Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_2002.101.7ON1111114612e-60
ZYRO0F18436g1.7ON112881625e-15
KAFR0D001601.7ON111891616e-15
TPHA0E039901.7ON116881582e-14
SAKL0C00506g1.7ON105891539e-14
KNAG0C002401.7ON126951488e-13
TBLA0A049501.7ON113881409e-12
NCAS0B090901.7ON119891312e-10
Skud_3.51.7ON113931294e-10
NDAI0A001601.7ON123921271e-09
Suva_3.1541.7ON113911261e-09
YCL058W-A (ADF1)1.7ON113901243e-09
CAGL0B00374g1.7ON121891155e-08
Smik_3.161.7ON113931112e-07
Kwal_YGOB_YCL058W-A1.7ON105881102e-07
Kwal_33.13015singletonOFF105881102e-07
KLTH0F00528g1.7ON104911068e-07
TDEL0C069501.7ON111881033e-06
AFR743CA1.7ON10188850.001
KLLA0C00528g1.7ON11644790.008
KLLA0F27511g7.231ON62378680.63
Ecym_84174.7ON29141660.86
Kpol_413.28.723ON66764651.6
TBLA0B017602.183ON38374641.9
TDEL0C014201.474ON64877623.9
Kpol_243.43.310ON53356606.2
ACR119W8.654ON93150606.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_2002.10
         (111 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON} (19162.....   182   2e-60
ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa] ...    67   5e-15
KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7 YC...    67   6e-15
TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON...    65   2e-14
SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly si...    64   9e-14
KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7 YC...    62   8e-13
TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1....    59   9e-12
NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {...    55   2e-10
Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)    54   4e-10
NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7 YC...    54   1e-09
Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A...    53   1e-09
YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}  ADF1Transcr...    52   3e-09
CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar t...    49   5e-08
Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A (R...    47   2e-07
Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON} ANN...    47   2e-07
Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig ...    47   2e-07
KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved...    45   8e-07
TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {...    44   3e-06
AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}...    37   0.001
KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no simila...    35   0.008
KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} simi...    31   0.63 
Ecym_8417 Chr8 (872889..873764) [876 bp, 291 aa] {ON} similar to...    30   0.86 
Kpol_413.2 s413 complement(4040..6043) [2004 bp, 667 aa] {ON} co...    30   1.6  
TBLA0B01760 Chr2 complement(394468..395619) [1152 bp, 383 aa] {O...    29   1.9  
TDEL0C01420 Chr3 complement(241918..243864) [1947 bp, 648 aa] {O...    28   3.9  
Kpol_243.4 s243 complement(7505..9106) [1602 bp, 533 aa] {ON} co...    28   6.2  
ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic ho...    28   6.9  

>Kpol_2002.10 s2002 (19162..19497) [336 bp, 111 aa] {ON}
           (19162..19497) [336 nt, 112 aa]
          Length = 111

 Score =  182 bits (461), Expect = 2e-60,   Method: Compositional matrix adjust.
 Identities = 96/111 (86%), Positives = 96/111 (86%)

Query: 1   MAKSSVSMXXXXXXXXXXXXXXXISQSEKKRNKIKMEKINKEGILPSDILQLNNETRNGQ 60
           MAKSSVSM               ISQSEKKRNKIKMEKINKEGILPSDILQLNNETRNGQ
Sbjct: 1   MAKSSVSMRKKGNVGKKSKRKNVISQSEKKRNKIKMEKINKEGILPSDILQLNNETRNGQ 60

Query: 61  SEGNKERALESQKLQQDNVKDRETIAKIEASKKETDDSMLKQIELMTGFSL 111
           SEGNKERALESQKLQQDNVKDRETIAKIEASKKETDDSMLKQIELMTGFSL
Sbjct: 61  SEGNKERALESQKLQQDNVKDRETIAKIEASKKETDDSMLKQIELMTGFSL 111

>ZYRO0F18436g Chr6 complement(1522314..1522652) [339 bp, 112 aa]
           {ON} similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 112

 Score = 67.0 bits (162), Expect = 5e-15,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 61/88 (69%), Gaps = 2/88 (2%)

Query: 24  ISQSEKKRNKIKMEKINKEGILPSDILQLNNETRNGQSEGNKERALESQKLQQDNVKDRE 83
           IS S+KKR K K+EK++ +G+LPS+I +LN    +  S      +L ++ L+QD   D++
Sbjct: 27  ISHSDKKRTKSKVEKLDAKGLLPSEIFKLNRSASSKTSN--GSSSLLARNLEQDRKMDQD 84

Query: 84  TIAKIEASKKETDDSMLKQIELMTGFSL 111
           T  K  A KKETD+++L+QIE+++GFSL
Sbjct: 85  TRDKANAKKKETDNNILQQIEMISGFSL 112

>KAFR0D00160 Chr4 (17823..18158) [336 bp, 111 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 111

 Score = 66.6 bits (161), Expect = 6e-15,   Method: Compositional matrix adjust.
 Identities = 40/89 (44%), Positives = 62/89 (69%), Gaps = 3/89 (3%)

Query: 24  ISQSEKKRNKIKMEKINKEGILPSDILQLNNETRNGQSEGNKER-ALESQKLQQDNVKDR 82
           ISQSE+K+NK+ +EK N++ I  +++ +LN + +  +   +K + ALE++KL  D  +D 
Sbjct: 25  ISQSERKKNKLIVEKFNQQTI--TNVQELNKDLKKDKRRLSKTKNALETKKLLHDQARDH 82

Query: 83  ETIAKIEASKKETDDSMLKQIELMTGFSL 111
           E    IE   KET+DSMLKQIE+++GFSL
Sbjct: 83  EVKQNIETKLKETEDSMLKQIEMISGFSL 111

>TPHA0E03990 Chr5 complement(837690..838040) [351 bp, 116 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 116

 Score = 65.5 bits (158), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 39/88 (44%), Positives = 59/88 (67%), Gaps = 1/88 (1%)

Query: 24  ISQSEKKRNKIKMEKINKEGILPSDILQLNNETRNGQSEGNKERALESQKLQQDNVKDRE 83
           +S   +K  K K+EK+NK  ++ SD +   N   NG+    +   LE++ L +DN+KDR+
Sbjct: 30  LSSQVRKSTKHKVEKLNKLEVISSDDINALNAL-NGKKREKQTSVLEAKTLAKDNLKDRQ 88

Query: 84  TIAKIEASKKETDDSMLKQIELMTGFSL 111
            I KIE+ KKET+ S+L+QIE+M+GFSL
Sbjct: 89  LIEKIESKKKETNASLLQQIEMMSGFSL 116

>SAKL0C00506g Chr3 (46439..46756) [318 bp, 105 aa] {ON} weakly
           similar to uniprot|Q2V2Q1 Saccharomyces cerevisiae
           YCL058W-A
          Length = 105

 Score = 63.5 bits (153), Expect = 9e-14,   Method: Compositional matrix adjust.
 Identities = 37/89 (41%), Positives = 62/89 (69%), Gaps = 5/89 (5%)

Query: 24  ISQSEKKRNKIKMEKINKEGILPSDILQLNNETRNGQSEGN-KERALESQKLQQDNVKDR 82
           I +S+KKR +I++E++NK+  L SD+    N T  G ++   K + L+++ L QD  KD+
Sbjct: 21  IKKSQKKRTRIQVEQLNKQEFLLSDL----NMTNAGSTKTKEKPKTLQAKALAQDQKKDK 76

Query: 83  ETIAKIEASKKETDDSMLKQIELMTGFSL 111
           ET  K+E  +K+T+D+ML Q+E+++GFSL
Sbjct: 77  ETRDKLEKQRKDTNDNMLAQLEMISGFSL 105

>KNAG0C00240 Chr3 (38093..38473) [381 bp, 126 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 126

 Score = 61.6 bits (148), Expect = 8e-13,   Method: Compositional matrix adjust.
 Identities = 39/95 (41%), Positives = 60/95 (63%), Gaps = 7/95 (7%)

Query: 24  ISQSEKKRNKIKMEKINKE--GILPSDILQLNNET--RNGQSEGNK---ERALESQKLQQ 76
           I  SE+KRNK+++EK+N+   G++  + + + NE    N + EG      R+L+ +KL Q
Sbjct: 32  IPLSERKRNKLQVEKLNRPTNGMIEGNAVDIRNEIDKHNQEVEGQNRTVHRSLDVEKLAQ 91

Query: 77  DNVKDRETIAKIEASKKETDDSMLKQIELMTGFSL 111
           D  KDR    ++   +KETD SML QIE+++GFSL
Sbjct: 92  DKSKDRIIQEQVAKKQKETDQSMLAQIEMISGFSL 126

>TBLA0A04950 Chr1 (1219399..1219740) [342 bp, 113 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 113

 Score = 58.5 bits (140), Expect = 9e-12,   Method: Compositional matrix adjust.
 Identities = 36/88 (40%), Positives = 59/88 (67%), Gaps = 3/88 (3%)

Query: 24  ISQSEKKRNKIKMEKINKEGILPSDILQLNNETRNGQSEGNKERALESQKLQQDNVKDRE 83
           IS  +KKR K+++EK+NK+  L SDI+ LN +++      N    L S++L++D  KDR 
Sbjct: 29  ISVGDKKRAKLQVEKMNKQDSLLSDIINLNGKSKELAKNVN---TLSSKQLKKDQEKDRL 85

Query: 84  TIAKIEASKKETDDSMLKQIELMTGFSL 111
              +I+  KK+T+D ++ QIE+++GFSL
Sbjct: 86  LNVEIKNKKKQTNDDLIAQIEMISGFSL 113

>NCAS0B09090 Chr2 complement(1744560..1744919) [360 bp, 119 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 119

 Score = 55.1 bits (131), Expect = 2e-10,   Method: Compositional matrix adjust.
 Identities = 35/89 (39%), Positives = 56/89 (62%), Gaps = 1/89 (1%)

Query: 24  ISQSEKKRNKIKMEKINK-EGILPSDILQLNNETRNGQSEGNKERALESQKLQQDNVKDR 82
           IS S++K+ K ++EK+NK E +LP ++L L  +    +     +  L ++ L QD  KD+
Sbjct: 31  ISFSDRKKAKHQVEKLNKKENLLPMNVLDLQKKKNLSKKPEPLKSILHARSLLQDQKKDK 90

Query: 83  ETIAKIEASKKETDDSMLKQIELMTGFSL 111
           E   KI A +K TDDS+ KQIE+++GF+ 
Sbjct: 91  EIRNKIRAEQKATDDSIEKQIEMISGFTF 119

>Skud_3.5 Chr3 (11576..11917) [342 bp, 113 aa] {ON} YCL058W-A (REAL)
          Length = 113

 Score = 54.3 bits (129), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 62/93 (66%), Gaps = 11/93 (11%)

Query: 24  ISQSEKKRNKIKMEKINK--EGILPSDILQLNNETRNGQSEGNKERA---LESQKLQQDN 78
           IS +E+KR K+++EK+NK  E ++P+    L  ET     E  K+RA   L++++L +D 
Sbjct: 27  ISTAERKRTKLQVEKLNKSSEIMIPT----LLRET--ATQEPTKKRAKSTLKAEELVKDQ 80

Query: 79  VKDRETIAKIEASKKETDDSMLKQIELMTGFSL 111
            KD +   +I+  K +T+DSML+QIE+++GFSL
Sbjct: 81  AKDCKVREQIQTEKSKTNDSMLEQIEMISGFSL 113

>NDAI0A00160 Chr1 (13398..13769) [372 bp, 123 aa] {ON} Anc_1.7
           YCL058W-A
          Length = 123

 Score = 53.5 bits (127), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 33/92 (35%), Positives = 54/92 (58%), Gaps = 4/92 (4%)

Query: 24  ISQSEKKRNKIKMEKINKEGILPSDILQLNNET----RNGQSEGNKERALESQKLQQDNV 79
           I QS++K+NKIK+   NKE  L  ++ +LN+++    +  Q    K  +L +  L  D  
Sbjct: 32  IKQSDRKKNKIKVAMFNKESSLHMNVSELNSQSMSPIKQKQDSLRKGSSLSAHDLLNDQK 91

Query: 80  KDRETIAKIEASKKETDDSMLKQIELMTGFSL 111
           KD E   +I+  KK+ +D ML+QIE+++GF  
Sbjct: 92  KDIEANNRIQTEKKQVNDDMLRQIEMISGFKF 123

>Suva_3.154 Chr3 (233345..233686) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 53.1 bits (126), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 36/91 (39%), Positives = 58/91 (63%), Gaps = 7/91 (7%)

Query: 24  ISQSEKKRNKIKMEKINK--EGILPSDILQLNNETRNGQSEGNKERA-LESQKLQQDNVK 80
           IS +E KR K+++E++NK  E ++P+    L  E      +  K R+ LE+++L +D  +
Sbjct: 27  ISTAEMKRTKLQVERLNKSSETMIPT----LLKEASKQDLDKKKTRSTLEAEELVKDQAR 82

Query: 81  DRETIAKIEASKKETDDSMLKQIELMTGFSL 111
           D +    IE  K +T+DSMLKQIE+++GFSL
Sbjct: 83  DSKVREHIETEKSKTNDSMLKQIEMISGFSL 113

>YCL058W-A Chr3 (23584..23925) [342 bp, 113 aa] {ON}
           ADF1Transcriptional repressor encoded by the antisense
           strand of the FYV5 gene; negatively regulates
           transcription of FYV5 by binding to the promoter on the
           sense strand
          Length = 113

 Score = 52.4 bits (124), Expect = 3e-09,   Method: Compositional matrix adjust.
 Identities = 33/90 (36%), Positives = 60/90 (66%), Gaps = 5/90 (5%)

Query: 24  ISQSEKKRNKIKMEKINK--EGILPSDILQLNNETRNGQSEGNKERALESQKLQQDNVKD 81
           IS +E+KR K+++EK+NK  E ++P+ + + + +     ++   E  L++++L +D  KD
Sbjct: 27  ISTAERKRTKLQVEKLNKSSETMIPTLLREASTQE---PAKLKAETTLKAEELIKDQEKD 83

Query: 82  RETIAKIEASKKETDDSMLKQIELMTGFSL 111
            +   +I   K +T+DSMLKQIE+++GFSL
Sbjct: 84  SKVREQIRTEKSKTNDSMLKQIEMISGFSL 113

>CAGL0B00374g Chr2 (23693..24058) [366 bp, 121 aa] {ON} similar to
           CA0039|IPF3998 Candida albicans and KLLA0C00528g
           Kluyveromyces lactis
          Length = 121

 Score = 48.9 bits (115), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 32/89 (35%), Positives = 53/89 (59%), Gaps = 1/89 (1%)

Query: 24  ISQSEKKRNKIKMEKINKEG-ILPSDILQLNNETRNGQSEGNKERALESQKLQQDNVKDR 82
           IS SE+K++KI   ++NK+  +    I+Q  N+ +  +    ++ AL+   L +D  +D+
Sbjct: 33  ISASERKKSKILTARLNKDADVAELKIIQELNDNKIAEEPKKRQTALDMNCLVKDQKRDK 92

Query: 83  ETIAKIEASKKETDDSMLKQIELMTGFSL 111
           +    IE    ET+  MLKQ+ELM+GFSL
Sbjct: 93  KVREHIEKINSETNSDMLKQLELMSGFSL 121

>Smik_3.16 Chr3 (25034..25375) [342 bp, 113 aa] {ON} YCL058W-A
           (REAL)
          Length = 113

 Score = 47.4 bits (111), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 38/93 (40%), Positives = 57/93 (61%), Gaps = 11/93 (11%)

Query: 24  ISQSEKKRNKIKMEKINK--EGILPSDILQLNNETRNGQSEGNK---ERALESQKLQQDN 78
           IS + KKR K+++EK+NK  E ++P+    L  ET  G  E  K   E  L++  L +D 
Sbjct: 27  ISTAVKKRTKLQVEKLNKSSEMMIPT----LLRET--GAQEPAKRKTESTLKAGDLIKDQ 80

Query: 79  VKDRETIAKIEASKKETDDSMLKQIELMTGFSL 111
            KD +    I+  K +T+D+MLKQIE+++GFSL
Sbjct: 81  EKDSKVREHIQMEKSKTNDNMLKQIEMISGFSL 113

>Kwal_YGOB_YCL058W-A s33 (41330..41647) [318 bp, 105 aa] {ON}
           ANNOTATED BY YGOB -
          Length = 105

 Score = 47.0 bits (110), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 57/88 (64%), Gaps = 4/88 (4%)

Query: 24  ISQSEKKRNKIKMEKINKEGILPSDILQLNNETRNGQSEGNKERALESQKLQQDNVKDRE 83
           I + +K R K+K+E+ NKE  L S++    N+  + + + +   +L+  +L +D  KD+ 
Sbjct: 22  IKKHQKIRTKLKVEQANKEVFLISEL----NKREDTKRQSSPLESLKPSRLVKDIKKDQN 77

Query: 84  TIAKIEASKKETDDSMLKQIELMTGFSL 111
              ++E+ +K TD+++L+Q+EL++GFSL
Sbjct: 78  AQKQLESQRKATDENVLRQLELISGFSL 105

>Kwal_33.13015 s33 (41330..41647) [318 bp, 105 aa] {OFF} [contig
           123] FULL
          Length = 105

 Score = 47.0 bits (110), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 29/88 (32%), Positives = 57/88 (64%), Gaps = 4/88 (4%)

Query: 24  ISQSEKKRNKIKMEKINKEGILPSDILQLNNETRNGQSEGNKERALESQKLQQDNVKDRE 83
           I + +K R K+K+E+ NKE  L S++    N+  + + + +   +L+  +L +D  KD+ 
Sbjct: 22  IKKHQKIRTKLKVEQANKEVFLISEL----NKREDTKRQSSPLESLKPSRLVKDIKKDQN 77

Query: 84  TIAKIEASKKETDDSMLKQIELMTGFSL 111
              ++E+ +K TD+++L+Q+EL++GFSL
Sbjct: 78  AQKQLESQRKATDENVLRQLELISGFSL 105

>KLTH0F00528g Chr6 (41595..41909) [315 bp, 104 aa] {ON} conserved
           hypothetical protein
          Length = 104

 Score = 45.4 bits (106), Expect = 8e-07,   Method: Compositional matrix adjust.
 Identities = 35/91 (38%), Positives = 55/91 (60%), Gaps = 10/91 (10%)

Query: 24  ISQSEKKRNKIKMEKINKEGILPSDILQLNNETRNGQSEGNKERALESQK---LQQDNVK 80
           I + +K R K+K+E+ NKE  L   I +LN    N +    +  ALES K   L +D  K
Sbjct: 21  IRKHQKIRTKLKVEQANKESFL---ISELNEREHNTK----RTPALESLKVSDLIEDREK 73

Query: 81  DRETIAKIEASKKETDDSMLKQIELMTGFSL 111
           D+    K+E  K+ TD+++++Q+EL++GFSL
Sbjct: 74  DKSMQKKMEEQKQSTDNNIIEQLELISGFSL 104

>TDEL0C06950 Chr3 complement(1262284..1262619) [336 bp, 111 aa] {ON}
           Anc_1.7 YCL058W-A
          Length = 111

 Score = 44.3 bits (103), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 31/88 (35%), Positives = 55/88 (62%), Gaps = 1/88 (1%)

Query: 24  ISQSEKKRNKIKMEKINKEGILPSDILQLNNETRNGQSEGNKERALESQKLQQDNVKDRE 83
           IS+ + K+ K ++E +N++    S+I++LN  T   +    K   LE++ LQ+D  KD++
Sbjct: 25  ISRRDVKKTKFRVENLNRDTASLSEIIKLNASTA-VKGSARKANTLENRTLQKDWQKDQK 83

Query: 84  TIAKIEASKKETDDSMLKQIELMTGFSL 111
              K +A K+E  +++ KQIE ++GFSL
Sbjct: 84  IREKSKAEKEEMANNLEKQIEDISGFSL 111

>AFR743CA Chr6 complement(1801173..1801478) [306 bp, 101 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YCL058W-A
          Length = 101

 Score = 37.4 bits (85), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 24/88 (27%), Positives = 47/88 (53%), Gaps = 8/88 (9%)

Query: 24  ISQSEKKRNKIKMEKINKEGILPSDILQLNNETRNGQSEGNKERALESQKLQQDNVKDRE 83
           IS+++KKR K+++EK++K G+L +++       + G         L++  L QD   D +
Sbjct: 22  ISKADKKRAKLQVEKLDKRGVLLAELTAAAPAAKTG--------VLQAASLAQDQRSDAQ 73

Query: 84  TIAKIEASKKETDDSMLKQIELMTGFSL 111
              +    +   D  +++Q+E + GFSL
Sbjct: 74  AQQQRAQERSNVDKKVVQQLEAIAGFSL 101

>KLLA0C00528g Chr3 (40060..40410) [351 bp, 116 aa] {ON} no
           similarity
          Length = 116

 Score = 35.0 bits (79), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/44 (38%), Positives = 30/44 (68%)

Query: 68  ALESQKLQQDNVKDRETIAKIEASKKETDDSMLKQIELMTGFSL 111
           +LE QK+++   +D+E + K +  KK T+  +  Q+EL++GFSL
Sbjct: 73  SLEGQKVREHYKEDKEVVKKHDKEKKATEKKIEDQLELISGFSL 116

>KLLA0F27511g Chr6 (2546533..2548404) [1872 bp, 623 aa] {ON} similar
           to uniprot|P39014 Saccharomyces cerevisiae YIL046W MET30
           F-box protein containing five copies of the WD40 motif
           controls cell cycle function sulfur metabolism and
           methionine biosynthesis as part of the ubiquitin ligase
           complex interacts with and regulates Met4p localizes
           within the nucleus
          Length = 623

 Score = 30.8 bits (68), Expect = 0.63,   Method: Composition-based stats.
 Identities = 22/78 (28%), Positives = 42/78 (53%), Gaps = 1/78 (1%)

Query: 26  QSEKKRNKI-KMEKINKEGILPSDILQLNNETRNGQSEGNKERALESQKLQQDNVKDRET 84
           + E  RNK  K+ + N+E  LPS++ Q N      +   + +   +   + QD V+  + 
Sbjct: 35  KGEILRNKASKVNQNNEEIQLPSEMPQFNFFKFCYRHNPDIQHTCKDSMVFQDQVRSEKW 94

Query: 85  IAKIEASKKETDDSMLKQ 102
           + K++A  KE+D +++KQ
Sbjct: 95  MEKMKALDKESDRAIIKQ 112

>Ecym_8417 Chr8 (872889..873764) [876 bp, 291 aa] {ON} similar to
           Ashbya gossypii ACL071C
          Length = 291

 Score = 30.0 bits (66), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 14/41 (34%), Positives = 23/41 (56%)

Query: 59  GQSEGNKERALESQKLQQDNVKDRETIAKIEASKKETDDSM 99
           G SEG+     + ++ Q   +KDRE    + A+K E+DD +
Sbjct: 231 GMSEGDDAITRKMEEFQSKTLKDREITVDVAATKPESDDQL 271

>Kpol_413.2 s413 complement(4040..6043) [2004 bp, 667 aa] {ON}
          complement(4040..6043) [2004 nt, 668 aa]
          Length = 667

 Score = 29.6 bits (65), Expect = 1.6,   Method: Composition-based stats.
 Identities = 18/64 (28%), Positives = 30/64 (46%), Gaps = 3/64 (4%)

Query: 25 SQSEKKRNKIKMEKINKEGILPSDILQLNNETRNGQSEGNKERALESQKLQQDNVKDRET 84
          S +E   + +K +KI  +GI+P     +N+   N  S  +KE   E      DNV   + 
Sbjct: 3  SYTETNSSSLKNDKIEDDGIVPHITASVNSTIDNSNSNSSKE---EISNDMNDNVFTEKK 59

Query: 85 IAKI 88
          I+ +
Sbjct: 60 ISHV 63

>TBLA0B01760 Chr2 complement(394468..395619) [1152 bp, 383 aa] {ON}
           Anc_2.183 YNL097C
          Length = 383

 Score = 29.3 bits (64), Expect = 1.9,   Method: Composition-based stats.
 Identities = 19/74 (25%), Positives = 40/74 (54%)

Query: 32  NKIKMEKINKEGILPSDILQLNNETRNGQSEGNKERALESQKLQQDNVKDRETIAKIEAS 91
           ++I+ + IN   IL   I +L N   + +S G+ E  +++ +L +DN+   E    + A 
Sbjct: 33  HEIEAKCINNLPILYEIIDKLTNPDLSSESNGDIELLIQNNRLLEDNMGSLEEKMHVSAI 92

Query: 92  KKETDDSMLKQIEL 105
              T + +++++EL
Sbjct: 93  LARTLERLIERLEL 106

>TDEL0C01420 Chr3 complement(241918..243864) [1947 bp, 648 aa] {ON}
           Anc_1.474 YJR045C
          Length = 648

 Score = 28.5 bits (62), Expect = 3.9,   Method: Compositional matrix adjust.
 Identities = 28/77 (36%), Positives = 42/77 (54%), Gaps = 12/77 (15%)

Query: 25  SQSEKKRNKIKMEKINKEGILPSDILQLNNETRNG--QSEGNKERALESQKLQQDNVKDR 82
           SQ E KR  I  E  NK     +D  QL N+T N   + EG  ++A E+QK+Q      R
Sbjct: 548 SQDEAKRQAI--ETANK-----AD--QLANDTENSLKEFEGKVDKA-EAQKVQDLITSLR 597

Query: 83  ETIAKIEASKKETDDSM 99
           ET+A+++A ++   D +
Sbjct: 598 ETVARVQAGEEVNADDL 614

>Kpol_243.4 s243 complement(7505..9106) [1602 bp, 533 aa] {ON}
           complement(7505..9106) [1602 nt, 534 aa]
          Length = 533

 Score = 27.7 bits (60), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 29/56 (51%), Gaps = 7/56 (12%)

Query: 45  LPSDILQLNNETRNGQSEGNKERALE------SQKLQQDNVK-DRETIAKIEASKK 93
           LP DI    N+  NG S GN +  +E      +  L +D+ K +R+   +I++ KK
Sbjct: 72  LPPDIFTYQNKKHNGNSSGNNDDNIEDDVELLNTGLGKDSTKLNRDFFERIKSKKK 127

>ACR119W Chr3 (560761..563556) [2796 bp, 931 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YPL141C and YOR233W
           (KIN4)
          Length = 931

 Score = 27.7 bits (60), Expect = 6.9,   Method: Composition-based stats.
 Identities = 17/50 (34%), Positives = 26/50 (52%)

Query: 24  ISQSEKKRNKIKMEKINKEGILPSDILQLNNETRNGQSEGNKERALESQK 73
           IS S   RN + +E   ++G +P  ++  N E+ NGQ  G    A  SQ+
Sbjct: 471 ISSSLMNRNSVIIEVSPQKGSVPPVMIPGNRESLNGQESGGIAMADMSQR 520

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.302    0.120    0.292 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,451,713
Number of extensions: 371707
Number of successful extensions: 2448
Number of sequences better than 10.0: 186
Number of HSP's gapped: 2420
Number of HSP's successfully gapped: 191
Length of query: 111
Length of database: 53,481,399
Length adjustment: 81
Effective length of query: 30
Effective length of database: 44,193,453
Effective search space: 1325803590
Effective search space used: 1325803590
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 17 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (21.8 bits)
S2: 59 (27.3 bits)