRQEISLMPNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFA 662

Query: 691 ADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLKEMGLN 739
            DPLN+K+GV+YRDI+L+RGG+Y++NDNL+EFLGREP+  AFLKE+GL 
Sbjct: 663 KDPLNTKNGVQYRDIVLARGGLYDINDNLKEFLGREPSKDAFLKELGLQ 711

>Suva_3.156 Chr3 (234520..236658) [2139 bp, 712 aa] {ON} YCL057W
           (REAL)
          Length = 712

 Score =  885 bits (2286), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 419/708 (59%), Positives = 538/708 (75%), Gaps = 10/708 (1%)

Query: 35  FFAVPAIA---FTILKYSTMTNSSLLIAPQPAPTWNWTPEGIVKDAESLIKDSNRIFDNL 91
           +FA P I    +T    S  T +S   APQ  P+W++TP  I    + +I+ SN+ +D++
Sbjct: 9   WFASPVITPLLYTRFLSSMTTTASFPTAPQTPPSWSFTPNDISGRTKEIIEKSNKFYDSM 68

Query: 92  AAISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADKDIRDSSMKATELIQNFEIEAS 151
           + + SP V NF+ P+M  EN++ P+INQLTFLQHVS+DK+IRD+S+ ++  +    I+ S
Sbjct: 69  SQVESPAVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVDSSMKLDELNIDLS 128

Query: 152 LRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIVK 211
           LR D+F+QF ++W D +       ++DS   E++R+IEK +KD+I SGL L +  R  VK
Sbjct: 129 LRHDVFLQFARVWQDAQ------SQADSIERETFRYIEKSYKDYIHSGLELDEPDRLKVK 182

Query: 212 DIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEKFKDEK-TGEEKFKVTF 270
           +I+KKI+ NS+NFSKNLGEQKEFI FTKE+L+GV D+++ QFE  +  K + E  +KVTF
Sbjct: 183 EIKKKISVNSINFSKNLGEQKEFITFTKEQLEGVPDSILAQFETIESGKDSNETLYKVTF 242

Query: 271 KYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDTLKLRNDLSTVLDYSNYANYNL 330
           KYPDI PV+K A +  TRK AF ADQNKV ENEA+ +DTLKLR++++++L Y  YANYNL
Sbjct: 243 KYPDIFPVMKLASSSQTRKQAFLADQNKVSENEAILLDTLKLRDEVASLLGYDTYANYNL 302

Query: 331 EMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXXXXXXXXDMKELNLPYDNHYYIWDHRYY 390
             KMAK+  TV +FL+DLK KL P               D+K+ N   D +YYIWDHRYY
Sbjct: 303 YDKMAKDSTTVMDFLNDLKKKLIPLGEKELQILQDMKAKDVKKRNQDEDPNYYIWDHRYY 362

Query: 391 DNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQL 450
           DNKYL +NFNVDLEKISE++P+E++I GML+IYET+  LKF+E  +P +++VWHEDVKQL
Sbjct: 363 DNKYLLENFNVDLEKISEFFPLETTITGMLQIYETLFNLKFIETKNPQEKSVWHEDVKQL 422

Query: 451 SVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSSYVDENDKRSYPVTALVCNFSK 510
           +VW MD+P +P FIGWIYFDLHPRDGKYGHAANFG+SSS++  +  RSYPVTALVCNFSK
Sbjct: 423 AVWNMDDPKSPRFIGWIYFDLHPRDGKYGHAANFGLSSSFMVNDTTRSYPVTALVCNFSK 482

Query: 511 PTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTW 570
            T DKPSLLKHNE+ TFFHELGHGIHDLVG N+ SR NGPGSVPWDFVEAPSQMLEFWTW
Sbjct: 483 STKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWTW 542

Query: 571 NKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVHTAEDVSKL 630
           NKNEL+ LS HYKTGEKIPE LI+SL+ TKHVNGALF LRQLHF  FDM+VH+ +D+  L
Sbjct: 543 NKNELMHLSSHYKTGEKIPEPLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHSCKDLQNL 602

Query: 631 NLLELWNGLREQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFA 690
           ++ + WN LR+ I L+ NG  +SKGY SFGHIM           +WAEVFATDMY+TKFA
Sbjct: 603 SICDTWNQLRQDISLMSNGGTLSKGYASFGHIMSDSYSAGYYGYLWAEVFATDMYHTKFA 662

Query: 691 ADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLKEMGL 738
            DPLN+K+G++YRDI+L+RGG+ ++ND+L+EFLGREP+  AFLKE+GL
Sbjct: 663 KDPLNTKNGIQYRDIVLARGGLRDINDSLKEFLGREPSKDAFLKELGL 710

>Smik_3.18 Chr3 (26213..28351) [2139 bp, 712 aa] {ON} YCL057W (REAL)
          Length = 712

 Score =  872 bits (2253), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 422/709 (59%), Positives = 538/709 (75%), Gaps = 10/709 (1%)

Query: 34  SFFAVPAIA---FTILKYSTMTNSSLLIAPQPAPTWNWTPEGIVKDAESLIKDSNRIFDN 90
           ++F  P I+   +T   YS    +S  IAPQ  P W +TP  I    + +I  SN  +++
Sbjct: 8   NWFTSPIISPLLYTRSLYSMSNATSFPIAPQAPPNWTFTPNDINGKTKEIIDKSNNFYES 67

Query: 91  LAAISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADKDIRDSSMKATELIQNFEIEA 150
           ++ + +PTV NF+ P+M  EN++ P+INQLTFLQHVS+DK+IRD+S+ ++  +    I+ 
Sbjct: 68  MSNVETPTVTNFVEPFMKFENELGPIINQLTFLQHVSSDKEIRDASVNSSMKLDELNIDL 127

Query: 151 SLRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIV 210
           SLR D+++QF ++W D +       KSDS   E++++IEK +KD+I SGL L +  R  +
Sbjct: 128 SLRHDIYLQFARVWQDAQ------SKSDSIERETFKYIEKSYKDYIHSGLELDESNRLKI 181

Query: 211 KDIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEKFKDEKTGEEK-FKVT 269
           KDI+KKI+ NS+NFSKNLGEQKE+I FTKE+L+GV D+V+ QFE  K +K   E  +KVT
Sbjct: 182 KDIKKKISVNSINFSKNLGEQKEYITFTKEQLEGVPDSVLAQFETIKSDKDRNETLYKVT 241

Query: 270 FKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDTLKLRNDLSTVLDYSNYANYN 329
           FKYPDI PV+K A +  TRK AF ADQNKVPENEA+ +DTL+LR+ L+++L Y  YANYN
Sbjct: 242 FKYPDIFPVMKLASSAQTRKEAFLADQNKVPENEAILLDTLELRDKLASLLGYDTYANYN 301

Query: 330 LEMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXXXXXXXXDMKELNLPYDNHYYIWDHRY 389
           L  KMAK+  TV +FL+DLK KL P               D+K+LN   D +YYIWDHRY
Sbjct: 302 LYDKMAKDSTTVMDFLNDLKDKLIPLGKKELELLQEMKSKDVKKLNQDEDPNYYIWDHRY 361

Query: 390 YDNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQ 449
           YDNKYL +NFNVDLEKISEY+P+E++I GML+IYET+  LKF+E  D   ++VWH+DVKQ
Sbjct: 362 YDNKYLLENFNVDLEKISEYFPLETTITGMLQIYETLFNLKFIEIKDGQSKSVWHDDVKQ 421

Query: 450 LSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSSYVDENDKRSYPVTALVCNFS 509
           L+VW MD+P +P+F+GWIYFDLHPRDGKYGHAANFG+SSS++  +  RSYPVTALVCNFS
Sbjct: 422 LAVWNMDDPKSPKFVGWIYFDLHPRDGKYGHAANFGLSSSFMTNDSVRSYPVTALVCNFS 481

Query: 510 KPTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWT 569
           K T DKPSLLKHNE+ TFFHELGHGIHDLVG N+ SR NGPGSVPWDFVEAPSQMLEFWT
Sbjct: 482 KSTKDKPSLLKHNEIVTFFHELGHGIHDLVGQNKESRFNGPGSVPWDFVEAPSQMLEFWT 541

Query: 570 WNKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVHTAEDVSK 629
           WNKNELI LS HY+TGEKIPESLI+SL+ TKHVNGALF LRQLHF  FDM+VHT +D+  
Sbjct: 542 WNKNELIDLSSHYETGEKIPESLIDSLIKTKHVNGALFTLRQLHFGLFDMKVHTCKDLQN 601

Query: 630 LNLLELWNGLREQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKF 689
           L++ E WN LR+ I L+ NG  +SKGYDSFGHIM           +WAEVFATDMY+TKF
Sbjct: 602 LSICETWNQLRQDISLISNGGTLSKGYDSFGHIMSDSYSAGYYGYLWAEVFATDMYHTKF 661

Query: 690 AADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLKEMGL 738
           A DPLN+K+G++YRDI+L+RGG+ ++ D+L++FLGREP+  AFLKE+GL
Sbjct: 662 AKDPLNTKNGIQYRDIVLARGGLNDIGDDLKKFLGREPSKDAFLKELGL 710

>Ecym_1011 Chr1 (19924..22074) [2151 bp, 716 aa] {ON} similar to
           Ashbya gossypii AGR406C/ AGR405C
          Length = 716

 Score =  815 bits (2105), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 392/716 (54%), Positives = 528/716 (73%), Gaps = 12/716 (1%)

Query: 25  LKNRKTRIVSFFAVPAIAFTILK--YSTMTNSSLLIAPQPAPTWNWTPEGIVKDAESLIK 82
           LKN  T  VSF  +PA+A    +  ++   N S L++P+ AP+W++  + IV  A+  I 
Sbjct: 11  LKNSAT--VSFLLLPALAIAGNRSVHNQERNMSSLLSPKLAPSWDFAADEIVSLAQKAID 68

Query: 83  DSNRIFDNLAAISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADKDIRDSSMKATEL 142
           +  + +D++A++ +P +ENF+V  ++HE++    ++QLTFLQHVSADK++RD+S++AT+L
Sbjct: 69  EGTKFYDSVASLETPDLENFVVAVIDHEDETDGYMSQLTFLQHVSADKEVRDASIEATKL 128

Query: 143 IQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRFIEKCHKDFIRSGLNL 202
           IQ + IE S R DL+ QF K+W   KD+    +K+D    E Y ++E  +KD+I +G+ L
Sbjct: 129 IQEWGIETSSRYDLYSQFSKVWEQYKDDENL-KKNDP---ELYWYMENVNKDYIHAGMGL 184

Query: 203 SDEKREIVKDIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEKFKDEKTG 262
            +E R  +K+I+KK+A+NSL FS NLGEQ ++IAFTK+EL GVS+  + QFEK  ++  G
Sbjct: 185 PEESRNKIKEIKKKLANNSLAFSNNLGEQNDYIAFTKDELVGVSETTLGQFEKVIED--G 242

Query: 263 EEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDTLKLRNDLSTVLDY 322
            EK+K+TFKYPDI PVL +AKNP TRK A+  DQNKVP+NE + ++TLKLRN+L+ +  +
Sbjct: 243 VEKYKMTFKYPDIHPVLNTAKNPETRKRAYIGDQNKVPQNEQILIETLKLRNELAEIHGH 302

Query: 323 SNYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXXXXXXXXDMKELNLPYDNHY 382
             YA+Y LEMKMAK +ETVFNFL DLK KL P               + KEL LPY+  +
Sbjct: 303 PTYASYQLEMKMAKKQETVFNFLYDLKDKLLPGGKKDLENLKSLKEQEYKELGLPYNGSF 362

Query: 383 YIWDHRYYDNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEETDPAKRNV 442
             WD+RYYD+KYLK+NF+VD E++++Y+P++ +IDGML IY+ +  LKFVEET    +NV
Sbjct: 363 NSWDYRYYDDKYLKENFDVDEEELAKYFPLQHTIDGMLNIYQKLFNLKFVEETRECGKNV 422

Query: 443 WHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSSYVDENDKRSYPVT 502
           WHEDVKQ +VW +D  + PEF+GWIYFDLHPR+GKYGHAANFG+ S YV E   R YPVT
Sbjct: 423 WHEDVKQFAVWDLDKCN-PEFVGWIYFDLHPREGKYGHAANFGLYSPYVTEEGTRHYPVT 481

Query: 503 ALVCNFSKPTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPS 562
            LVCNFSKP+S +P+LLKH E+ TFFHELGHGIH LVG +R   LNGP S+PWDFVEAPS
Sbjct: 482 VLVCNFSKPSSTRPALLKHGEVVTFFHELGHGIHALVGKSRIGHLNGPSSIPWDFVEAPS 541

Query: 563 QMLEFWTWNKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVH 622
           QMLEFW WNK++++ LSKHY+TGE+IP+ L++SL+ TKHVN  L  LRQLHFS FDM VH
Sbjct: 542 QMLEFWPWNKDQILKLSKHYETGEQIPDELVDSLIKTKHVNAGLSNLRQLHFSLFDMTVH 601

Query: 623 TAEDVSKLNLLELWNGLREQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFAT 682
           T +++ KL++  LWN LRE++ L+ NGD ++KGYDSF HIM           MW+EVFA 
Sbjct: 602 TDKELDKLDIKSLWNNLREEVTLISNGDVLTKGYDSFSHIM-SGYSAGYYGYMWSEVFAA 660

Query: 683 DMYYTKFAADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLKEMGL 738
           DMY+T FA +PL++  G  YRDIIL++GG+ ++ D+LEEFLGREPNN AFLKE+GL
Sbjct: 661 DMYHTMFAPNPLDTSVGTRYRDIILAKGGLRDIEDSLEEFLGREPNNKAFLKELGL 716

>AGR406C Chr7 complement(1472496..1474547) [2052 bp, 683 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 683

 Score =  695 bits (1793), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/688 (49%), Positives = 469/688 (68%), Gaps = 8/688 (1%)

Query: 51  MTNSSLLIAPQPAPTWNWTPEGIVKDAESLIKDSNRIFDNLAAISSPTVENFIVPYMNHE 110
           M + + L+ PQ AP+WN++ + ++  +  LI  +  ++ N+     PT++N+I+P + HE
Sbjct: 1   MKDLASLVPPQAAPSWNFSAQDVISLSHQLINQTEAVYHNVLQEKPPTIDNYIMPLIYHE 60

Query: 111 NKVSPLINQLTFLQHVSADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDN 170
            +   L NQL FL++VS D +IR++S  AT ++ ++ I  + + DL+  FD++W   KD+
Sbjct: 61  EETDLLWNQLVFLRNVSPDPEIREASKNATSMLDDWIIGLTSKYDLYQHFDEVWAQYKDD 120

Query: 171 SEFNEKSDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGE 230
            +F ++    N+E YR++EK    + RSG+ +  E R+ + +++ KIA+  L FS NLGE
Sbjct: 121 EKFKKE----NFELYRYMEKDADGYRRSGMKVPVENRKRLDEVKSKIAAAELEFSSNLGE 176

Query: 231 QKEFIAFTKEELDGVSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKL 290
           + E+IAFTKEEL+GV D V+ QFEK  +   G EKFKVTFKYPDI PVL+ A NP TR+ 
Sbjct: 177 EVEYIAFTKEELEGVPDTVLNQFEKIIE--GGVEKFKVTFKYPDIGPVLRLASNPETRRR 234

Query: 291 AFNADQNKVPENEALFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKT 350
           A  AD+N+V  NE L  +TL+LR +L+ +L + N+A YNL+ KMAKNEETV  FL+DL  
Sbjct: 235 ASMADENRVAANEPLLFETLELRRELADLLGFKNFAAYNLDDKMAKNEETVLKFLNDLVE 294

Query: 351 KLRPXXXXXXXXXXXXXXXDMKELNLPYDNHYYIWDHRYYDNKYLKDNFNVDLEKISEYY 410
           KL P               D K  NL +D  +Y WD  YY NK L++ +NV+ + +++Y+
Sbjct: 295 KLLPVGKNDLEILKKKKAEDYKSKNLTFDGEFYSWDTGYYTNKILRERYNVNPDDLAQYF 354

Query: 411 PIESSIDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFD 470
           P+ES+I+GML IY T+ +LKFVE TD  +++VWHEDVKQ +VW +D+ D P+F GW+YFD
Sbjct: 355 PVESAIEGMLNIYTTLFRLKFVEITDECEKSVWHEDVKQFAVWNIDDEDNPKFQGWLYFD 414

Query: 471 LHPRDGKYGHAANFGISSSYVDENDKRSYPVTALVCNFSKPTSDKPSLLKHNELTTFFHE 530
           LHPRDGKYGHAANFG+ S+Y   +  +SYPVT LV NFSKPT  +P+LLK  ELTTFFHE
Sbjct: 415 LHPRDGKYGHAANFGMVSAYRKRDGSKSYPVTILVTNFSKPTPTRPALLKLGELTTFFHE 474

Query: 531 LGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKHYKTGEKIPE 590
           LGHGIHDLVG+N    LNGPGSVPWDFVEAPSQMLE+WT  ++ L  LSKHY+TGEKIP+
Sbjct: 475 LGHGIHDLVGSNDLESLNGPGSVPWDFVEAPSQMLEYWTARRDVLTMLSKHYETGEKIPK 534

Query: 591 SLIESLVSTKHVNGALFALRQLHFSTFDMEVHTAEDVSKLNLLELWNGLREQICLVENGD 650
           SL+++  S   +N  L  L QL    FDM VHT  D     + +LWN L  +I L+   +
Sbjct: 535 SLLDAWFSVGGLNSGLANLGQLKLGLFDMYVHT-RDYKGAEVRKLWNDLTREIGLMNLKN 593

Query: 651 EMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFAADPLNSKSGVEYRDIILSRG 710
             S GYDSFGHIM           +W++VFA DMY TKF  +P N+  GVEYRD IL+ G
Sbjct: 594 YTSTGYDSFGHIM-AGYAAGYYGYLWSQVFAADMYDTKFKPNPFNATVGVEYRDTILATG 652

Query: 711 GIYEVNDNLEEFLGREPNNSAFLKEMGL 738
           G+Y++ DNL +FLGR+PNN AFL+ +GL
Sbjct: 653 GLYDMTDNLRKFLGRDPNNKAFLRGLGL 680

>AGR405C Chr7 complement(1469769..1471922) [2154 bp, 717 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); Tandem gene duplication in this genome
          Length = 717

 Score =  657 bits (1694), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/684 (46%), Positives = 455/684 (66%), Gaps = 8/684 (1%)

Query: 57  LIAPQPAPTWNWTPEGIVKDAESLIKDSNRIFDNLAAISSP-TVENFIVPYMNHENKVSP 115
           L+ PQP P WN+T   ++  A  L + S+ +++++ +     T++N+I P + ++ +   
Sbjct: 12  LVPPQPPPVWNYTATEVIDLAYGLAQKSDAVYESVFSQKDEFTLDNYIWPLLYNDQETDL 71

Query: 116 LINQLTFLQHVSADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNE 175
           L NQL FL++VS D  +R++S+   +++  +    S + DL+  F+ IWT  KD+ EF  
Sbjct: 72  LWNQLIFLRNVSPDPKVREASLSTGKILDQWVANISSKYDLYTNFEHIWTQYKDDEEFK- 130

Query: 176 KSDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKEFI 235
                NYE Y+++EK    + R+  NL++ +   +  + +KI+ ++L FS NLGE+ E+I
Sbjct: 131 ---VTNYELYKYMEKDASYYNRNKRNLTNAESIELGQVTRKISVDTLQFSINLGEETEYI 187

Query: 236 AFTKEELDGVSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNAD 295
            FT+EEL+GVS  V++QFE+  +   G +K KVTFKYPDI PVL++A NP TR+ A+ AD
Sbjct: 188 TFTEEELEGVSPLVLDQFERIIE--GGVKKLKVTFKYPDIGPVLRTATNPETRRKAYVAD 245

Query: 296 QNKVPENEALFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPX 355
           QN+V  NE L  +TL LR  ++ +  Y NYA YNL  KMAKNEETV  FL DL  +L P 
Sbjct: 246 QNRVAANEQLLFETLDLRRRMAQLRGYKNYAEYNLRDKMAKNEETVIPFLTDLVERLLPV 305

Query: 356 XXXXXXXXXXXXXXDMKELNLPYDNHYYIWDHRYYDNKYLKDNFNVDLEKISEYYPIESS 415
                         D K  NL +D   Y WD+ YY+NK L++ + +D E +++Y+PIES 
Sbjct: 306 GEKDREILKSKKAEDYKSKNLTFDGEIYAWDNAYYNNKILQEKYQIDPEDMAQYFPIESV 365

Query: 416 IDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRD 475
           I+GML  Y+T+ +LKFVE TDP+++NVWHEDVKQ +VW +D+ D PEF GWIYFDL+PRD
Sbjct: 366 IEGMLDTYQTLFRLKFVEVTDPSQKNVWHEDVKQFAVWNIDDEDCPEFQGWIYFDLYPRD 425

Query: 476 GKYGHAANFGISSSYVDENDKRSYPVTALVCNFSKPTSDKPSLLKHNELTTFFHELGHGI 535
           GKY HAANFG++S++  ++  +SYPVT LVCN +KPT  + ++L+  E+TT FHELGHGI
Sbjct: 426 GKYSHAANFGMASAFRKKDGSQSYPVTVLVCNLTKPTPTRTAILRPGEITTLFHELGHGI 485

Query: 536 HDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKHYKTGEKIPESLIES 595
           H LV  N+ +  N  GSVPWDFVEAPSQMLE+WT  ++ L  LSKHY+TGEKIP SL+++
Sbjct: 486 HHLVANNKLAAHNSLGSVPWDFVEAPSQMLEYWTGRRDVLTMLSKHYETGEKIPPSLLDA 545

Query: 596 LVSTKHVNGALFALRQLHFSTFDMEVHTAEDVSKLNLLELWNGLREQICLVENGDEMSKG 655
             ++  +   L+ L QL    FDM VHT E    L + +LWN +R +I L+ + +  S G
Sbjct: 546 WFNSSGLGSGLYYLGQLRLGLFDMYVHTRE-YHGLEVRKLWNDMRREISLINSQNYTSTG 604

Query: 656 YDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFAADPLNSKSGVEYRDIILSRGGIYEV 715
           Y++FGHIM           +W++VFA DMY TKF ++P NS  G +YRD IL+ GG+Y++
Sbjct: 605 YNTFGHIMTGSYSAGYYGYLWSQVFAADMYQTKFKSNPFNSTVGRQYRDTILAPGGLYDM 664

Query: 716 NDNLEEFLGREPNNSAFLKEMGLN 739
           NDNL +FLGREPNN AFL+ +G N
Sbjct: 665 NDNLRKFLGREPNNRAFLRGLGFN 688

>ABR185W Chr2
           (758126..758380,758380..758709,758709..759029,
           759033..759122,759122..759499) [1374 bp, 457 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YCL057W
           (PRD1); 3-intron; artificial frameshift
          Length = 457

 Score =  380 bits (975), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 201/416 (48%), Positives = 265/416 (63%), Gaps = 11/416 (2%)

Query: 326 ANYNLEMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXXXXXXXXDMKELNLPYDNHYYIW 385
           A Y LE+K AKN + V +FL+DL+ KL+P               + KEL   YD   Y  
Sbjct: 49  AAYVLEVKTAKNVDNVNSFLNDLREKLKPASADNWRPLKKLKEQECKELGNFYDGELYSQ 108

Query: 386 DHRYYDNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEETDPAKRNVWHE 445
           D  YY+ K L+DNF+VD E+ ++Y+P+E +I  ML  Y T+ +  FVEET+PA RNVWHE
Sbjct: 109 DLCYYEQKLLRDNFSVDEEETAQYFPLEHTIKFMLDTYNTLFRHNFVEETEPATRNVWHE 168

Query: 446 DVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSSYVDENDKRSYPVTALV 505
           D KQ SVWKMD+ DAP+F GW+YFDLHPRDGK+GH A F    + + E   R YPVT+LV
Sbjct: 169 DDKQYSVWKMDDWDAPQFTGWLYFDLHPRDGKFGHLACFDNVYTDMSEEGSRVYPVTSLV 228

Query: 506 CNFSKPTSDKPSLLKHNELTTFFHELGHGIHDLVGANR--CSRLNGPGSVPWDFVEAPSQ 563
           CNFS P+ +KP+LLKH E+  FFHELGHG H L+ A    CS       VP DF+EAPSQ
Sbjct: 229 CNFSNPSKEKPALLKHYEVQAFFHELGHGSHKLLCAPELCCSS----SWVPRDFIEAPSQ 284

Query: 564 MLEFWTWNKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVHT 623
           MLE+W W K+ +  LSKH +TGE+IPESL++ +V +K  N A+  L Q+  +  DM VH 
Sbjct: 285 MLEYWIWRKDVITDLSKH-ETGERIPESLVDCMVKSKRANAAIDNLIQV-LALLDMAVHK 342

Query: 624 -AEDVSKLNLLELWNGLREQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFAT 682
                  L+L  LWN L E + L++N  E ++ Y SF HI+            W++VFA 
Sbjct: 343 HVGSYETLDLNALWNNLCEDVILIKN-PEPTRAYCSFSHIV-EGYAAGYYGYQWSKVFAA 400

Query: 683 DMYYTKFAADPLNSKSGVEYRDIILSRGGIYEVNDNLEEFLGREPNNSAFLKEMGL 738
           DMY+++F    L+   G  Y D I++RGG+YE+ DNL EFL REPNN A+L++ GL
Sbjct: 401 DMYFSRFEKAHLDPTLGKLYGDTIIARGGLYEMEDNLGEFLDREPNNEAYLRDQGL 456

 Score = 40.4 bits (93), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 26/41 (63%)

Query: 60  PQPAPTWNWTPEGIVKDAESLIKDSNRIFDNLAAISSPTVE 100
           PQPAP+W+ +P  I    ++ ++ + R+F  LA +  PTVE
Sbjct: 7   PQPAPSWDLSPAQINDKVQTALESAARMFAELANVKLPTVE 47

>KAFR0D02950 Chr4 complement(581305..583638) [2334 bp, 777 aa] {ON}
           Anc_2.432 YKL134C
          Length = 777

 Score =  168 bits (425), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 163/676 (24%), Positives = 301/676 (44%), Gaps = 54/676 (7%)

Query: 69  TPEGIVKDAESLIKDSNRIFDNLAAISSPT-VENFIVPYMNHENKVSPLINQLTFLQHVS 127
           TPEG++  +++ +  +N +   +   ++   +  +IV      + +  +I+   F++ V 
Sbjct: 89  TPEGLLTFSKASLWKANELVKIMKNDNTKQGLLKYIVRLDQLSDTLCRVIDLCEFIRSVH 148

Query: 128 ADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRF 187
            DK+   ++ +  E  + FE   +L  D+ +  DK+ T + DN   ++ S+ +       
Sbjct: 149 PDKEFLSAAQQCHE--EMFEFMNTLNTDVEL-CDKLKTLLHDNEILSKLSEEEIKVGRIL 205

Query: 188 IEKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQK-EFIAFTKEELD--G 244
           +E    DF +SG+ ++   RE   ++ ++I+    +F  N  + K  +I     +L+  G
Sbjct: 206 LE----DFEKSGIYMNPRIREQFIELSQEISLIGQDFINNANQPKTNYIKVNASKLESAG 261

Query: 245 VSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEA 304
           ++  ++   +K        E +K+    P    VLK  KN   R   + A  +   E   
Sbjct: 262 LNRLLLNSLKK----DAIRENYKIPTYGPTPYAVLKDCKNEEVRADIWTALHSCSSEQIL 317

Query: 305 LFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXXX 364
                +KLR  L+ ++   +++ Y L+ K+AK  + V NF++ L   +RP          
Sbjct: 318 RLSHLVKLRAMLANLMGAESFSQYQLKGKLAKAPKDVKNFIETLIKYVRPNTEKELKFIA 377

Query: 365 XXXXXDMKELNLPYDNHYYI----WDHRYYDNKYLKDNFNVD---LEKISEYYPIESSID 417
                D  ++N    +        WD  YY + Y K     +    E +S Y+ +    +
Sbjct: 378 DLKREDQGKINCGEMDGVLSTVRPWDRDYYSSIYFKGKEKTEHEFTEPLSSYFTLGGVFE 437

Query: 418 GMLKIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGK 477
           G+  +   +  +K +E   P     W  DV++++V      +    IG IYFDL  R GK
Sbjct: 438 GLSDLLTQIYGIK-LEPAIPVSGETWFNDVRKINVI----SEEEGIIGIIYFDLFERYGK 492

Query: 478 YGHAANFGISSS---YVDENDKR-------------SYPVTALVCNFSKPT--SDKP-SL 518
             + A+F +  S   Y +EN                  P+ +LVCNFS+ T  SDK   L
Sbjct: 493 TSNPAHFTVCCSREMYPEENADSIIQLGSKKDGTIFQLPIISLVCNFSRRTFQSDKTICL 552

Query: 519 LKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISL 578
           L  +E+ T FHE+GH IH ++G      ++G      DFVE PS ++E +  +   L  +
Sbjct: 553 LTLSEIETLFHEMGHAIHSMLGRTTLQNVSGTRCAT-DFVELPSILMEHFASDTRVLKKM 611

Query: 579 SKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVHT---AEDVSKLNLLEL 635
           S HY+TGEKI E  ++  +       +     Q   +  D E+H+     ++  LN++E+
Sbjct: 612 SCHYETGEKIAEKKLQFHLKEGEFLRSCETFSQAKMAMLDQELHSDKIIHNLDNLNVVEI 671

Query: 636 WNGLREQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFAADPLN 695
           +  L  ++ ++   D+ S     FGH+            ++    A  ++   FA DP N
Sbjct: 672 YQNLERRLQVLV--DDRSNWCGKFGHLF--GYGATYYSYLFDRAIARKVWNHLFANDPFN 727

Query: 696 SKSGVEYRDIILSRGG 711
             +G ++++ +L  GG
Sbjct: 728 KTNGEKFKESLLKWGG 743

>NDAI0E02010 Chr5 complement(404579..406915) [2337 bp, 778 aa] {ON}
           Anc_1.9 YCL057W
          Length = 778

 Score =  168 bits (425), Expect = 7e-43,   Method: Compositional matrix adjust.
 Identities = 158/683 (23%), Positives = 302/683 (44%), Gaps = 63/683 (9%)

Query: 69  TPEGIVKDAESLIKDSNRIFDNLAAISSPTVE-NFIVPYMNHENKVSPLINQLTFLQHVS 127
           TP G+ + ++  +  + +I DNL +  S   + NF++      + +  +I+   F++   
Sbjct: 91  TPSGLREFSDVSLAKAKKIIDNLKSDRSLDGKVNFVIELDRLSDTLCRVIDLCEFIRSAH 150

Query: 128 ADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRF 187
            ++   +++    E +  F    +  ++L    ++   D +  S+ +E+     Y     
Sbjct: 151 PEEGFIEAAQDCHEKLFEFMNVLNTDRELCELLNETLQDEQVLSKLSEEEKKVGYILL-- 208

Query: 188 IEKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGE-QKEFIAFTKEELD--G 244
                +DFI+SG+ +   K++    + + I+     +  N+ +  +  I   + ELD  G
Sbjct: 209 -----QDFIKSGIYMDSGKKDQFITLSQDISVIGQEYINNINQLARNHIKVKRSELDNAG 263

Query: 245 VSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEA 304
           +   V  Q  K   + TG+     T+ +   L +LK+  +P  RK  + A  +   +   
Sbjct: 264 IEFDVACQLGK---DITGKYYKIPTYGHLPFL-ILKACTDPEIRKKIWVAMHDCSKQQIE 319

Query: 305 LFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXXXXXX--- 361
              + +K+R  L+  +    YA Y ++ KMAKN + V  FL  L   L+P          
Sbjct: 320 RLTNLVKIRAFLAHTMGRECYAAYAIDGKMAKNPKDVDEFLKSLMDFLKPKAAKELKFIS 379

Query: 362 -----XXXXXXXXDMKELNL---PYDNHYYIWDHRYYDNKYLKDNFNVDLEKISEYYPIE 413
                        D+ E+     P+D  YY   HR      L D++ +D+     YYP+ 
Sbjct: 380 DLIHNEKGEKPSDDVDEILTAVRPWDREYYTAIHRNKQKHLLLDDYALDV-----YYPLG 434

Query: 414 SSIDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHP 473
           + I G+  I+E++  ++F E     K   W  DV++L+V      +    IG IY DL  
Sbjct: 435 NVIQGLSDIFESIYGIRF-EPAVAGKGETWSSDVRRLNVVS----EKEGLIGIIYCDLFR 489

Query: 474 RDGKYGHAANFGISSS---YVDEND-------------KRSYPVTALVCNFSKP---TSD 514
           R GK  +AA+F I  S   Y  E+D             K   P+ +L+CNF+     + +
Sbjct: 490 RQGKTNNAAHFTICCSRQIYPHEDDFSTIQLGTNVDGTKFQLPIISLLCNFNTRCLNSGE 549

Query: 515 KPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNE 574
              LL  NE+ T FHE+GH IH ++G  R   ++G      DFVE PS ++E +  +   
Sbjct: 550 TICLLALNEIETLFHEMGHAIHSMLGRTRLQNVSGT-RCSTDFVELPSVLMEHFARDTRV 608

Query: 575 LISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVH---TAEDVSKLN 631
           L  +  HYKTG+++P +L+   +             Q   +  D  ++     +++  ++
Sbjct: 609 LKRIGHHYKTGDRVPATLLNRYLEKARFLKDCETFSQAKMAMLDQRLYDKNIVQNIDSVD 668

Query: 632 LLELWNGLREQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFAA 691
           ++++++ L +++ ++   D+ S     FGH+            ++    A+ ++   F  
Sbjct: 669 VVKIYHELEKELEVLV--DDESNWCAKFGHLF--GYGATYYCYLFDRAIASKVWKKLFEK 724

Query: 692 DPLNSKSGVEYRDIILSRGGIYE 714
           DP +   G ++++ +L  GG+ E
Sbjct: 725 DPYSRSGGEKFKNDVLKWGGLRE 747

>SAKL0E03938g Chr5 (317017..319320) [2304 bp, 767 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 767

 Score =  166 bits (421), Expect = 2e-42,   Method: Compositional matrix adjust.
 Identities = 166/680 (24%), Positives = 302/680 (44%), Gaps = 63/680 (9%)

Query: 69  TPEGIVKDAESLIKDSNRIFDNLAAISSPT-VENFIVPYMNHENKVSPLINQLTFLQHVS 127
           +P+G+ K     +  +N + + +    SP    N+I       + +  +I+   F++   
Sbjct: 80  SPQGLRKFCRHSLTQANELVETMRHDRSPKGYANYIANLDRLSDILCRVIDLAEFIRASH 139

Query: 128 ADKDIRDSSMKATELIQNFEIEASLRKDLFIQ--FDKIWTDVKDNSEFNEKSDSKNYESY 185
            D     ++    E  + FEI   L  D+ +      + TD    SE +        E  
Sbjct: 140 PDPHFVQAAQDCHE--EMFEIMNVLNTDVALCDILKHVLTDPTILSELSP-------EEI 190

Query: 186 RFIEKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKE-FIAFTKEELD- 243
           +  +   +DF +SG++++ E RE    + ++I+    +F  N    +  +I    EEL+ 
Sbjct: 191 KVGKILLEDFEKSGIHMNPEVREQFIALSQQISVVGQDFINNTEYVRSNYIKVEVEELNK 250

Query: 244 -GVSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILP--VLKSAKNPNTRKLAFNADQNKVP 300
            G++  V+ Q  K  D K    K   TF Y   +P  +L+S  + N R   ++A  +   
Sbjct: 251 SGINKIVLNQLSK--DIKGRHYKIP-TFGY---IPYSILRSCPDDNIRMKVWSALHSCSE 304

Query: 301 ENEALFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXXXXX 360
           +  A     +KLR+ L+ ++   ++A+Y LE KMAK  E V  F+  L    +P      
Sbjct: 305 KQIARLDQLIKLRSVLANIMGKKSFAHYQLEGKMAKTPEYVRGFMQSLIDATKPKAAEEL 364

Query: 361 XXXXXXXXXDMKELNLPYDNHYYI------WDHRYYDNKY-LKDNFNVDLEKISEYYPIE 413
                     +   N P ++ + I      WD  +Y + + L+     + E+IS Y+ + 
Sbjct: 365 KFIADLKAKHVPG-NKPAESMHEILEMVKPWDRDFYGSVHALQQRRPFNNEQISSYFSLG 423

Query: 414 SSIDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHP 473
             I G+  +++ +  + ++E   P     W  +V++++V      +    IG +Y DL  
Sbjct: 424 VVIQGLSNLFKQIYGI-YLEPVVPKTGETWSPEVRRINVVS----EKEGVIGVVYCDLFE 478

Query: 474 RDGKYGHAANFGISSS-------------YVDENDKR---SYPVTALVCNFSKPTSDKP- 516
           R GK  + A+F +  S              V +N K      PV +LVCNFS  T  +  
Sbjct: 479 RQGKTANPAHFTVCCSRQIYDGETDLSTIQVGQNSKGEQFQLPVISLVCNFSPTTISQEQ 538

Query: 517 --SLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNE 574
              LL+ +E+ T FHE+GH +H ++G  +   ++G      DFVE PS ++E +  +   
Sbjct: 539 SICLLQLSEIETLFHEMGHAMHSMLGRTKLQNISGT-RCATDFVELPSILMEHFARDHRV 597

Query: 575 LISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVH---TAEDVSKLN 631
           L  ++ HY TGE IPE L+ S  S         A  Q   +  D E+H     +++  L+
Sbjct: 598 LQRMASHYSTGESIPEQLLFSYQSEVKFLQHAEAFSQAKMAILDQELHGESIMKEMQYLD 657

Query: 632 LLELWNGLREQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFAA 691
           +++L++ L  Q+ ++   D+ S     FGH+            ++    A+ ++   FA 
Sbjct: 658 IVKLYHNLERQLEVL--SDDKSNWCGRFGHLF--GYGATYYSYLFDRAIASKIWQHLFAN 713

Query: 692 DPLNSKSGVEYRDIILSRGG 711
           DP   +SG ++++ +L  GG
Sbjct: 714 DPFCRRSGEKFKNSVLKWGG 733

>KNAG0A06200 Chr1 complement(937577..939946) [2370 bp, 789 aa] {ON}
           Anc_2.432 YKL134C
          Length = 789

 Score =  166 bits (420), Expect = 4e-42,   Method: Compositional matrix adjust.
 Identities = 144/556 (25%), Positives = 251/556 (45%), Gaps = 56/556 (10%)

Query: 193 KDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLG-EQKEFIAFTKEELD--GVSDAV 249
           +DF +SG+ +S + R+   ++ + I+    +F  N    + EFI    EELD  GVS  +
Sbjct: 221 EDFEKSGIYMSTDTRDRFIEMSQDISLVGQDFINNTNWLRSEFIEIASEELDNSGVSPIL 280

Query: 250 MEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDT 309
           + Q             +KV         +L+S KN N RK  + A  +   +        
Sbjct: 281 LRQLTT----TVRGTHYKVPAYGTAPYIILRSCKNENARKAVWTALHSCPDKQINRLTHM 336

Query: 310 LKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXXXXXXXX 369
           +K+R+ LS ++    +A Y L+ KMAK+ E V NF+  L    +P               
Sbjct: 337 VKMRSVLSNIMGKVGFAVYQLQGKMAKSPENVLNFITRLMEHTKPMAAEELKLLANMKLN 396

Query: 370 DMKELNLPYDNH-------YYIWDHRYYDNKYLKD----NFNVDLEKISEYYPIESSIDG 418
           D   L LP  N           WD  YY  K  +     N   + E I+ Y+ + S ++G
Sbjct: 397 D---LGLPEANSEKEILETVRPWDRDYYVAKSQQTRKAKNQLTNHEPINAYFTLGSVLEG 453

Query: 419 MLKIYETVMKLKF-VEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGK 477
           +  +++++  +   V  + P +   W  +V++++V   +N      IG +Y DL  R  K
Sbjct: 454 LSNLFKSIYGISLEVVASIPGE--TWSSEVRRVNVKTENN----NIIGVVYCDLFERKAK 507

Query: 478 YGHAANFGISSS---YVDEND-------------KRSYPVTALVCNFSKPTSDKPSLLKH 521
               A+F +  S   Y +END             K   P+ +LVCNF++ + ++  LL+ 
Sbjct: 508 TSSPAHFTVCCSRELYAEENDPSILQSGVNSRGEKFQLPIISLVCNFARTSDNELCLLQL 567

Query: 522 NELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKH 581
           +E+ T FHE+GH +H ++G  +   ++G      DFVE PS ++E +  +   L  + +H
Sbjct: 568 SEIETLFHEMGHAMHSMLGQTKLQNISGTRCTT-DFVELPSIIMEHFARDPRVLKGIGRH 626

Query: 582 YKTGEKIPESLI-ESLVSTKHV-NGALFALRQLHFSTFDMEVHTAE---DVSKLNLLELW 636
           Y T EK+PE L+ E L ST+++ N   FA  Q   +  D  ++       V  L+++EL+
Sbjct: 627 YITKEKVPEDLLAEELNSTRYLQNCETFA--QAKMAMLDQRLYDNNIIFHVRDLDVVELY 684

Query: 637 NGLREQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFAADPLNS 696
           + L   + ++   D+ +     FGH+            +     A  ++   F  DP + 
Sbjct: 685 HDLERNLEVLV--DDQTNWCGKFGHLF--GYGATYYSYLLDRAIAAKIWDCLFVNDPFSR 740

Query: 697 KSGVEYRDIILSRGGI 712
             G  +++ +L  GG+
Sbjct: 741 TGGENFKNAVLKWGGL 756

>TBLA0I00710 Chr9 (128272..130593) [2322 bp, 773 aa] {ON} Anc_2.432
           YKL134C
          Length = 773

 Score =  157 bits (397), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 162/647 (25%), Positives = 289/647 (44%), Gaps = 61/647 (9%)

Query: 99  VENFIVPYMNHENKVSPLINQLTFLQHVSADKDIRDSSMKATELIQNFEIEASLRKDLFI 158
           + N+I+      + +  +I+   F++    +K    ++ +  E +  F    +L  D+ +
Sbjct: 120 LANYIIRLDQLSDTLCRVIDLCEFIRSCHPEKSFVQAAQECHEHMYAFM--NTLNTDIAL 177

Query: 159 QFDKIWTDVKDNSEFNEKSDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIVKDIQKKIA 218
             D++ T V DN E  ++   +  +  + +    +DF +SG+ +S E R+    + + I+
Sbjct: 178 -CDRLRT-VLDNKEVLKRLTDEEIKVGKLL---LEDFEKSGIQMSPEIRDRFISLSQDIS 232

Query: 219 SNSLNFSKNLG-EQKEFIAFTKEELDGVSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILP 277
               +F  N    +K++I    +E D   D    +++  KD      K     K P    
Sbjct: 233 LAGQDFLNNTSYTEKDYIKIKCDEFDKACDYPALKYKLSKDLSGKYYKIPTYGKIP--YT 290

Query: 278 VLKSAKNPNTRK---LAFNADQNKVPENEALFVDTLKLRNDLSTVLDYSNYANYNLEMKM 334
            L   K+   RK   +AF++  NK  E        +K R +L+ +L  S+Y+ Y LE KM
Sbjct: 291 ALLKCKDEELRKKLWVAFHSCSNKQIER---LTKIIKHRIELAKLLSKSSYSEYTLEGKM 347

Query: 335 AKNEETVFNFLDDLKTKLRPXXXXX----XXXXXXXXXXDMKELNLPYDNHYYIWDHRYY 390
           AK  + V NFL+ L   + P                    ++       N+   WD  YY
Sbjct: 348 AKGPKEVNNFLNALLKSILPEVTKELEPISNKKCLSEGFSLETSEQSILNNIKPWDRDYY 407

Query: 391 DNKYLKDNFNVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEETDPAK---RNVWHEDV 447
            N     +       I EY+ + + I G+  ++ ++  ++F    +P K      W +DV
Sbjct: 408 -NPIQATSEGAYQMLIMEYFTLGNIIHGLSNLFNSIYGIRF----EPGKIEDGETWSKDV 462

Query: 448 KQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSS---YVDENDKRS------ 498
           ++L+V   D       IG IY DL  R+GK    +++ I  S   Y +E+D  +      
Sbjct: 463 RKLNVISEDEG----LIGVIYCDLFEREGKSESPSHYTICCSREIYSEEHDLSTIQTGVN 518

Query: 499 --------YPVTALVCNF---SKPTSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRL 547
                    P+ +LVCNF   +   S +   L+H+E+ T FHE+GH +H ++G  R   +
Sbjct: 519 NKTGKNFQLPIVSLVCNFQVTNAKESRRICFLQHHEIETLFHEMGHAMHSMLGRTRFQTI 578

Query: 548 NGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKHYKTGEKIP-ESLIESLVSTKHVNGAL 606
           +G   V  DFVE PS ++EF+  N   LI +S+HY +GE I  E L + L +TK    A 
Sbjct: 579 SGTRCVS-DFVEIPSILMEFFANNPKVLIDISRHYDSGESIDIEVLNKYLENTKQFK-AC 636

Query: 607 FALRQLHFSTFDMEVHT--AEDVSKLNLLELWNGLREQICLVENGDEMSKGYDSFGHIMX 664
               Q   +  D  +H   A  +  ++++E+++ L +++ ++   D  S     FGH+  
Sbjct: 637 ETYSQGKMALLDQRLHAENANSLDNIDVVEIYHNLEKELSVLP--DTESNWCGRFGHLY- 693

Query: 665 XXXXXXXXXXMWAEVFATDMYYTKFAADPLNSKSGVEYRDIILSRGG 711
                     ++    AT ++ + F  DP + K G  +++ +L  GG
Sbjct: 694 -GYGALYYCYLFDRAIATKIWESLFQNDPFSRKGGNIFKEQLLKWGG 739

>ZYRO0G20130g Chr7 (1666665..1669025) [2361 bp, 786 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 786

 Score =  156 bits (395), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 161/679 (23%), Positives = 299/679 (44%), Gaps = 59/679 (8%)

Query: 69  TPEGIVKDAESLIKDSNRIFDNLAAISSPT-VENFIVPYMNHENKVSPLINQLTFLQHVS 127
           +P+G+ K +   +  +  + +++    +P  ++N+I+      + +  +I+   F++   
Sbjct: 97  SPDGLRKFSRQSLNQAYELLEDMKNDETPQGLQNYILRLDQLSDTLCRVIDLCEFIRSSH 156

Query: 128 ADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRF 187
            D    D++    E  + FE    L  D+ +  +K+ T V +  E   K  S+  +  + 
Sbjct: 157 PDSHFVDAAQDCHE--EMFEFMNVLNTDVNL-CNKLRT-VLNTPEVVCKLSSEEVKVGKI 212

Query: 188 IEKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLG-EQKEFIAFTKEEL--DG 244
           +    +DF +SG+ ++ E RE    + ++I+    +F  N    +  +I    E +   G
Sbjct: 213 L---LEDFEKSGIYMNPEIREQFIALSQEISIVGQDFINNTDFVRTNYITVDCETIHNSG 269

Query: 245 VSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEA 304
           ++  ++ Q  K  D K   + +K+         VL++  +   RK  + A  +  P+ + 
Sbjct: 270 INQLILSQLSK--DIKG--KHYKIPTHGYIAYSVLRACPDEIVRKKLWTA-MHSCPDKQI 324

Query: 305 LFVDTL-KLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXX 363
           + +D L +LR  L+ ++   +YA Y LE KMAK+ E V +F+D L    +P         
Sbjct: 325 VRLDQLVRLRAVLAFLMGKKSYAEYQLEGKMAKSPEEVTDFIDSLIKVTQPKAKQELGFI 384

Query: 364 XXXXXXDM-----KELNLPYDNHYYIWDHRYYDNKY---LKDNFNVDLEKISEYYPIESS 415
                  M     +  NL   +    WD  +Y   Y    +    +D ++IS Y+ + + 
Sbjct: 385 SDLKRKHMDLPPSETSNLDTLDIVRPWDRDFYHTIYSIQQRRQSPIDDQQISMYFTLGNV 444

Query: 416 IDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRD 475
           + G+  ++  +  ++ +E     K   W  +V++L+V      D    IG +Y DL  RD
Sbjct: 445 MQGLSDLFHQIYGIR-LEPVIAQKGETWSPEVRRLNVVS----DEEGVIGVVYCDLFERD 499

Query: 476 GKYGHAANFGISSS---YVDEND-------------KRSYPVTALVCNFSKPT---SDKP 516
           GK  + ++F +  S   Y  END             K   P+ +LVCNF+          
Sbjct: 500 GKTSNPSHFTVCCSRQIYPKENDLSTIQIGTNKDGTKFQLPIISLVCNFASSVVSFGQSL 559

Query: 517 SLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELI 576
            LL  +E+ T FHE+GH +H ++G  R   L+G      DFVE PS ++E +  +   L 
Sbjct: 560 CLLHISEIETLFHEMGHAMHSMLGRTRLQNLSGT-RCATDFVELPSILMEHFARDTRVLR 618

Query: 577 SLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVHTAEDVSKLNLLE-- 634
            + KH  TGE +PESL+ + +             Q   +  D  +H  E ++ ++ L+  
Sbjct: 619 QIGKHCNTGEPVPESLLTNYLQDLQYMQYCETFSQAKMAMLDQRLHGKEIITGMDTLDVV 678

Query: 635 -LWNGL-REQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFAAD 692
            L+  L RE   LV   D+ S     FGH+            ++    A+ ++ + F  D
Sbjct: 679 ALYQNLERELRVLV---DDQSTWCGRFGHLF--GYGATYYSYLFDRAIASKVWESLFQED 733

Query: 693 PLNSKSGVEYRDIILSRGG 711
           P +   G  +++ +L  GG
Sbjct: 734 PFSRAGGQRFKEYVLKWGG 752

>CAGL0D02112g Chr4 complement(216204..218489) [2286 bp, 761 aa] {ON}
           similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134c MIP1
          Length = 761

 Score =  156 bits (395), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 140/557 (25%), Positives = 251/557 (45%), Gaps = 60/557 (10%)

Query: 194 DFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLG-EQKEFIAFTKEELD--GVSDAVM 250
           DF +SG+ +    RE   ++ ++I+     F  N     KEFI   ++E+D  G+S  + 
Sbjct: 194 DFEKSGIYMKAGIREQFIELSQQISVIGQEFINNTDYVAKEFIKVKRDEMDKSGISPLLT 253

Query: 251 EQFEKFKDEKTGEEKFKVTFKYPDI-LPVLKSAKNPNTRKLAFNADQNKVPENEALFVDT 309
            +  +   + TG  K+     Y  I L +LKS  + + RK  + A  N  P+ +   ++ 
Sbjct: 254 ARLNR---DLTG--KYYKIPTYGQIPLQILKSCPDEDIRKEVWAALHN-CPKAQIQRLNQ 307

Query: 310 L-KLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXXXXXXX 368
           L +LR  LS +L   +Y++Y L+ KMA + E V  F+  L    +P              
Sbjct: 308 LVRLRVILSNLLGKQSYSDYQLDNKMAGSPENVKGFIKTLMNVTKPLAARELEFIAR--- 364

Query: 369 XDMKELNLPYDNHYY---------IWDHRYYDNKYLKDN--FNVDLEKISEYYPIESSID 417
               +LN P   H            WD  Y+ +KY  DN    +  E++  Y+ + + I+
Sbjct: 365 ---DKLNAPDSRHMSDNEILSIVKPWDKNYFSSKYDSDNEMAMIRDEQLRYYFSLGNVIN 421

Query: 418 GMLKIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGK 477
           G+ ++++ +  +  ++ +       W  DV++L V      +    +G IY DL  R GK
Sbjct: 422 GLSELFKRIYGIT-LQPSRTENGETWSPDVRRLDVIS----EEEGLVGVIYCDLFERVGK 476

Query: 478 YGHAANFGISSS---YVDENDKRS-------------YPVTALVCNFSK---PTSDKPSL 518
             + A+F +  S   Y DEND  +              PV +LVCNFS    P  ++   
Sbjct: 477 ISNPAHFTVCCSRQVYPDENDFTTIQTGQNSDGTVFQLPVISLVCNFSTVALPNGNRTCF 536

Query: 519 LKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISL 578
           L  NE+ T FHE+GH +H ++G  R   ++G      DFVE PS ++E +  +   L ++
Sbjct: 537 LHMNEIETLFHEMGHAMHSMLGRTRLQNISGTRCAT-DFVELPSILMEHFARDIRVLRTI 595

Query: 579 SKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVHTA---EDVSKLNLLEL 635
             HY+T E  PE+L+   +             Q   +  D ++H +    D+ +++  ++
Sbjct: 596 GSHYETSEPAPEALLNDYLDKTQFLQHCETYSQAKMAMLDQKLHGSFSLSDIERIDSAKI 655

Query: 636 WNGLREQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFAADPLN 695
           +  L  ++ ++   D+ S     FGH+            ++    A+ ++ + F  DP N
Sbjct: 656 YQKLETRLQVL--ADDESNWCGRFGHLF--GYGATYYSYLFDRAIASKVWDSLFKDDPFN 711

Query: 696 SKSGVEYRDIILSRGGI 712
              G ++++ +L  GG+
Sbjct: 712 RTGGEKFKERVLKWGGL 728

>Skud_11.93 Chr11 complement(175243..177561) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  154 bits (389), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 160/676 (23%), Positives = 302/676 (44%), Gaps = 53/676 (7%)

Query: 69  TPEGIVKDAESLIKDSNRIFDNLAAISSPTVE-NFIVPYMNHENKVSPLINQLTFLQHVS 127
           +P+G+ K ++  +K +  + + +   S+ + + ++I+      + +  +I+   F++   
Sbjct: 85  SPDGLRKFSQVSLKQAQTLLEKMRNDSTESGKLSYIINLDRLSDTLCRVIDLCEFIRSTH 144

Query: 128 ADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRF 187
            D     ++    E  Q FE    L  D  +    I   V ++ E + K   +  +  + 
Sbjct: 145 PDDKFVKAAQDCHE--QMFEFMNVLNTD--VSLCNILKSVLNSPEVSSKLSDEELKVGKI 200

Query: 188 IEKCHKDFIRSGLNLSDEKREIVKDIQKKIA---SNSLNFSKNLGEQKEFIAFTKEELDG 244
           +     DF +SG+ ++ + RE   ++ ++I+      +N +   G     I     +   
Sbjct: 201 L---LDDFEKSGIYMNPDVREKFIELSQEISLIGQEFINHTDYPGSNSVKIPCKDLDNGN 257

Query: 245 VSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEA 304
           VS  +++Q  K   +  G+     TF Y     +LKS +    RK  + A  +   +   
Sbjct: 258 VSAFLLKQLNK---DVKGQNYKIPTFGYA-AYALLKSCEKEEVRKKLWTALHSCSDKQIK 313

Query: 305 LFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXXX 364
                +KLR  L+ +++  +YA Y LE KMAKN + V +F+  L                
Sbjct: 314 RLSHLIKLRAILANLMNKESYAEYQLEGKMAKNPKDVQDFILTLMNGTIDKTANELKFIA 373

Query: 365 XXXXXDMKE-LNLPYDNHYYI---WDHRYYDNKYLKDNFN--VDLEKISEYYPIESSIDG 418
                D+K+ L    D+   +   WD  YY  KYL+ N +   + ++IS Y+ + + I+G
Sbjct: 374 ELKTKDLKKPLATKTDDILRLVRPWDRDYYTGKYLQLNPSDAPNAKEISYYFTLGNVIEG 433

Query: 419 MLKIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGKY 478
           +  +++ +  ++   E    +   W  DV++L+V      +    IG IY DL  R+GK 
Sbjct: 434 LSDLFQHIYGIRLEPEI-ADEGETWSPDVRRLNVIS----EEEGIIGIIYCDLFERNGKT 488

Query: 479 GHAANFGISSS-------------YVDENDKRSY---PVTALVCNFSK-PTSDKPSL--L 519
            + A+F +  S              V EN   SY   PV +LVCNF+  P + K +L  L
Sbjct: 489 SNPAHFTVCCSRQIYPNETDFSTIQVGENPDGSYFQLPVISLVCNFAPIPIASKKTLCFL 548

Query: 520 KHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISLS 579
           + +E+ T FHE+GH +H ++G      ++G      DFVE PS ++E +  +   L  +S
Sbjct: 549 QLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTKIS 607

Query: 580 KHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVHTAE---DVSKLNLLELW 636
           KHY+TGE I   +++S + T +         Q   +  D   H  E   D+   ++++ +
Sbjct: 608 KHYETGETIQAGMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHDEEIISDIDNFDIVKNY 667

Query: 637 NGLREQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFAADPLNS 696
             L  ++ ++   D+ S     FGH+            ++    A+ ++Y  F  DP + 
Sbjct: 668 QALERRLKVLV--DDQSNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSR 723

Query: 697 KSGVEYRDIILSRGGI 712
           K+G +++  +L  GG+
Sbjct: 724 KNGDKFKKHLLKWGGL 739

>Ecym_6099 Chr6 complement(186647..188968) [2322 bp, 773 aa] {ON}
           similar to Ashbya gossypii AFR198W
          Length = 773

 Score =  150 bits (380), Expect = 3e-37,   Method: Compositional matrix adjust.
 Identities = 166/693 (23%), Positives = 312/693 (45%), Gaps = 96/693 (13%)

Query: 69  TPEGIVKDAESLIKDSNRIFDNLAAISS-PTVENFIVPYMNHENKVSPLINQLTFLQHVS 127
           +P+G+ + A    KD+  I   L   +S   ++++I+      + +  +I+   F++   
Sbjct: 93  SPDGLRRFARKSRKDAEAIVKQLREDTSFDALKSYIIRLDQLSDILCRVIDLCEFIRASH 152

Query: 128 ADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRF 187
            D +   ++ +  E  + FEI   L  D+ +    +  +V  N    ++  S   E  R 
Sbjct: 153 PDDNFVTAAQECHE--EMFEIMNVLNTDVVLC--NVLKEVLTNESIRKELSS---EEIRV 205

Query: 188 IEKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKEFI--AFTKEELD-- 243
                +DF +SG+ ++ + RE   ++ + I+     F  N     E++  +F + E D  
Sbjct: 206 GHILLEDFEKSGIYMNPKVRERFIELSQVISIVGQEFITN----TEYVGTSFVEIETDVL 261

Query: 244 ---GVSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILP--VLKSAKNPNTRKLAFNADQNK 298
              GVS  V++Q  K   + +G+     T+ Y   LP  ++++  +   RK  + A    
Sbjct: 262 EASGVSQMVLQQLSK---DLSGKFYKIPTYGY---LPYSIIRTCPSEYIRKKVWTA-MYS 314

Query: 299 VPENEALFVDTL-KLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXX 357
            PE +   +  L +LR  L+ ++   +YA Y LE KMAK+ + V NF++ L    +P   
Sbjct: 315 CPEKQIKRLKKLVRLRQQLAHIMGKPDYATYQLEGKMAKSPKNVKNFMNTLIEYTKPLA- 373

Query: 358 XXXXXXXXXXXXDMKEL----NLPYDNH----------YYIWDHRYYDNKYL----KDNF 399
                        M+EL    ++ +DNH             WD  Y+ +  L    +   
Sbjct: 374 -------------MEELKPLADMKHDNHCKDASEILSSVRPWDRDYFGSMSLLAQPRSVK 420

Query: 400 NVDLEKISEYYPIESSIDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPD 459
            +  + ++ Y+ +   I G+  +++++  ++ +E         W  +V+++ V      +
Sbjct: 421 TMSFQSLNCYFSLGVVIQGLSDLFQSIYGIR-LEPVVAKTGETWDPEVRKIQVIS----E 475

Query: 460 APEFIGWIYFDLHPRDGKYGHAANFGISSS---YVDEND-------------KRSYPVTA 503
           A   IG IY DL  R GK  + A+F +  S   Y +E D             K   PV +
Sbjct: 476 ANGVIGVIYCDLFERQGKTPNPAHFTVCCSRQIYPNETDYSTIQVGSHPDKSKFQMPVIS 535

Query: 504 LVCNFSKPTSDKPS--LLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAP 561
           LVCNFS   +D  S  LL+ +E+ T FHE+GH +H ++G  +   ++G      DFVE P
Sbjct: 536 LVCNFSHTQADDDSICLLQLSEVETLFHEMGHAMHSMLGRTQLQNISGTRCAT-DFVELP 594

Query: 562 SQMLEFWTWNKNELISLSKHYKTGEKIPESLIESLVSTKHVNGAL---FALRQLHFSTFD 618
           S ++E +  +   L  +S HY TGE++P+   E LV+ +  N  L       Q+  +  D
Sbjct: 595 SILMEHFAKDLRVLSRISSHYATGERVPK---EMLVNYQQENRFLEHTETFSQIKMAMLD 651

Query: 619 MEVHTAEDVSKLNLLELWNGLREQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAE 678
             +H+  D S+ +++ +++GL +++ ++   D+ S     FGH+            +   
Sbjct: 652 QRLHSLTDNSE-DIVTVYHGLEKELQVLV--DDRSNWCGRFGHLF--GYGASYYSYLMDR 706

Query: 679 VFATDMYYTKFAADPLNSKSGVEYRDIILSRGG 711
             A  ++   F  DP +   G ++++ +L  GG
Sbjct: 707 AIAAKVWNHLFQHDPFSRAGGEKFKNSVLKWGG 739

>NCAS0A04280 Chr1 complement(864327..866648) [2322 bp, 773 aa] {ON}
           Anc_2.432
          Length = 773

 Score =  150 bits (380), Expect = 4e-37,   Method: Compositional matrix adjust.
 Identities = 146/570 (25%), Positives = 266/570 (46%), Gaps = 61/570 (10%)

Query: 193 KDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKE-FIAFTKEELD--GVSDAV 249
           +DF +SG+ +    R+    + ++I+    +F  N+   K   +     EL+  GV+  +
Sbjct: 204 EDFEKSGIYMDPNIRKQFISLSQEISLTGQDFINNIDLIKSNHVKIKCSELNKSGVNSLL 263

Query: 250 MEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDT 309
           ++Q  K   + TG+     T  Y  I  +++S  +   R   + A  +  P ++   +  
Sbjct: 264 LKQLPK---DITGKYYKIPTSGYIPI-SLIRSCPDATIRAKVW-ASLHSCPNDQIRRLTH 318

Query: 310 L-KLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXXXXXXX 368
           L KLR  L+ +L+  ++A Y LE KMAK  + V +F+  L   +RP              
Sbjct: 319 LVKLRAILAHLLNKCSFAKYQLEGKMAKTPQNVRDFIKTLMDYMRPKAAQELKFMADLK- 377

Query: 369 XDMKELNLPYDNHYYI-------WDHRYYDNKYLKDNFNVDL---EKISEYYPIESSIDG 418
              KELN+P  +           WD  YY   + K   +V+L     I+ Y+ + + + G
Sbjct: 378 --CKELNIPTSDSTTAILDLISPWDREYYTTIHSKAK-DVNLYENHPINMYFTMGNIMKG 434

Query: 419 MLKIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGKY 478
           +  I++ +  ++ +E   P +   W  +V++L+V      +    IG +Y DL  R GK 
Sbjct: 435 LSHIFQRIYGIR-LEAVVPEEGETWSPEVRRLNVIS----ETEGLIGVVYCDLFERAGKT 489

Query: 479 GHAANFGISSS---YVDENDKRS-------------YPVTALVCNFSKP--TSDKP-SLL 519
            + A+F +  S   Y DEND  +              PV +LVCNFS    ++DK   LL
Sbjct: 490 SNPAHFTVCCSRQIYPDENDLSTIQIGTNPDGTAFQLPVISLVCNFSSTLTSNDKMICLL 549

Query: 520 KHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISLS 579
           + NE+ T FHE+GH +H ++G +R   ++G      DFVE PS ++E +  +K  L  + 
Sbjct: 550 QLNEIETLFHEMGHAMHSMLGRSRLQNVSGTRCAT-DFVELPSILMEHFARDKRVLHEIG 608

Query: 580 KHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVHT---AEDVSKLNLLELW 636
            HY+T E++ E +IE+ +             Q   +  D E+++    +D+  +++++++
Sbjct: 609 FHYETNERVSEYVIEAHLKKMKFLQDCETFSQGKMAMLDQELYSENIIKDLDHVDVVKIY 668

Query: 637 NGLREQI-CLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFAADPLN 695
             L E +  LV+N    S     FGH+            ++    A+ ++   FA DP +
Sbjct: 669 QTLEEDLKVLVDNK---SNWCGKFGHLF--GYGASYYSYLFDRAIASKVWDQLFAKDPFS 723

Query: 696 SKSGVEYRDIILSRGGI----YEVNDNLEE 721
            + G ++++ +L  GG+    + + D LE+
Sbjct: 724 REGGEKFKNCVLKWGGLRDPWHCIADVLEQ 753

>AFR198W Chr6 (797448..799778) [2331 bp, 776 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL134C (OCT1)
          Length = 776

 Score =  150 bits (379), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 171/704 (24%), Positives = 300/704 (42%), Gaps = 92/704 (13%)

Query: 59  APQPAPTWNW------TPEGIVKDAESLIKDSNRIFDNLAAISSP-TVENFIVPYMNHEN 111
           APQ A T  +      +PEG+ K A   + ++  +  NL   SS   +  +I+      +
Sbjct: 80  APQVAHTGLFQNPYLNSPEGLRKFANKSLTEATALVRNLREDSSQEGLVRYIIRLDQLSD 139

Query: 112 KVSPLINQLTFLQHVSADKDIRDSSMKATELIQNFEIEASLRKDLFI--QFDKIWTDVKD 169
            +  +I+   FL+    D+    ++ +  E  Q FEI   L  D+ +  +  ++ +D   
Sbjct: 140 ILCRVIDLCEFLRAAHPDEQFVAAAQECHE--QMFEIMNILNTDVVLCKRLKQVLSDENI 197

Query: 170 NSEFNEKSDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIVKDIQKKIA---SNSLNFSK 226
           +S+ +        E  R      +DF ++G   S E R+    + + I+    + +N ++
Sbjct: 198 SSKLSS-------EEIRVGHILLEDFEKAGAYASPEVRKQFIQLSQNISIIGQDFINNTE 250

Query: 227 NLGEQKEFIAFTKEELDGVSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPN 286
           +L      I     E  G S  V+ Q  K  D      K   +   P  L  L +  +  
Sbjct: 251 SLSSSYIKIPCKDLESSGTSHLVLRQLTK--DTMGNNYKIPTSGYAPYTL--LNACPSEA 306

Query: 287 TRKLA----FNADQNKVPENEALFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVF 342
            R+      F+  + +V   ++L    L+LR  L+ ++  ++Y +Y LE KMAK+ E V 
Sbjct: 307 IRRQVWTAMFSCSEKQVKRLKSL----LQLRRKLANIMGATDYVSYQLEGKMAKSPENVK 362

Query: 343 NFLDDLKTKLRPXXXXXXXXXXXXXXXDMKEL--------NLPYDNHYYI---WDHRYYD 391
           NFL+ L    +P               +++EL        NL   N   +   WD  YY 
Sbjct: 363 NFLNTLVDHTKPLAAG-----------ELEELAKLKRNVENLSETNTLKLMRPWDRDYYS 411

Query: 392 N---KYLKDNFNVD-LEKISEYYPIESSIDGMLKIYETVMKLKFVEETDPAKRNVWHEDV 447
           +    + + N  VD    I+ Y+ +   + G+  ++  +  +        A    W  DV
Sbjct: 412 SLSPNFTRPNHRVDGFTSINTYFSLGVVMQGISDLFRDIYGISLKPVVAQAG-ETWAPDV 470

Query: 448 KQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAANFGISSS---YVDEND--------- 495
           ++L V      +    IG IY DL  R GK    ++F +  S   Y +END         
Sbjct: 471 RKLQVIS----ETEGIIGLIYCDLLERPGKTTSPSHFTVCCSRQIYPEENDFSTIQVGEN 526

Query: 496 ----KRSYPVTALVCNFSKPTSDKP---SLLKHNELTTFFHELGHGIHDLVGANRCSRLN 548
               +   PV +L+CNF      K     LL+ +++ T FHE+GH +H ++G  +   L+
Sbjct: 527 PDGSRFQMPVISLICNFRATRHGKNKSLCLLELSDVETLFHEMGHALHSMLGRTQLQNLS 586

Query: 549 GPGSVPWDFVEAPSQMLEFWTWNKNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFA 608
           G   V  DFVE PS ++E +  ++  L+ +S +Y TGE IPE L+ +     +       
Sbjct: 587 GTRCVT-DFVELPSILMEHFAKDRRVLLRISSNYATGEPIPEELLSAFQEQNNFLKNTET 645

Query: 609 LRQLHFSTFDMEVHTAEDVSKLNLLELWNGL-REQICLVENGDEMSKGYDSFGHIMXXXX 667
             Q+  S  D  +H+  D  + +++ +++GL RE   LV   D+ +     FGH+     
Sbjct: 646 FSQIKMSMLDQRLHSITD--QDDIIAVYHGLEREMEVLV---DDQTNWCGRFGHLF--GY 698

Query: 668 XXXXXXXMWAEVFATDMYYTKFAADPLNSKSGVEYRDIILSRGG 711
                  +     A  ++   F  DP +  SG ++++ +L  GG
Sbjct: 699 GASYYSYLMDRAIAAKIWDHLFKKDPFSRSSGEKFKEGVLKWGG 742

>Kpol_297.8 s297 complement(11648..14011) [2364 bp, 787 aa] {ON}
           complement(11648..14011) [2364 nt, 788 aa]
          Length = 787

 Score =  149 bits (375), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 160/681 (23%), Positives = 288/681 (42%), Gaps = 64/681 (9%)

Query: 69  TPEGIVKDAESLIKDSNRIFDNLAAISSPTVENFIVPYMNH-ENKVSPLINQLTFLQHVS 127
           +PEG+   ++  ++ S +I D L +  +P      V  ++   + +  +I+   F++   
Sbjct: 99  SPEGLKLFSQVSLEKSQKIVDKLRSDRTPEGLRLYVQNLDLLSDTLCRVIDLCEFIRSSH 158

Query: 128 ADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRF 187
            D    +++    E  + FE    L  D+ + F      V +N E   K   +     R 
Sbjct: 159 PDYKFVEAAQDCYE--EMFEFMNMLNTDVNLCF--TLKHVLENKEIASKLSEEELRVGRI 214

Query: 188 IEKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKEF-IAFTKEELD--G 244
           +    +DF +SG+ +  E RE    + + I+     F  N    K+  +  +  +LD  G
Sbjct: 215 L---LEDFEKSGIYMKPEVREQFITLSQSISVIGQEFISNTDFVKDNNVVVSCNQLDSLG 271

Query: 245 VSDAVMEQFEKFKDEKTGEEKFKV-TFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENE 303
           +   ++ Q EK        + +K+ T+ Y     +LKS  +   R+  + A  N   E  
Sbjct: 272 IDPELLSQIEK----DIAGKNYKIPTYGYIP-FALLKSCPSEEIREKIWVAVHNCSNEQI 326

Query: 304 ALFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXX------ 357
               D +KLR  LS +L   +YA Y LE KMAKN + V  F+  L    +P         
Sbjct: 327 KRLTDLVKLRAVLSQLLGKKSYAEYQLEGKMAKNPKEVIEFIKTLMDFTKPMAAKELDGI 386

Query: 358 -----XXXXXXXXXXXXDMKELNLPYDNHYYIWDHRYYDNKYLKDNFNVDLEKISEYYPI 412
                            D+ +   P+D  YY    R  +    K+ +    E++ +Y+ +
Sbjct: 387 AEKKLTIKSNGSNLSVCDILKTVRPWDRDYYSAIER--EQTSAKNLYGS--EEVLKYFTL 442

Query: 413 ESSIDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLH 472
            + + G+  +++ +  +K +E   P     W  +V++++V   D       IG IY DL 
Sbjct: 443 GNVMQGLSNLFQKIYGIK-LELDVPKIGETWSPEVRKINVISEDEG----LIGIIYCDLF 497

Query: 473 PRDGKYGHAANFGISSSY---------------VDENDKR-SYPVTALVCNFSKPT---S 513
            R GK  +AA+F I  S                +D    R   P+ +LVCNFSK     +
Sbjct: 498 ERSGKTSNAAHFTICCSRDISPYETEDSTTQIAIDSKGTRFQLPIISLVCNFSKTMISET 557

Query: 514 DKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKN 573
           D    L   E+ T FHE+GH +H ++G  +   ++G      DFVE PS ++E++  +  
Sbjct: 558 DSVCFLHLPEVETLFHEMGHAMHSMLGRTKLQNISGTRCAT-DFVELPSILMEYFARDPR 616

Query: 574 ELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVH---TAEDVSKL 630
            L ++ KHY T E +   ++E  +             Q   +  D  +H    +  +  L
Sbjct: 617 VLETIGKHYLTKETVKREMLEPHLQDLKYLQHCETYSQAKMAMLDQTLHGETISSHLDHL 676

Query: 631 NLLELWNGLREQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFA 690
           ++++L+  L  Q+ ++   D+ S     FGH+            ++    A+ ++   F 
Sbjct: 677 DVVKLYQDLERQLGVLV--DDKSNWCGKFGHLF--GYSAVYYSYLFDRAIASKIWGALFE 732

Query: 691 ADPLNSKSGVEYRDIILSRGG 711
            +P +  SG +YR+ +L  GG
Sbjct: 733 RNPFSRASGDKYRNSVLQWGG 753

>Kwal_26.7616 s26 (444266..446578) [2313 bp, 770 aa] {ON} YKL134C
           (OCT1) - 1:1 [contig 55] FULL
          Length = 770

 Score =  148 bits (374), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 129/550 (23%), Positives = 255/550 (46%), Gaps = 47/550 (8%)

Query: 193 KDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLG-EQKEFIAFTKEELD--GVSDAV 249
           +DF +SG+++  +  E   +I ++I+     F  N    + +++    +ELD  GVS  +
Sbjct: 203 EDFEKSGIDMEPKVGEQFINISQQISIVGQEFINNTDFPRSDYVKIPCKELDSSGVSTLL 262

Query: 250 MEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDT 309
           + Q  +  D K   + +KV         +L+S  N N R   + A  +  PE +   +  
Sbjct: 263 LNQLSR--DLKN--QNYKVPAYGYAAFSILRSCPNENVRMKIWTA-MHSCPEKQISRLKQ 317

Query: 310 L-KLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXXXXXXX 368
           L  LR  L++++   +YA Y L  KMAK+   V  F+  L    +P              
Sbjct: 318 LVMLRGLLASIMGKKSYAEYQLSGKMAKSPVYVRGFVQSLVDVTKPLAAEELRVLAKLKS 377

Query: 369 XDMKELNLPYDNHYYI-----WDHRYYD--NKYLKDNFNVDLEKISEYYPIESSIDGMLK 421
             +  +N+P  +   +     WD  +Y   N   +    ++ E IS Y+ + + + G+ +
Sbjct: 378 GHLG-VNVPQSDADVLRFVRPWDRDFYSTLNALQQQRKTLENEHISSYFSLGTVMQGLSR 436

Query: 422 IYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHA 481
           ++E +  ++ +E         W  +V++++V      +    IG +Y DL  R GK  + 
Sbjct: 437 LFEDIYGIR-LEPVVAKAGETWSPEVRRINVVS----EKEGIIGVVYCDLFERQGKTSNP 491

Query: 482 ANFGISSS---YVDEND-------------KRSYPVTALVCNFSKPTSDKP--SLLKHNE 523
           A+F +  S   Y  E D             K   PV +LVC+F++ ++ +    LL+ ++
Sbjct: 492 AHFTVCCSRTIYPGETDLSTIQVGQLPSGEKFQLPVISLVCSFAQNSASRQGVCLLQLSD 551

Query: 524 LTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKHYK 583
           + T FHE+GH +H ++G      ++G      DFVE PS ++E +  +   L  + +HY 
Sbjct: 552 VDTLFHEMGHAMHSMLGRTSLQNISGT-RCATDFVELPSILMEHFARDSRVLSRIGRHYA 610

Query: 584 TGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVHTAEDVS--KLNLLELWNGLRE 641
           T + IP  L++   +  +         Q   +  D E+H+++ ++  KL++++L++G+ +
Sbjct: 611 TDQPIPTELLKLNQTEMNYLQHTETFSQAKMAMLDQELHSSKALTDGKLDVVKLYHGVEK 670

Query: 642 QICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFAADPLNSKSGVE 701
            + ++   D+ S     FGH++           ++    A+ ++   FA DP N ++G +
Sbjct: 671 DMEVL--ADDQSNWCGRFGHLL--GYGASYYSYLFDRAIASKIWQHLFAEDPFNRENGEK 726

Query: 702 YRDIILSRGG 711
           +++ +L  GG
Sbjct: 727 FKESVLKWGG 736

>Smik_11.102 Chr11 complement(175013..177331) [2319 bp, 772 aa] {ON}
           YKL134C (REAL)
          Length = 772

 Score =  147 bits (372), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 146/551 (26%), Positives = 246/551 (44%), Gaps = 47/551 (8%)

Query: 194 DFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNL---GEQKEFIAFTKEELDGVSDAVM 250
           DF +SG+ ++   RE    + ++I+     F  ++   G     I     +   VS  ++
Sbjct: 204 DFEKSGIYMNPGVREKFIQLSQEISLVGQEFINHIDYPGSNSVKIPCKDLDSSKVSTFLL 263

Query: 251 EQFEKFKDEKTGEEKFKV-TFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDT 309
           +Q  K  D K   + +KV TF Y     +LKS +    RK  + A  +   +        
Sbjct: 264 KQLNK--DVKG--QNYKVPTFGYA-AFALLKSCEIEVVRKKIWTALHSCSDKQIKRLDRL 318

Query: 310 LKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXXXXXXXX 369
           +KLR  L+ ++   +YA Y LE KMAKN + V +F+  L                     
Sbjct: 319 IKLRAVLANLMHKGSYAEYQLEGKMAKNPKDVQDFILTLMNNTIDKTANELKFIADLKAK 378

Query: 370 DMKE-LNLPYDNHYYI---WDHRYYDNKYLKDN-FNVDLEK-ISEYYPIESSIDGMLKIY 423
           D+K+ L    D    +   WD  YY  KY++ N  NV   K IS Y+ + + I G+  ++
Sbjct: 379 DLKKPLTTNTDEILKLVRPWDRDYYTGKYIQLNPSNVPSAKEISYYFTLGNVIQGLSDLF 438

Query: 424 ETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAAN 483
           + +  ++ +E     +   W  DV++L+V      +    IG IY DL  R+GK  + A+
Sbjct: 439 QQIYGIR-LEPAIADEGETWSPDVRRLNVIS----EEEGIIGIIYCDLFERNGKTSNPAH 493

Query: 484 FGISSS-------------YVDENDKRSY---PVTALVCNFSK-PTSDKPSL--LKHNEL 524
           F +  S              V EN   SY   PV +LVCNFS  P + K SL  L+ +E+
Sbjct: 494 FTVCCSRQIYPHETDFSTIQVGENPNGSYFQLPVISLVCNFSPVPIASKKSLCFLQLSEV 553

Query: 525 TTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKHYKT 584
            T FHE+GH +H ++G      ++G      DFVE PS ++E +  +   L  + KHY+T
Sbjct: 554 ETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRVLTRIGKHYET 612

Query: 585 GEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVH---TAEDVSKLNLLELWNGLRE 641
           GE I + +++  + T +         Q   +  D   H      D+   N+++ +  L  
Sbjct: 613 GETIQKGMLQCFMKTTNFLQNCETYSQAKMAMLDQSFHDEKIMSDIDNFNVVDNYQALER 672

Query: 642 QICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFAADPLNSKSGVE 701
            + ++   D+ S     FGH+            ++    A+ ++YT F  DP +  +G +
Sbjct: 673 HLKVLV--DDQSNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYTLFDDDPYSRNNGDK 728

Query: 702 YRDIILSRGGI 712
           ++  +L  GG+
Sbjct: 729 FKKHLLKWGGL 739

>Suva_11.91 Chr11 complement(175327..177654) [2328 bp, 775 aa] {ON}
           YKL134C (REAL)
          Length = 775

 Score =  147 bits (372), Expect = 4e-36,   Method: Compositional matrix adjust.
 Identities = 142/551 (25%), Positives = 252/551 (45%), Gaps = 47/551 (8%)

Query: 194 DFIRSGLNLSDEKREIVKDIQKKIA---SNSLNFSKNLGEQKEFIAFTKEELDGVSDAVM 250
           DF +SG+ ++ + RE    + ++I+      +N +   G     I+  + +   VS  ++
Sbjct: 207 DFEKSGIYMNPDVREKFIQLSQEISLVGQEFINHTDYPGSNSVKISCRELDNSNVSAFLL 266

Query: 251 EQFEKFKDEKTGEEKFKV-TFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDT 309
           +Q  K  D K   + +KV TF Y     +LKS +    RK  + A  +   +        
Sbjct: 267 KQLNK--DVKG--QNYKVPTFGYA-AYALLKSCEKEQVRKKIWTALHSCSDKQIKRLNHL 321

Query: 310 LKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXXXXXXXX 369
           +KLR +L+ ++   +YA Y LE KMAKN + V +F+  L                     
Sbjct: 322 IKLRANLADLMHKGSYAEYQLEGKMAKNPKDVQDFILTLMNDTIDKTATELKFIAELKAK 381

Query: 370 DMKE-LNLPYDNHYYI---WDHRYYDNKYLKDNFN--VDLEKISEYYPIESSIDGMLKIY 423
           D+K+ L    D    +   WD  YY  KYL+ N +     ++IS Y+ + + I G+  ++
Sbjct: 382 DLKKPLATKTDEILKLVRPWDRDYYTGKYLQLNPSNAPSAKEISSYFTLGNVIQGLSDLF 441

Query: 424 ETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHAAN 483
           + +  +K +E     +   W  DV++L+V      +    IG IY DL  R GK  + A+
Sbjct: 442 QHIYGIK-LEPAIADEGETWSPDVRRLNVIS----EEEGIIGIIYCDLFERSGKTSNPAH 496

Query: 484 FGISSS---YVDENDKRS-------------YPVTALVCNFSK-PTSDKPSL--LKHNEL 524
           F +  S   Y +E D  +              PV +LVCNF+  P + K SL  L+ +E+
Sbjct: 497 FTVCCSRQIYPNETDFSTIQLGENADGSFFQLPVISLVCNFAPIPIASKKSLCFLQLSEV 556

Query: 525 TTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKHYKT 584
            T FHE+GH +H ++G      ++G      DFVE PS ++E +  +   L  + KHY+T
Sbjct: 557 ETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTRIGKHYET 615

Query: 585 GEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVHTAEDVSKL---NLLELWNGLRE 641
           GE +   +++S + T +         Q   +  D   H  E +S +   ++++ +  L  
Sbjct: 616 GETVEPDMLQSFMRTTNFLQNCETYSQAKMAMLDQSFHDEEVISNIDNYDVVKNYQALER 675

Query: 642 QICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFAADPLNSKSGVE 701
           ++ ++   D+ S     FGH+            ++    A+ ++Y  F  DP + K+G +
Sbjct: 676 RLKVLV--DDQSNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYSRKNGDK 731

Query: 702 YRDIILSRGGI 712
           ++  +L  GG+
Sbjct: 732 FKKHLLKWGGL 742

>KLTH0D04730g Chr4 (432572..434890) [2319 bp, 772 aa] {ON} similar
           to uniprot|P35999 Saccharomyces cerevisiae YKL134C OCT1
           Mitochondrial intermediate peptidase cleaves N-terminal
           residues of a subset of proteins upon import after their
           cleavage by mitochondrial processing peptidase
           (Mas1p-Mas2p) may contribute to mitochondrial iron
           homeostasis
          Length = 772

 Score =  147 bits (371), Expect = 5e-36,   Method: Compositional matrix adjust.
 Identities = 134/562 (23%), Positives = 260/562 (46%), Gaps = 70/562 (12%)

Query: 193 KDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLG-EQKEFIAFTKEELD--GVSDAV 249
           +DF +SG++++ E  E   ++ ++I+     F  N    + E++  +  EL+  G+S  +
Sbjct: 204 EDFEKSGIDMAPEVGEQFINLSQQISIVGQEFISNTDFPKSEYVKVSCNELETSGISPLL 263

Query: 250 MEQFEKFKDEKTGEEKFKV-TFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVD 308
           +    +     T  + +KV T+ Y     +L+S  + N R   + A  +  PE +   + 
Sbjct: 264 LNHLSR----DTKGQNYKVPTYGYI-AFSILRSCPSENIRMKVWTA-VHSCPEKQITRLK 317

Query: 309 TL-KLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXXXXXX 367
            L KLR  L+ ++  ++Y++Y LE KMAK+   V  F++ L   ++P             
Sbjct: 318 HLVKLRGLLAQIMGKNSYSDYQLEGKMAKSPVYVRGFVESLAEAIKPLAMRELRALANLK 377

Query: 368 XXDMKELNLPYDNHYYI-----WDHRYYDN--KYLKDNFNVDLEKISEYYPIESSIDGML 420
              + +L +P  +   +     WD  +Y       +    ++ E+I+ Y+ + + + G+ 
Sbjct: 378 SSHL-DLPIPKTDEEVLKFVRPWDRDFYSTLISLQQQRKTLENEQINSYFSLGTVMQGLS 436

Query: 421 KIYETVMKLKFVEETDPAKRNV---WHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGK 477
            + E +  ++     +PA   V   W  +V++++V      D    IG +Y DL  R GK
Sbjct: 437 SLLEDIYGIRL----EPAVAKVGETWSPEVRRINVVS----DQEGVIGVVYCDLFERQGK 488

Query: 478 YGHAANFGISSS---YVDENDKRS--------------YPVTALVCNFSKPTSDKP--SL 518
             + A+F +  S   Y +E D  +               PV +LVC+FS+ +  K    L
Sbjct: 489 TSNPAHFTVCCSRQIYPEETDLSTIQVGQQPSSGQIFQLPVISLVCSFSQNSGSKKDVCL 548

Query: 519 LKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISL 578
           L+ +E+ T FHE+GH IH ++G      ++G      DFVE PS ++E +  +   L  +
Sbjct: 549 LQLSEVDTLFHEMGHAIHSMLGRTSLQNISGT-RCATDFVELPSILMEHFAHDSRVLSRI 607

Query: 579 SKHYKTGEKIPESLIESLVSTKHVNGALF-------ALRQLHFSTFDMEVHTAEDVS--K 629
            KHY T E +P+ L+       H+N              Q   +  D E+H+   ++   
Sbjct: 608 GKHYITNEPVPDELL-------HLNQNELKYLQNTETFSQAKMAMLDQEMHSPRMLTDGP 660

Query: 630 LNLLELWNGLREQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKF 689
           ++++E+++ + +Q+ ++   D+ S     FGH++           ++    A+ ++   F
Sbjct: 661 VDVVEIYHEVEKQMGVLT--DDKSNWCGRFGHLL--GYGASYYSYLFDRAIASKVWQHLF 716

Query: 690 AADPLNSKSGVEYRDIILSRGG 711
           A DP + KSG ++++ +L  GG
Sbjct: 717 ANDPFSRKSGEKFKNSVLRWGG 738

>YKL134C Chr11 complement(189124..191442) [2319 bp, 772 aa] {ON}
           OCT1Mitochondrial intermediate peptidase, cleaves
           destabilizing N-terminal residues of a subset of
           proteins upon import, after their cleavage by
           mitochondrial processing peptidase (Mas1p-Mas2p); may
           contribute to mitochondrial iron homeostasis
          Length = 772

 Score =  146 bits (368), Expect = 1e-35,   Method: Compositional matrix adjust.
 Identities = 161/677 (23%), Positives = 295/677 (43%), Gaps = 55/677 (8%)

Query: 69  TPEGIVKDAESLIKDSNRIFDNLAA-ISSPTVENFIVPYMNHENKVSPLINQLTFLQHVS 127
           +P+G+ K ++  ++ +  + D +    S      +I+      + +  +I+   F++   
Sbjct: 85  SPDGLRKFSQVSLQQAQELLDKMRNDFSESGKLTYIMNLDRLSDTLCRVIDLCEFIRSTH 144

Query: 128 ADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNEKSDSKNYESYRF 187
            D     ++    E  Q FE    L  D  +    I   V +N E + K  ++  +  + 
Sbjct: 145 PDDAFVRAAQDCHE--QMFEFMNVLNTD--VSLCNILKSVLNNPEVSSKLSAEELKVGKI 200

Query: 188 IEKCHKDFIRSGLNLSDEKREIVKDIQKKIA---SNSLNFSKNLGEQKEFIAFTKEELDG 244
           +     DF +SG+ ++ + RE    + ++I+      +N +   G     I     +   
Sbjct: 201 L---LDDFEKSGIYMNPDVREKFIQLSQEISLVGQEFINHTDYPGSNSVKIPCKDLDNSK 257

Query: 245 VSDAVMEQFEKFKDEKTGEEKFKV-TFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENE 303
           VS  +++Q  K  D K   + +KV TF Y     +LKS +N   RK  + A  +   +  
Sbjct: 258 VSTFLLKQLNK--DVKG--QNYKVPTFGYA-AYALLKSCENEMVRKKLWTALHSCSDKQV 312

Query: 304 ALFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXX 363
                 +KLR  L+ ++  ++YA Y LE KMAKN + V +F+  L               
Sbjct: 313 KRLSHLIKLRAILANLMHKTSYAEYQLEGKMAKNPKDVQDFILTLMNNTIEKTANELKFI 372

Query: 364 XXXXXXDMKE-LNLPYDNHYYI---WDHRYYDNKYLKDN--FNVDLEKISEYYPIESSID 417
                 D+K+ L    D    +   WD  YY  KY + N   + + ++IS Y+ + + I 
Sbjct: 373 AELKAKDLKKPLTTNTDEILKLVRPWDRDYYTGKYFQLNPSNSPNAKEISYYFTLGNVIQ 432

Query: 418 GMLKIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGK 477
           G+  +++ +  ++ +E     +   W  DV++L+V      +    IG IY DL  R+GK
Sbjct: 433 GLSDLFQQIYGIR-LEPAITDEGETWSPDVRRLNVIS----EEEGIIGIIYCDLFERNGK 487

Query: 478 YGHAANFGISSS-------------YVDENDKRSY---PVTALVCNFSKP-TSDKPSL-- 518
             + A+F +  S              V EN   +Y   PV +LVCNFS    + K SL  
Sbjct: 488 TSNPAHFTVCCSRQIYPSETDFSTIQVGENPDGTYFQLPVISLVCNFSPILIASKKSLCF 547

Query: 519 LKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISL 578
           L+ +E+ T FHE+GH +H ++G      ++G      DFVE PS ++E +  +   L  +
Sbjct: 548 LQLSEVETLFHEMGHAMHSMLGRTHMQNISGTRCAT-DFVELPSILMEHFAKDIRILTKI 606

Query: 579 SKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVH---TAEDVSKLNLLEL 635
            KHY TGE I   +++  + + +         Q   +  D   H      D+   +++E 
Sbjct: 607 GKHYGTGETIQADMLQRFMKSTNFLQNCETYSQAKMAMLDQSFHDEKIISDIDNFDVVEN 666

Query: 636 WNGLREQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFAADPLN 695
           +  L  ++ ++   D+ S     FGH+            ++    A+ ++Y  F  DP +
Sbjct: 667 YQALERRLKVLV--DDQSNWCGRFGHLF--GYGATYYSYLFDRTIASKIWYALFEDDPYS 722

Query: 696 SKSGVEYRDIILSRGGI 712
            K+G +++  +L  GG+
Sbjct: 723 RKNGDKFKKHLLKWGGL 739

>TPHA0G02390 Chr7 complement(486025..488412) [2388 bp, 795 aa] {ON}
           Anc_2.432 YKL134C
          Length = 795

 Score =  142 bits (359), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 160/678 (23%), Positives = 290/678 (42%), Gaps = 60/678 (8%)

Query: 69  TPEGIVKDAESLIKDSNRIFDNLAAISSPTVENFIVPYMNH----ENKVSPLINQLTFLQ 124
           +P G+    +  +  +N I + L      T E  +  Y++      + +  +I+   F++
Sbjct: 106 SPGGLKTFCQHSLMKANGIVEQL---KKDTTEEGLALYISRLDLLSDTLCRVIDLCEFIR 162

Query: 125 HVSADKDIRDSSMKATELIQNFEIEASLRKD--LFIQFDKIWTDVKDNSEFNEKSDSKNY 182
               D +    S +  EL+  FE   +L  D  L      I  D K  S+  +       
Sbjct: 163 SAHPDDEYLKVSQECYELM--FEFMNTLNTDVQLCYTLKHILEDEKICSKLTD------- 213

Query: 183 ESYRFIEKCHKDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGE-QKEFIAFTKEE 241
           E Y+  +   +DF +SG+ +    RE   ++ ++I+     F  N     K  I   +E 
Sbjct: 214 EEYKVGKILLEDFEKSGIYMEPNTREKFIELSQEISLVGQEFISNTDYVTKNNILIDRES 273

Query: 242 LDGVSDAVMEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVPE 301
           L+ +S+  +    + K + TG+  +K+    P    +L +  N   RK  +    +   E
Sbjct: 274 LN-LSELELPFTYQLKTDITGKH-YKIPTTGPIPYSILTNCSNETIRKKIWTELHSCSQE 331

Query: 302 NEALFVDTLKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXXXXXX 361
                   + LR  L+ +L   ++A Y L+ KMAKN E V  F+  L    +P       
Sbjct: 332 QIERLKKMVTLRYKLAKLLKKKSFAEYQLQGKMAKNPEEVKKFISTLLDFTKPLAIKELT 391

Query: 362 XXXXXXXXDMKELNLPYDNHYYI-----WDHRYYD--NKYLKDNFNVDLEKISEYYPIES 414
                   D+  L    D+++ +     WD  YY   N+Y       DL ++  Y+ + +
Sbjct: 392 SLAEVKAADLG-LAFKNDSNFIVNLIRPWDRNYYSKINRYENKQTMEDLNELPYYFSLGN 450

Query: 415 SIDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPR 474
            I G+  ++  +  ++F E   P     W  +V++L+V      ++   IG +Y DL  R
Sbjct: 451 VIAGLSNLFHNIYGIRF-ELAVPKLEETWLPEVRKLNVIS----ESEGLIGIVYCDLFER 505

Query: 475 DGKYGHAANFGISSS------------YVDENDKRS---YPVTALVCNFSKP---TSDKP 516
             K  +AA+F I  S             V  N K +    P+ +L+CNFSK      + P
Sbjct: 506 PSKKTNAAHFTICCSREIGKGEDISTMQVGMNSKGNMFQLPIISLICNFSKSHLFEENGP 565

Query: 517 SLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELI 576
             L+ +E+ T FHE+GH +H ++G  R    +G      DFVE PS ++E +  +   + 
Sbjct: 566 CFLQLHEIETLFHEMGHAMHSVLGRTRLQNTSGTRCAT-DFVELPSILMEHFAKDVRVME 624

Query: 577 SLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVHTA---EDVSKLNLL 633
           S+S HY + E     L+++ + +      L    Q   S  D  +H+    ED   +N++
Sbjct: 625 SISSHYISQEPASPELLQTWLHSTDNLQNLELYTQAKMSMLDQILHSNEIFEDQKDINVV 684

Query: 634 ELWNGLREQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFAADP 693
           + +N L +++ L    D+ S     FGH+            ++    A+ ++ + F  +P
Sbjct: 685 KSYNDLEKKLELF--SDDQSNWCGKFGHLF--GYGASYYSYLFDRAIASKVWESLFKQNP 740

Query: 694 LNSKSGVEYRDIILSRGG 711
            +  SG++++D +L  GG
Sbjct: 741 FSRTSGLKFKDSVLRWGG 758

>KLLA0B12397g Chr2 complement(1084129..1086468) [2340 bp, 779 aa]
           {ON} similar to uniprot|P35999 Saccharomyces cerevisiae
           YKL134C OCT1 Mitochondrial intermediate peptidase
           cleaves N-terminal residues of a subset of proteins upon
           import after their cleavage by mitochondrial processing
           peptidase (Mas1p-Mas2p) may contribute to mitochondrial
           iron homeostasis
          Length = 779

 Score =  137 bits (345), Expect = 8e-33,   Method: Compositional matrix adjust.
 Identities = 138/562 (24%), Positives = 244/562 (43%), Gaps = 65/562 (11%)

Query: 193 KDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKE-FIAFTKEELDG-VSDAVM 250
           +DF +SG+ +  E RE    + ++I+    +F  N    +  +I  + E +D  V+  V 
Sbjct: 205 EDFEKSGIYMKPEIREKFIQLSQEISVIGQDFINNTEYVRSNYIKISCELMDAHVNKMVC 264

Query: 251 EQFEKFKDEKTGEEKFKVTFKY-PDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDT 309
            Q +K   + TGE     T+ Y P  L  L++  +   R   +    +            
Sbjct: 265 SQMKK---DITGEYYKVPTYGYIPHTL--LRTCSDEVIRMKIWTEMHSCSDAQIERLTKL 319

Query: 310 LKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDL--------KTKLRPXXXXXXX 361
           + LR +L+ +L   N+A Y L  KMAK  E V  FL+ L         ++L+P       
Sbjct: 320 ISLRVELAKLLGSQNFAQYQLHGKMAKTPENVSGFLESLVHSTRIKAASELKPLAVLKSE 379

Query: 362 XXXXXX---XXDMKELNLPYDNHYYIWDHRYYDN-KYLKDNFNVDL---EKISEYYPIES 414
                      ++ EL  P       WD  YY + + L    +  L   E IS  + +  
Sbjct: 380 LTGTQTPHTSEEVLELMKP-------WDRDYYGSIQALAQRRSSSLDNGESISSSFSLGV 432

Query: 415 SIDGMLKIYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPR 474
            + G+  ++E +  +K V  T P     W  DV+++ V  +D  D    IG +Y DL  R
Sbjct: 433 VMQGLSDLFEKIYGIKLVPAT-PKTGETWSPDVRRIDV--VDEHDG--LIGVMYCDLFER 487

Query: 475 DGKYGHAANFGISSS---YVDEND-------------KRSYPVTALVCNF-------SKP 511
           +GK  + A+F +  S   Y++E D             K   PV +LVC+F          
Sbjct: 488 EGKTPNPAHFTVCCSRNMYLNEADTSTIQVGVNSNGQKFQLPVISLVCDFRWVEVNMGDG 547

Query: 512 TSDKPSLLKHNELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWN 571
              +  LL+ NE+ T FHE+GH +H ++G  +   ++G      DFVE PS ++E +  +
Sbjct: 548 KHQQMCLLQLNEIETLFHEMGHAMHSMLGRTQLQNVSGTRCAT-DFVELPSILMEHFARD 606

Query: 572 KNELISLSKHYKTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVHTAEDVS--K 629
              L S+S HYKTG+ +   ++++               Q+  S  D E+H  +  +   
Sbjct: 607 TRVLSSISSHYKTGKSLDVEVLKNHQLENQFLQNCETFSQIKMSFLDQELHNLDHTTDGS 666

Query: 630 LNLLELWNGLREQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKF 689
           ++++ +++ L  ++ ++   D+ S     FGH+            ++    A+ ++   F
Sbjct: 667 IDVIAIYHRLERRLAVLP--DDQSNWCGKFGHLF--GYGASYYSYLFDRAIASKIWDHLF 722

Query: 690 AADPLNSKSGVEYRDIILSRGG 711
             DP N  +G ++++ +L  GG
Sbjct: 723 EQDPFNRTNGTKFKEGLLQWGG 744

>TDEL0A02080 Chr1 complement(373425..375788) [2364 bp, 787 aa] {ON}
           Anc_2.432 YKL134C
          Length = 787

 Score =  136 bits (342), Expect = 2e-32,   Method: Compositional matrix adjust.
 Identities = 131/553 (23%), Positives = 239/553 (43%), Gaps = 49/553 (8%)

Query: 193 KDFIRSGLNLSDEKREIVKDIQKKIASNSLNFSKNLGEQKE-FIAFTKEELD--GVSDAV 249
           +DF +SG+ ++ E R+    + ++I+     F  N    +  +I    EE+D  G++  +
Sbjct: 216 EDFEKSGIYMNPEVRDQFIALSQEISLVGQEFINNTDYVRSNYIKIKCEEVDNSGINKLL 275

Query: 250 MEQFEKFKDEKTGEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDT 309
           + Q  K    K     +K+         +L+S  +   R   + A      +        
Sbjct: 276 ISQLPKDVRGKY----YKIPTHGYIAYSILRSCPDEEIRMNLWTAMHRCSDKQINRLDQL 331

Query: 310 LKLRNDLSTVLDYSNYANYNLEMKMAKNEETVFNFLDDLKTKLRPXXXXXXXXXXXXXXX 369
           L+LR  L+ ++   ++A Y LE KMA+  + V +F+  L   +RP               
Sbjct: 332 LRLRAILAKLMGKESFAQYQLEGKMAQTPQQVRDFIGTLVNYMRPKTIEELKFIYELKSK 391

Query: 370 DMKELNLPYDNHYYI------WDHRYYDNKY-LKDNFN-VDLEKISEYYPIESSIDGMLK 421
             K    P  +   I      WD  YY + Y L+   + +D E+IS Y+ + + I G+  
Sbjct: 392 QEKREIQPSPSEQDIASMVRPWDREYYTSMYSLQQRRDAIDDEQISSYFTLGNVIQGLSD 451

Query: 422 IYETVMKLKFVEETDPAKRNVWHEDVKQLSVWKMDNPDAPEFIGWIYFDLHPRDGKYGHA 481
           ++E++  ++ +E   P     +  +V++L+V      +    IG +Y DL  R GK  + 
Sbjct: 452 LFESIYGIR-LEPVVPKTGETFSPEVRRLNVV----CEQEGVIGVVYCDLFERAGKTSNP 506

Query: 482 ANFGISSS----------------YVDENDKRSYPVTALVCNFSKPTSDKP---SLLKHN 522
           ++F +  S                +  E      PV ALVCNFS  T  +     LL+ N
Sbjct: 507 SHFTVCCSRQIYPKETEFSTIQTGFNSEGLMFQLPVIALVCNFSSSTDSEGKSICLLQLN 566

Query: 523 ELTTFFHELGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNELISLSKHY 582
           E+ T FHE+GH +H ++G  R   ++G      DFVE PS ++E +  +   L  + KH+
Sbjct: 567 EVETLFHEMGHAMHSMLGRTRLQNISGT-RCATDFVELPSILMEHFARDVRVLERIGKHH 625

Query: 583 KTGEKIPESLIESLVSTKHVNGALFALRQLHFSTFDMEVH---TAEDVSKLNLLELWNGL 639
           +TG  I E L+ + +             Q   +  D ++H     +D    ++   +  L
Sbjct: 626 RTGAPISEKLLLNYLEETKFMQHCETFSQAKMAMLDQDLHGEKVIKDFDHFDVTAAYQQL 685

Query: 640 -REQICLVENGDEMSKGYDSFGHIMXXXXXXXXXXXMWAEVFATDMYYTKFAADPLNSKS 698
            R+   LV   D+ S     FGH+            ++    A+ ++ + F++DP +  +
Sbjct: 686 ERDMKVLV---DDKSNWCGKFGHLF--GYGATYYSYLFDRAIASKVWDSLFSSDPYSRVN 740

Query: 699 GVEYRDIILSRGG 711
           G ++++ +L  GG
Sbjct: 741 GEKFKECVLKWGG 753

>TPHA0L01660 Chr12 complement(348715..350358) [1644 bp, 547 aa] {ON}
           Anc_8.539 YBR200W
          Length = 547

 Score = 36.2 bits (82), Expect = 0.35,   Method: Compositional matrix adjust.
 Identities = 40/157 (25%), Positives = 65/157 (41%), Gaps = 34/157 (21%)

Query: 453 WKMDNPDAPEFIGWI---YFDL--HPRDGKYGHAANFGISSSYVDENDKRSYPVTALVC- 506
           +K  NP++ + +G +   YF++    R    G  +N GIS    +E   +   +  +V  
Sbjct: 97  YKASNPNSSK-VGMVPKSYFEIINKTRPPSVGVHSNGGISRQQSNEISTQPSSLYGIVLY 155

Query: 507 NFSKPTSDKPSLLKHNELTTFFHE----LGHGIHDLVGANRCSRLNGPGSVPWDFVEAPS 562
           +F    +D        ELT +  E      H  ++   A    RL GPG VP DFV    
Sbjct: 156 DFQAEKAD--------ELTAYVGENLFICAHHNYEWFIAKPIGRLGGPGLVPIDFV---- 203

Query: 563 QMLEFWTWNKNELISLSKHYKTGEKIPESLIESLVST 599
                       +I +S  + TG KI + +I + + T
Sbjct: 204 -----------SIIDISTGFATGNKIKDDIIAANLPT 229

>NCAS0G01020 Chr7 (176788..178005) [1218 bp, 405 aa] {ON} Anc_6.291
           YPL255W
          Length = 405

 Score = 34.7 bits (78), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 23/102 (22%), Positives = 48/102 (47%), Gaps = 3/102 (2%)

Query: 117 INQLTFLQHVSADKDIRDSSMKATELIQNFEIEASLRKDLFIQFDKIWTDVKDNSEFNEK 176
           + +L +    S+D ++ D  +  T L Q  ++    R D   ++++I + ++ NSE   K
Sbjct: 276 LRKLAYNLETSSDAEVEDLQLTVTNLRQQLQMAQQDRSDALFRYERIDSALR-NSELQRK 334

Query: 177 SDSKNYESYRFIEKCHKDFIRSGLNLSDEKREIVKDIQKKIA 218
            D   YE+   IE+  ++      N+S+ +    KD  +  +
Sbjct: 335 KDKIAYETR--IEELERELFARDNNISNSRYPSYKDTTRSTS 374

>TBLA0H03590 Chr8 complement(874695..876497) [1803 bp, 600 aa] {ON}
           Anc_8.539 YBR200W
          Length = 600

 Score = 33.1 bits (74), Expect = 3.1,   Method: Compositional matrix adjust.
 Identities = 23/78 (29%), Positives = 32/78 (41%), Gaps = 19/78 (24%)

Query: 520 KHNELTTFFHE----LGHGIHDLVGANRCSRLNGPGSVPWDFVEAPSQMLEFWTWNKNEL 575
           K +ELT F  E      H  ++   A    RL GPG VP DFV                +
Sbjct: 173 KSDELTVFAGENLFICAHHNYEWFIAKPIGRLGGPGLVPVDFV---------------SI 217

Query: 576 ISLSKHYKTGEKIPESLI 593
           + +S  Y TG  + E ++
Sbjct: 218 VDISTGYATGSDVKEDIL 235

>KAFR0J00650 Chr10 (112487..117985) [5499 bp, 1832 aa] {ON} Anc_5.191
            YLR024C
          Length = 1832

 Score = 32.3 bits (72), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 33/137 (24%), Positives = 63/137 (45%), Gaps = 19/137 (13%)

Query: 202  LSDEKREIVKDIQKKIASNSLNFSKNLGEQKEFIAFTKEELDGVSDAVMEQFEKFKDEKT 261
            L+ E+RE    I KK+A   + F +N      F +  KEE  G             D+ +
Sbjct: 1178 LAIERRE---KILKKLAKQQMKFIEN----NHFTSQDKEEYAG------------SDDSS 1218

Query: 262  GEEKFKVTFKYPDILPVLKSAKNPNTRKLAFNADQNKVPENEALFVDTLKLRNDLSTVLD 321
             EE  K+ +KYPD   V    K  +   + F+  +  + ++   F DT+ ++N  ++++ 
Sbjct: 1219 QEEINKLGWKYPDDGCVFCKMKKEDDAFVYFSYLEQNICDHGVDFPDTIYMKNVFNSMIG 1278

Query: 322  YSNYANYNLEMKMAKNE 338
             + + N +   K+ +N+
Sbjct: 1279 PNIFKNISAGTKLIENK 1295

>TPHA0H01240 Chr8 (274496..277129) [2634 bp, 877 aa] {ON} Anc_5.59
           YHR178W
          Length = 877

 Score = 32.3 bits (72), Expect = 5.4,   Method: Compositional matrix adjust.
 Identities = 13/39 (33%), Positives = 22/39 (56%)

Query: 93  AISSPTVENFIVPYMNHENKVSPLINQLTFLQHVSADKD 131
           A+     + FI  Y NH ++  P+I+++ FL  VS  +D
Sbjct: 424 AVDRSLYDRFIAAYFNHNHRTFPMIDKIAFLNSVSTIRD 462

>KAFR0L00580 Chr12 complement(106812..108308) [1497 bp, 498 aa] {ON}
           Anc_7.151 YER007W
          Length = 498

 Score = 31.6 bits (70), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 34/88 (38%), Gaps = 16/88 (18%)

Query: 613 HFSTFDMEVHTAEDVSKLNL-----------LELWNGLREQICLVENGDEMSKGYDSFGH 661
           HF   D ++H  E +  LNL            E WN   E++CL +N   + K  D F  
Sbjct: 239 HFQCIDQKLHLPESLVTLNLSDNALKSFPQGFEKWN--LEELCLADNDITIIKKRDDFSA 296

Query: 662 IMXXXXXXXXXXXMWAEVFATDMYYTKF 689
            +            WAE+   D+  T F
Sbjct: 297 AIKNLNLSNNRISKWAEL---DILNTSF 321

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.134    0.394 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 82,698,166
Number of extensions: 3962393
Number of successful extensions: 14622
Number of sequences better than 10.0: 189
Number of HSP's gapped: 15111
Number of HSP's successfully gapped: 197
Length of query: 739
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 622
Effective length of database: 40,065,477
Effective search space: 24920726694
Effective search space used: 24920726694
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 70 (31.6 bits)