Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_2002.111.8ON86864353e-57
SAKL0C00528g1.8ON110783314e-41
AFR743W1.8ON82793224e-40
TPHA0E039801.8ON86863224e-40
ZYRO0F18414g1.8ON87743216e-40
TBLA0A049601.8ON96793165e-39
KLTH0F00550g1.8ON82793145e-39
Ecym_10101.8ON82773102e-38
NCAS0B090801.8ON93863061e-37
CAGL0B00396g1.8ON88843061e-37
Kwal_33.130161.8ON82822982e-36
YCL057C-A (MOS1)1.8ON97972992e-36
Smik_3.171.8ON97972932e-35
Skud_3.61.8ON97702895e-35
TDEL0C069401.8ON86822842e-34
Suva_3.1551.8ON97702853e-34
KLLA0C00550g1.8ON82832782e-33
KNAG0C002501.8ON94852551e-29
NDAI0A001701.8ON96962402e-27
KAFR0D001701.8ON90672383e-27
ZYRO0G01012g1.361ON32219631.4
TBLA0F027507.488ON141427603.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_2002.11
         (86 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}...   172   3e-57
SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}...   132   4e-41
AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic ho...   128   4e-40
TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8 Y...   128   4e-40
ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} simila...   128   6e-40
TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa] {O...   126   5e-39
KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON} ...   125   5e-39
Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON} sim...   124   2e-38
NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8...   122   1e-37
CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON} ...   122   1e-37
Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON} ...   119   2e-36
YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}  MO...   119   2e-36
Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON} YCL...   117   2e-35
Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON} YCL0...   115   5e-35
TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8...   114   2e-34
Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON} ...   114   3e-34
KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON} ...   111   2e-33
KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON} A...   102   1e-29
NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON} A...    97   2e-27
KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON} A...    96   3e-27
ZYRO0G01012g Chr7 (81774..82742) [969 bp, 322 aa] {ON} similar t...    29   1.4  
TBLA0F02750 Chr6 (661437..665681) [4245 bp, 1414 aa] {ON} Anc_7....    28   3.2  

>Kpol_2002.11 s2002 complement(19864..20124) [261 bp, 86 aa] {ON}
          complement(19864..20124) [261 nt, 87 aa]
          Length = 86

 Score =  172 bits (435), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 86/86 (100%), Positives = 86/86 (100%)

Query: 1  MSQQSQELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGI 60
          MSQQSQELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGI
Sbjct: 1  MSQQSQELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGI 60

Query: 61 GFGIGRGYSEGDAIFRSAAGLRKSTV 86
          GFGIGRGYSEGDAIFRSAAGLRKSTV
Sbjct: 61 GFGIGRGYSEGDAIFRSAAGLRKSTV 86

>SAKL0C00528g Chr3 complement(47403..47735) [333 bp, 110 aa] {ON}
           similar to uniprot|Q96VH5 Saccharomyces cerevisiae
           YCL057C-A
          Length = 110

 Score =  132 bits (331), Expect = 4e-41,   Method: Compositional matrix adjust.
 Identities = 61/78 (78%), Positives = 73/78 (93%), Gaps = 1/78 (1%)

Query: 5   SQELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGIGFGI 64
           S++LQ+ S P +SILNDKWDVVLSN +VKT LGFGAG++ASV+LFKRRAFPVWLG+GFG+
Sbjct: 30  SEQLQV-SKPNKSILNDKWDVVLSNVVVKTGLGFGAGIVASVLLFKRRAFPVWLGVGFGL 88

Query: 65  GRGYSEGDAIFRSAAGLR 82
           GRGY+EGDAIFRS+AGLR
Sbjct: 89  GRGYAEGDAIFRSSAGLR 106

>AFR743W Chr6 (1800868..1801116) [249 bp, 82 aa] {ON} Syntenic
          homolog of Saccharomyces cerevisiae YCL057C-A
          Length = 82

 Score =  128 bits (322), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 62/79 (78%), Positives = 71/79 (89%), Gaps = 1/79 (1%)

Query: 4  QSQELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGIGFG 63
           S +L++ SAP+RSILNDKWDVVLSN +VKT LGFGAGV ASV+ FKRRAFPVWLG+GFG
Sbjct: 1  MSGQLEV-SAPSRSILNDKWDVVLSNLVVKTGLGFGAGVFASVLFFKRRAFPVWLGVGFG 59

Query: 64 IGRGYSEGDAIFRSAAGLR 82
          +GRGY+EGDAIFRS AGLR
Sbjct: 60 LGRGYAEGDAIFRSHAGLR 78

>TPHA0E03980 Chr5 (837161..837421) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  128 bits (322), Expect = 4e-40,   Method: Compositional matrix adjust.
 Identities = 60/86 (69%), Positives = 70/86 (81%)

Query: 1  MSQQSQELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGI 60
          MS+Q     +     +SILNDKWDVVLSN LVKT LGFG GV+ S++LFKRRAFPVWLGI
Sbjct: 1  MSEQKNNNNLELTSPKSILNDKWDVVLSNMLVKTGLGFGVGVVTSILLFKRRAFPVWLGI 60

Query: 61 GFGIGRGYSEGDAIFRSAAGLRKSTV 86
          GFG+GRGYS+GDAIFRSAAGLR + +
Sbjct: 61 GFGVGRGYSDGDAIFRSAAGLRSTRI 86

>ZYRO0F18414g Chr6 (1521776..1522039) [264 bp, 87 aa] {ON} similar
          to uniprot|Q96VH5 Saccharomyces cerevisiae YCL057C-A
          Length = 87

 Score =  128 bits (321), Expect = 6e-40,   Method: Compositional matrix adjust.
 Identities = 60/74 (81%), Positives = 68/74 (91%)

Query: 11 TSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGIGFGIGRGYSE 70
           +AP +SILNDKWDVVLSN LVK+ LGFG GV+ASV++FKRRAFPVWLGIGFG+GRGY+E
Sbjct: 12 VTAPNKSILNDKWDVVLSNLLVKSGLGFGVGVVASVLIFKRRAFPVWLGIGFGLGRGYAE 71

Query: 71 GDAIFRSAAGLRKS 84
          GDAIFRSAAGLR S
Sbjct: 72 GDAIFRSAAGLRTS 85

>TBLA0A04960 Chr1 complement(1220183..1220473) [291 bp, 96 aa]
          {ON} Anc_1.8 YCL057C-A
          Length = 96

 Score =  126 bits (316), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 61/79 (77%), Positives = 68/79 (86%), Gaps = 2/79 (2%)

Query: 4  QSQELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGIGFG 63
          +S    +TS   RSILNDKWD+V+SN LVKT+ GFGAGVLASVI FKRRAFPVWLG+GFG
Sbjct: 16 ESASTAVTS--NRSILNDKWDIVISNMLVKTTFGFGAGVLASVIFFKRRAFPVWLGVGFG 73

Query: 64 IGRGYSEGDAIFRSAAGLR 82
          +GRGYSEGDAIFRS AGLR
Sbjct: 74 LGRGYSEGDAIFRSTAGLR 92

>KLTH0F00550g Chr6 complement(42092..42340) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  125 bits (314), Expect = 5e-39,   Method: Compositional matrix adjust.
 Identities = 59/79 (74%), Positives = 73/79 (92%), Gaps = 1/79 (1%)

Query: 4  QSQELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGIGFG 63
           S++L++ S  +RS+LNDKWDVVLSN +VKT LGFGAGV+ASV+LFKRRAFPVW+G+GFG
Sbjct: 1  MSEQLKV-SPTSRSLLNDKWDVVLSNLVVKTGLGFGAGVVASVLLFKRRAFPVWIGVGFG 59

Query: 64 IGRGYSEGDAIFRSAAGLR 82
          +GRGY+EGDAIFRS+AGLR
Sbjct: 60 LGRGYAEGDAIFRSSAGLR 78

>Ecym_1010 Chr1 complement(19126..19374) [249 bp, 82 aa] {ON}
          similar to Ashbya gossypii AFR743W
          Length = 82

 Score =  124 bits (310), Expect = 2e-38,   Method: Compositional matrix adjust.
 Identities = 59/77 (76%), Positives = 69/77 (89%), Gaps = 1/77 (1%)

Query: 6  QELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGIGFGIG 65
          ++L++ +AP+RSILNDKWDVVLSN +VK  LGF  GVLASV+ FKRRAFPVWLGIGFG+G
Sbjct: 3  EKLEV-AAPSRSILNDKWDVVLSNLVVKAGLGFSVGVLASVLFFKRRAFPVWLGIGFGLG 61

Query: 66 RGYSEGDAIFRSAAGLR 82
          RGY+EGDAIFRS AGLR
Sbjct: 62 RGYAEGDAIFRSHAGLR 78

>NCAS0B09080 Chr2 (1744147..1744428) [282 bp, 93 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 93

 Score =  122 bits (306), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 61/86 (70%), Positives = 65/86 (75%), Gaps = 2/86 (2%)

Query: 3  QQSQELQITSAPT--RSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGI 60
           QS        PT  RSILNDKWDVVLSN LVK  LGF  GV+ASVI FKRR FPVWLGI
Sbjct: 8  NQSTPTSTAVTPTIDRSILNDKWDVVLSNMLVKVGLGFSVGVVASVIFFKRRTFPVWLGI 67

Query: 61 GFGIGRGYSEGDAIFRSAAGLRKSTV 86
          GFG+GRGY+EGDAIFRS AGLR + V
Sbjct: 68 GFGVGRGYAEGDAIFRSPAGLRTAKV 93

>CAGL0B00396g Chr2 complement(24498..24764) [267 bp, 88 aa] {ON}
          highly similar to uniprot|Q96VH5 Saccharomyces
          cerevisiae YCL057ca
          Length = 88

 Score =  122 bits (306), Expect = 1e-37,   Method: Compositional matrix adjust.
 Identities = 56/84 (66%), Positives = 66/84 (78%)

Query: 3  QQSQELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGIGF 62
          ++++   +   P RSILNDKWDVVLSN +VK  LGFG GV+ SV+ FKRR+FPVWLG+GF
Sbjct: 5  EETKAKTVDYTPVRSILNDKWDVVLSNMIVKMGLGFGVGVVTSVLFFKRRSFPVWLGVGF 64

Query: 63 GIGRGYSEGDAIFRSAAGLRKSTV 86
          G GRGYSEGDAIFRS AGLR   V
Sbjct: 65 GAGRGYSEGDAIFRSTAGLRSVKV 88

>Kwal_33.13016 s33 complement(41816..42064) [249 bp, 82 aa] {ON}
          YCL057C-A - Hypothetical ORF, has similarity to
          proteins in S. pombe, C. elegans, D. melanogaster.
          [contig 123] FULL
          Length = 82

 Score =  119 bits (298), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 58/82 (70%), Positives = 70/82 (85%), Gaps = 4/82 (4%)

Query: 1  MSQQSQELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGI 60
          MS Q++   ++    RS+LNDKWDVVLSN +VK  LGFGAGV+ASV+LFKRRA PVW+G+
Sbjct: 1  MSDQAKIAPVS----RSLLNDKWDVVLSNLVVKVGLGFGAGVVASVLLFKRRAAPVWIGV 56

Query: 61 GFGIGRGYSEGDAIFRSAAGLR 82
          GFG+GRGYSEGDAIFRS+AGLR
Sbjct: 57 GFGLGRGYSEGDAIFRSSAGLR 78

>YCL057C-A Chr3 complement(24032..24325) [294 bp, 97 aa] {ON}
          MOS1Mitochondrial protein essential for proper inner
          membrane organization; conserved component of the
          mitochondrial inner membrane organizing system (MICOS,
          MINOS, or MitOS), a scaffold-like structure on the
          intermembrane space side of the inner membrane which
          has a role in the maintenance of crista junctions and
          inner membrane architecture; ortholog of human MINOS1
          Length = 97

 Score =  119 bits (299), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 60/97 (61%), Positives = 73/97 (75%), Gaps = 11/97 (11%)

Query: 1  MSQQSQELQ-ITSAPTR----------SILNDKWDVVLSNFLVKTSLGFGAGVLASVILF 49
          MS+Q+Q  Q   S P++          +IL+ KWD+VLSN LVKT++GFG GV  SV+ F
Sbjct: 1  MSEQAQTQQPAKSTPSKDSNKNGSSVSTILDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 50 KRRAFPVWLGIGFGIGRGYSEGDAIFRSAAGLRKSTV 86
          KRRAFPVWLGIGFG+GRGY+EGDAIFRS+AGLR S V
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>Smik_3.17 Chr3 complement(25487..25777) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  117 bits (293), Expect = 2e-35,   Method: Compositional matrix adjust.
 Identities = 58/97 (59%), Positives = 72/97 (74%), Gaps = 11/97 (11%)

Query: 1  MSQQSQELQITS-APTR----------SILNDKWDVVLSNFLVKTSLGFGAGVLASVILF 49
          MS+Q+Q  Q     P++          ++L+ KWD+VLSN LVKT++GFG GV  SV+ F
Sbjct: 1  MSEQAQAQQPAKVTPSKDSSKNGSGVSTVLDTKWDIVLSNMLVKTAMGFGVGVFTSVLFF 60

Query: 50 KRRAFPVWLGIGFGIGRGYSEGDAIFRSAAGLRKSTV 86
          KRRAFPVWLGIGFG+GRGY+EGDAIFRS+AGLR S V
Sbjct: 61 KRRAFPVWLGIGFGVGRGYAEGDAIFRSSAGLRSSKV 97

>Skud_3.6 Chr3 complement(12034..12324) [291 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  115 bits (289), Expect = 5e-35,   Method: Compositional matrix adjust.
 Identities = 52/70 (74%), Positives = 62/70 (88%)

Query: 17 SILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGIGFGIGRGYSEGDAIFR 76
          +IL+ KWD+V+SN LVKT++GFG GV  SV+ FKRRAFPVWLGIGFG+GRGY+EGDAIFR
Sbjct: 28 TILDAKWDIVMSNMLVKTAMGFGVGVFTSVLFFKRRAFPVWLGIGFGVGRGYAEGDAIFR 87

Query: 77 SAAGLRKSTV 86
          S+AGLR S V
Sbjct: 88 SSAGLRSSKV 97

>TDEL0C06940 Chr3 (1261913..1262173) [261 bp, 86 aa] {ON} Anc_1.8
          YCL057C-A
          Length = 86

 Score =  114 bits (284), Expect = 2e-34,   Method: Compositional matrix adjust.
 Identities = 64/82 (78%), Positives = 72/82 (87%)

Query: 1  MSQQSQELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGI 60
          MS++SQ     +AP+RSILNDKWDVVLSN LVKT LGFG GV+ SV+ FKRRAFPVWLGI
Sbjct: 1  MSEKSQAQLQVAAPSRSILNDKWDVVLSNMLVKTGLGFGVGVVGSVLFFKRRAFPVWLGI 60

Query: 61 GFGIGRGYSEGDAIFRSAAGLR 82
          GFG+GRGY+EGDAIFRSAAGLR
Sbjct: 61 GFGLGRGYAEGDAIFRSAAGLR 82

>Suva_3.155 Chr3 complement(233792..234085) [294 bp, 97 aa] {ON}
          YCL057C-A (REAL)
          Length = 97

 Score =  114 bits (285), Expect = 3e-34,   Method: Compositional matrix adjust.
 Identities = 51/70 (72%), Positives = 61/70 (87%)

Query: 17 SILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGIGFGIGRGYSEGDAIFR 76
          ++L+ KWD+VLSN LVKT++GFG GV  SV+ FKRRAFP WLGIGFG+GRGY+EGDAIFR
Sbjct: 28 TVLDAKWDIVLSNMLVKTAMGFGIGVFTSVLFFKRRAFPAWLGIGFGVGRGYAEGDAIFR 87

Query: 77 SAAGLRKSTV 86
          S+AGLR S V
Sbjct: 88 SSAGLRSSKV 97

>KLLA0C00550g Chr3 complement(40901..41149) [249 bp, 82 aa] {ON}
          similar to uniprot|Q96VH5 Saccharomyces cerevisiae
          YCL057C-A
          Length = 82

 Score =  111 bits (278), Expect = 2e-33,   Method: Compositional matrix adjust.
 Identities = 53/83 (63%), Positives = 67/83 (80%), Gaps = 4/83 (4%)

Query: 1  MSQQSQELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGI 60
          MS+Q Q    T+    SIL+ +WDVVLSN + KT+LG G G++ASV+ FKRRAFPVW+G+
Sbjct: 1  MSEQVQ----TTKAVPSILDKRWDVVLSNVVAKTALGAGVGIVASVLFFKRRAFPVWVGV 56

Query: 61 GFGIGRGYSEGDAIFRSAAGLRK 83
          GFG+GRGY+EGDAIFR+ AGLRK
Sbjct: 57 GFGLGRGYAEGDAIFRTNAGLRK 79

>KNAG0C00250 Chr3 complement(38677..38961) [285 bp, 94 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 94

 Score =  102 bits (255), Expect = 1e-29,   Method: Compositional matrix adjust.
 Identities = 56/85 (65%), Positives = 68/85 (80%)

Query: 2  SQQSQELQITSAPTRSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGIG 61
          + Q+   Q+ +   RS+LNDKWDVVLSN LVK  +GFG GV+ SV+LF+RRAFPVWLGIG
Sbjct: 10 ATQNNNGQLATKIDRSLLNDKWDVVLSNMLVKVGMGFGVGVVTSVLLFRRRAFPVWLGIG 69

Query: 62 FGIGRGYSEGDAIFRSAAGLRKSTV 86
          FG+GRGYSEGDAIFRS +G+R   V
Sbjct: 70 FGVGRGYSEGDAIFRSTSGIRTVKV 94

>NDAI0A00170 Chr1 complement(13975..14265) [291 bp, 96 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 96

 Score = 97.1 bits (240), Expect = 2e-27,   Method: Compositional matrix adjust.
 Identities = 61/96 (63%), Positives = 68/96 (70%), Gaps = 10/96 (10%)

Query: 1  MSQQ--SQELQITSAPT--------RSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFK 50
          MS+Q    E Q   AP         +SILNDKWD+VLSN LVK  LGFG GV+ SVI FK
Sbjct: 1  MSEQVNKTEHQNAVAPPQQQLATIDKSILNDKWDIVLSNTLVKVGLGFGVGVVTSVIFFK 60

Query: 51 RRAFPVWLGIGFGIGRGYSEGDAIFRSAAGLRKSTV 86
          RR FPVWLGIGFG GRGY+EGDAIFRS+AG+R   V
Sbjct: 61 RRTFPVWLGIGFGAGRGYAEGDAIFRSSAGIRSVNV 96

>KAFR0D00170 Chr4 complement(18220..18492) [273 bp, 90 aa] {ON}
          Anc_1.8 YCL057C-A
          Length = 90

 Score = 96.3 bits (238), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 55/67 (82%), Positives = 58/67 (86%)

Query: 16 RSILNDKWDVVLSNFLVKTSLGFGAGVLASVILFKRRAFPVWLGIGFGIGRGYSEGDAIF 75
          RSILNDKWD+VLSN LVK  LGFG GV+ SVI FKRRAFPVWLGIG+G GR YSEGDAIF
Sbjct: 20 RSILNDKWDLVLSNMLVKVGLGFGVGVVTSVIFFKRRAFPVWLGIGYGFGRAYSEGDAIF 79

Query: 76 RSAAGLR 82
          RS AGLR
Sbjct: 80 RSNAGLR 86

>ZYRO0G01012g Chr7 (81774..82742) [969 bp, 322 aa] {ON} similar to
           uniprot|P43599 Saccharomyces cerevisiae YFR018C
           Hypothetical ORF
          Length = 322

 Score = 28.9 bits (63), Expect = 1.4,   Method: Composition-based stats.
 Identities = 12/19 (63%), Positives = 14/19 (73%)

Query: 21  DKWDVVLSNFLVKTSLGFG 39
           DKW V+LS FLV+ S GF 
Sbjct: 301 DKWAVLLSEFLVEESSGFA 319

>TBLA0F02750 Chr6 (661437..665681) [4245 bp, 1414 aa] {ON} Anc_7.488
            YBL047C
          Length = 1414

 Score = 27.7 bits (60), Expect = 3.2,   Method: Composition-based stats.
 Identities = 10/27 (37%), Positives = 18/27 (66%)

Query: 4    QSQELQITSAPTRSILNDKWDVVLSNF 30
            Q  + Q+ S+ TR++ ND+W+ + S F
Sbjct: 1241 QIPQPQLQSSETRNVSNDEWNEIFSGF 1267

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.322    0.137    0.402 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 7,691,251
Number of extensions: 246643
Number of successful extensions: 610
Number of sequences better than 10.0: 23
Number of HSP's gapped: 610
Number of HSP's successfully gapped: 23
Length of query: 86
Length of database: 53,481,399
Length adjustment: 58
Effective length of query: 28
Effective length of database: 46,830,771
Effective search space: 1311261588
Effective search space used: 1311261588
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.9 bits)
S2: 59 (27.3 bits)