Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_2001.775.709ON41341321950.0
TPHA0D046505.709ON42140411491e-155
ZYRO0B16478g5.709ON39140111131e-150
NCAS0G002005.709ON43840410981e-147
TDEL0B021105.709ON38935110871e-146
NDAI0F002405.709ON46433210831e-145
KLTH0E00880g5.709ON37134810401e-140
SAKL0E15070g5.709ON38533810151e-135
TBLA0E016905.709ON48833510221e-135
Kwal_55.196615.709ON3713419981e-133
Skud_9.155.709ON4023479991e-133
YIL153W (RRD1)5.709ON3933229951e-132
Smik_9.165.709ON3933479911e-132
Suva_9.355.709ON3933989841e-131
KAFR0D021905.709ON4264129601e-127
Ecym_40125.709ON3953309461e-125
AFR293C5.709ON3653279391e-124
KLLA0A00462g5.709ON3533589231e-122
CAGL0H06655g5.709ON4243779221e-121
KNAG0L021705.709ON3964078001e-103
Suva_16.1588.674ON3583104292e-48
NCAS0C016908.674ON3593094293e-48
Skud_16.1308.674ON3583094275e-48
YPL152W (RRD2)8.674ON3583094267e-48
ACR139C8.674ON3592564268e-48
Kpol_1013.48.674ON3583084251e-47
Smik_6.3498.674ON3583094251e-47
NDAI0E024108.674ON3593094189e-47
Kwal_26.87838.674ON3553074152e-46
ZYRO0F07326g8.674ON3522524152e-46
KNAG0J016908.674ON3633094163e-46
KAFR0H024408.674ON3533214144e-46
Ecym_23998.674ON3512564074e-45
TPHA0D012408.674ON3593034074e-45
CAGL0M02255g8.674ON3583094031e-44
TBLA0C018608.674ON3563123971e-43
KLTH0D11176g8.674ON3533063952e-43
TDEL0A062008.674ON3553033952e-43
SAKL0H06622g8.674ON3553073925e-43
KLLA0F11187g8.674ON3603493873e-42
Kwal_14.819singletonON56884722.6
ADL177C3.32ON90565679.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_2001.77
         (413 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa] ...   850   0.0  
TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa] ...   447   e-155
ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]...   433   e-150
NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709      427   e-147
TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.7...   423   e-146
NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709      421   e-145
KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar ...   405   e-140
SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]...   395   e-135
TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.7...   398   e-135
Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W ...   389   e-133
Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)   389   e-133
YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}  RRD1Peptidyl...   387   e-132
Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)   386   e-132
Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)   383   e-131
KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.7...   374   e-127
Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to ...   369   e-125
AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON} S...   366   e-124
KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar ...   360   e-122
CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {...   359   e-121
KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {...   312   e-103
Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152...   169   2e-48
NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {O...   169   3e-48
Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152...   169   5e-48
YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}  RRD2Activ...   168   7e-48
ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON} S...   168   8e-48
Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON} ...   168   1e-47
Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON...   168   1e-47
NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {O...   165   9e-47
Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {O...   164   2e-46
ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {...   164   2e-46
KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {...   164   3e-46
KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.6...   164   4e-46
Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar t...   161   4e-45
TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {O...   161   4e-45
CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highl...   159   1e-44
TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {O...   157   1e-43
KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {...   156   2e-43
TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa] ...   156   2e-43
SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} simila...   155   5e-43
KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} simi...   153   3e-42
Kwal_14.819 s14 complement(63184..64890) [1707 bp, 568 aa] {ON} ...    32   2.6  
ADL177C Chr4 complement(383367..386084) [2718 bp, 905 aa] {ON} S...    30   9.2  

>Kpol_2001.77 s2001 complement(211870..213111) [1242 bp, 413 aa]
           {ON} complement(211870..213111) [1242 nt, 414 aa]
          Length = 413

 Score =  850 bits (2195), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/413 (100%), Positives = 413/413 (100%)

Query: 1   MKMKQPLLNKEPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDES 60
           MKMKQPLLNKEPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDES
Sbjct: 1   MKMKQPLLNKEPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDES 60

Query: 61  YVSEIPTVNKLVKLISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTD 120
           YVSEIPTVNKLVKLISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTD
Sbjct: 61  YVSEIPTVNKLVKLISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTD 120

Query: 121 DKQNISSKCKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGG 180
           DKQNISSKCKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGG
Sbjct: 121 DKQNISSKCKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGG 180

Query: 181 DLLIIFNEYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMD 240
           DLLIIFNEYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMD
Sbjct: 181 DLLIIFNEYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMD 240

Query: 241 IVNKDLVCEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYM 300
           IVNKDLVCEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYM
Sbjct: 241 IVNKDLVCEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYM 300

Query: 301 VEVLNKFPVVQHFWFGTGLFPWIDNNTKKSLPLYENDAKKTTSIHTKSPSPSPLGISTRR 360
           VEVLNKFPVVQHFWFGTGLFPWIDNNTKKSLPLYENDAKKTTSIHTKSPSPSPLGISTRR
Sbjct: 301 VEVLNKFPVVQHFWFGTGLFPWIDNNTKKSLPLYENDAKKTTSIHTKSPSPSPLGISTRR 360

Query: 361 DFSKFTSPALNRNPICRNPNHLGIGANPLRKSNMGPPSTNSVNSIFTRNSPSI 413
           DFSKFTSPALNRNPICRNPNHLGIGANPLRKSNMGPPSTNSVNSIFTRNSPSI
Sbjct: 361 DFSKFTSPALNRNPICRNPNHLGIGANPLRKSNMGPPSTNSVNSIFTRNSPSI 413

>TPHA0D04650 Chr4 complement(1015658..1016923) [1266 bp, 421 aa]
           {ON} Anc_5.709 YIL153W
          Length = 421

 Score =  447 bits (1149), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 228/404 (56%), Positives = 285/404 (70%), Gaps = 6/404 (1%)

Query: 8   LNKEPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIPT 67
           +N +   F LP+KRIYDSQ T  FQSS+AI+RLKY++ KYI +V NV+IPD +YVSEI  
Sbjct: 7   INIKEQSFSLPLKRIYDSQSTFTFQSSIAIYRLKYYLHKYINMVHNVEIPDLTYVSEITI 66

Query: 68  VNKLVKLISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNIS- 126
           VN++  L++ELS  +D  PP  GPRR+GNL+CR WH  +D  +  LL K+L         
Sbjct: 67  VNEMSSLLTELSNDIDTIPPFEGPRRYGNLACRNWHSLIDSKVPLLLEKVLGCSNHATEK 126

Query: 127 ---SKCKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLL 183
               K K  ++EL+YYL NS GS+TRLDYGTGHELSF+AVIA +DMLGLWTEN KG DLL
Sbjct: 127 GEFEKLKGCIIELNYYLCNSLGSATRLDYGTGHELSFLAVIAAMDMLGLWTENFKGVDLL 186

Query: 184 IIFNEYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVN 243
            +F+ YY+L+KKLI+TYTLEPAGSHGVWGLDDHFH +YILGS+Q SE  NPP  P DI+N
Sbjct: 187 HMFHCYYELVKKLIVTYTLEPAGSHGVWGLDDHFHLSYILGSSQLSENPNPPFSPSDIIN 246

Query: 244 KDLVCEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEV 303
           K +V EY + N YC  I FI  VKSGPFSEHSP+LYDIS +V++W KV SGL+KMYMVEV
Sbjct: 247 KKIVTEYMHKNFYCYTIDFIYKVKSGPFSEHSPILYDISTTVNSWLKVNSGLVKMYMVEV 306

Query: 304 LNKFPVVQHFWFGTGLFPWIDNNTKKSLPLYENDAKKTTSIHTKSPSPSPLGISTRRDFS 363
           LNKFPVVQHFWFG G +PW +  T K L +Y ND  +  ++   S S S    +  +D S
Sbjct: 307 LNKFPVVQHFWFGEGFYPWKNVKTHKLLDVYMNDTNQENNVFNSSDSSSIPNNAMNKDRS 366

Query: 364 KFTSPA-LNRNPICRNPNHLGIGANPLRKSNMGPPSTNSVNSIF 406
              +P+ LNR P  R    + +    LR+  MGPPS++ V +I 
Sbjct: 367 VNQNPSQLNRIPQNRY-TAIPVNNRDLRRPPMGPPSSHGVENIL 409

>ZYRO0B16478g Chr2 complement(1336755..1337930) [1176 bp, 391 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 391

 Score =  433 bits (1113), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 215/401 (53%), Positives = 271/401 (67%), Gaps = 24/401 (5%)

Query: 7   LLNKEPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIP 66
           +L  E  +F  PVKRI+DSQ T  FQ+SVAI RLKYFI KY K++  V+IP     S I 
Sbjct: 3   MLTNENTQFNTPVKRIFDSQCTLEFQASVAIVRLKYFIQKYAKIINRVNIPQGP--SRIS 60

Query: 67  TVNKLVKLISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNIS 126
            VN+ V +++ +SLLVD+TPP  GPRR+GNL+CR+WH K+D  + SL  K+L D      
Sbjct: 61  VVNEFVGVLNHMSLLVDQTPPLEGPRRYGNLACRDWHAKIDEQMPSLWRKVLPD------ 114

Query: 127 SKCKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLIIF 186
            +    +VEL +YLGNSFGS+TRLDYGTGHELSF+AV+  IDMLGL+T+  +G D L+I 
Sbjct: 115 -RFHHCIVELVHYLGNSFGSATRLDYGTGHELSFLAVVGAIDMLGLFTDEFQGEDFLLIM 173

Query: 187 NEYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDL 246
           N YY +++KLILTYTLEPAGSHGVWGLDDHFH AY+ GSAQW+     PL+P DI+N  L
Sbjct: 174 NAYYAVVRKLILTYTLEPAGSHGVWGLDDHFHLAYVFGSAQWANYKEAPLRPRDILNHHL 233

Query: 247 VCEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNK 306
           V EYA+ N+YC  I FI  VK GPF EHS MLYD++ +VH W+K+ESGL+KMY VEVLNK
Sbjct: 234 VQEYAHLNLYCQTIGFIYQVKRGPFREHSSMLYDLATTVHTWAKLESGLMKMYAVEVLNK 293

Query: 307 FPVVQHFWFGTGLFPWIDNNTKKSLPLY---ENDAKKTTSIHTKSPSPSPLGISTRRDFS 363
           FPVVQHFWFGTG +PW+DN T K L +Y   + D + T+S   K    +    S      
Sbjct: 294 FPVVQHFWFGTGFYPWVDNQTGKQLLIYDPADADRRNTSSTGGKY---AAFVSSINSPVP 350

Query: 364 KFTSPALNRNPICRNPNHLGIGANPLRKSNMGPPSTNSVNS 404
            F +P+       R P        P R + MGPP+  + NS
Sbjct: 351 HFPAPSTTAASEARAP--------PAR-TRMGPPTARTTNS 382

>NCAS0G00200 Chr7 (29159..30475) [1317 bp, 438 aa] {ON} Anc_5.709
          Length = 438

 Score =  427 bits (1098), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 211/404 (52%), Positives = 276/404 (68%), Gaps = 22/404 (5%)

Query: 7   LLNKEPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIP 66
           +L+ +  +F LP KRI+DSQ T  FQSS+A+ RL++F+ KYI +V NV  P E  +S + 
Sbjct: 32  VLDLKTTQFSLPAKRIFDSQTTQDFQSSIALNRLRFFLQKYISMVTNVQTPPEGTLSSVT 91

Query: 67  TVNKLVKLISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNIS 126
            VN +V+L++ LS L+DETPP  GPRR+GNL+CR+WH K++  L +LL ++L      +S
Sbjct: 92  LVNSIVQLLNHLSTLIDETPPLVGPRRYGNLACRDWHTKMEAQLPALLNEILDPYLPKVS 151

Query: 127 ---SKCKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLL 183
              S     + EL+YY+ N+FGSSTRLD+GTGHELSF+A IA IDMLGLWT+ ++G D+L
Sbjct: 152 GESSSMHPCIQELNYYISNAFGSSTRLDFGTGHELSFMAFIAAIDMLGLWTDGMQGTDIL 211

Query: 184 IIFNEYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVN 243
           ++FN YY L++KLILTYTLEPAGSHGVWGLDDHFH AYILGS+QW    N P++P D+ +
Sbjct: 212 LLFNTYYALVRKLILTYTLEPAGSHGVWGLDDHFHLAYILGSSQW--IRNAPMRPRDVKD 269

Query: 244 KDLVCEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEV 303
             LV +YA +N+YC  I FI  VKSGPFSEHSP+LYDI+ SV  WSKV+ GL+KMYM EV
Sbjct: 270 ISLVKQYAKSNLYCQCIAFIFQVKSGPFSEHSPILYDIATSVTTWSKVQRGLIKMYMDEV 329

Query: 304 LNKFPVVQHFWFGTGLFPWIDNNTKKSLPLYENDAKKTTSIHTKSPSPSPLGISTRRDFS 363
           L KFPVVQHFWFG G +PWI+ +T K LP+YE+             SP        R+  
Sbjct: 330 LKKFPVVQHFWFGDGFYPWINQHTGKPLPIYEH-------------SPEDDETEQEREIQ 376

Query: 364 KFTSPALNRNPICRNPNHLGIGANPL---RKSNMGPPSTNSVNS 404
           ++       N   R     GI A P     ++NM PPS+  +NS
Sbjct: 377 QYAPHWHKENAHVRTAKP-GITAMPSVTNTRTNMAPPSSRMMNS 419

>TDEL0B02110 Chr2 (376429..377598) [1170 bp, 389 aa] {ON} Anc_5.709
           YIL153W
          Length = 389

 Score =  423 bits (1087), Expect = e-146,   Method: Compositional matrix adjust.
 Identities = 210/351 (59%), Positives = 256/351 (72%), Gaps = 12/351 (3%)

Query: 3   MKQPLLNKEPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYV 62
           + +P ++    +F  PVK I+DSQG S FQ SVAI RLKY + KY +++    I  E   
Sbjct: 2   ISEPRIDISQTKFESPVKCIFDSQGASDFQQSVAIDRLKYHLEKYARMIHGQPIVHEP-- 59

Query: 63  SEIPTVNKLVKLISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDK 122
           S I  VN++V L+S LS LVDETPP  GPRR+GNL+CR+WH K+D NL  LL ++L  D 
Sbjct: 60  SGIEVVNRVVSLLSRLSELVDETPPFSGPRRYGNLACRDWHDKLDANLTELLQQVLPQDY 119

Query: 123 QNISSKCKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDL 182
                KC   + ELSYYLGNSFGSSTRLDYGTGHELSF+AV+  +DMLGLWT    G D+
Sbjct: 120 H----KC---IPELSYYLGNSFGSSTRLDYGTGHELSFLAVLGALDMLGLWTSEFSGKDV 172

Query: 183 LIIFNEYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIV 242
           L++F+ YYKL++KLILTYTLEPAGSHGVWGLDDHFH  YILGS+QWS     P+ P D+ 
Sbjct: 173 LLLFDTYYKLVRKLILTYTLEPAGSHGVWGLDDHFHIIYILGSSQWSSDPAVPMTPRDVK 232

Query: 243 NKDLVCEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVE 302
           NK LV +YA+TN+YC AI FI  VKSGPFSEHS MLYDI+ +V  WSKV+SGLLKMY VE
Sbjct: 233 NKVLVQDYADTNLYCQAIDFIFHVKSGPFSEHSSMLYDIASTVQTWSKVQSGLLKMYYVE 292

Query: 303 VLNKFPVVQHFWFGTGLFPWIDNNTKKSLPLYEN---DAKKTTSIHTKSPS 350
           VL KFPVVQHFWFG G +PWI +   + LP+YEN   + K+  S+ T +PS
Sbjct: 293 VLKKFPVVQHFWFGPGFYPWISDRNGQKLPIYENAESEKKQPPSMTTMAPS 343

>NDAI0F00240 Chr6 (46047..47441) [1395 bp, 464 aa] {ON} Anc_5.709
          Length = 464

 Score =  421 bits (1083), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 201/332 (60%), Positives = 256/332 (77%), Gaps = 11/332 (3%)

Query: 7   LLNKEPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPD--ESYVSE 64
           LL+ +   F LPVKRI+DSQ T  FQSS+A+ RL++F+ +YI+LV NV+IP   +SYVSE
Sbjct: 13  LLDLKATNFSLPVKRIFDSQTTQDFQSSIALQRLRFFLQRYIELVANVEIPPHPDSYVSE 72

Query: 65  IPTVNKLVKLISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQN 124
           I  VN ++ L++ELS +V +TPP  GPRR+GNL+CR+WH K+++ L  LL K +      
Sbjct: 73  ILMVNSIIHLLNELSTIVQDTPPLKGPRRYGNLACRDWHSKIEVELPKLLEKAIP----- 127

Query: 125 ISSKCKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLI 184
            S   + S++EL+YY+ NSFGSSTRLDYGTGHELSF+A IA +DMLGL+ + + G DLLI
Sbjct: 128 -SPDLQPSIIELNYYIANSFGSSTRLDYGTGHELSFMAFIAALDMLGLFPD-LTGKDLLI 185

Query: 185 IFNEYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNK 244
           +FN YY L+++LILTYTLEPAGSHGVWGLDDHFH AYILGS+QW   NN PL P +I N 
Sbjct: 186 MFNAYYSLVRELILTYTLEPAGSHGVWGLDDHFHLAYILGSSQW--LNNAPLTPKEITNS 243

Query: 245 DLVCEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVL 304
            LV +Y+  N+YC  I+F+  VKSGPF+EHSP+LYDIS SV  W KV+ GL+KMYM EVL
Sbjct: 244 RLVKDYSTKNLYCQCIEFVLTVKSGPFAEHSPILYDISTSVSAWRKVQRGLIKMYMDEVL 303

Query: 305 NKFPVVQHFWFGTGLFPWIDNNTKKSLPLYEN 336
           NKFPVVQHFWFGTG +PWI+  T + LP+YE+
Sbjct: 304 NKFPVVQHFWFGTGFYPWINFQTLRELPVYEH 335

>KLTH0E00880g Chr5 (87353..88468) [1116 bp, 371 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 371

 Score =  405 bits (1040), Expect = e-140,   Method: Compositional matrix adjust.
 Identities = 193/348 (55%), Positives = 246/348 (70%), Gaps = 12/348 (3%)

Query: 15  FCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIPTVNKLVKL 74
           F  P KRI+DS+G+ +FQSSVA+ RLK ++ KY+  +  V IP+ S   E+ +  +L+K 
Sbjct: 13  FTEPTKRIFDSRGSHVFQSSVAMGRLKSYLHKYVSSMSGVKIPETSTNHEVRSFAELLKT 72

Query: 75  ISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDSVV 134
           +SEL   VD TP  PGPRR+GNL+CR WH KVD +L++LL K L +        C  S+V
Sbjct: 73  LSEL---VDSTPALPGPRRYGNLACRTWHDKVDESLEALLHKFLPE-------PCHKSIV 122

Query: 135 ELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLIIFNEYYKLMK 194
           EL YYLGN+FGS  RLDYGTGHELSF A I  +DMLG+W  + +  D+L +F++YY L++
Sbjct: 123 ELQYYLGNAFGSRERLDYGTGHELSFFAEICALDMLGVWGADFQASDVLFLFDKYYALVR 182

Query: 195 KLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLVCEYANTN 254
           KL+LTYTLEPAGSHGVWGLDDHFH  YI G++QW +    P+ P ++ +K +V EY  TN
Sbjct: 183 KLVLTYTLEPAGSHGVWGLDDHFHLIYIFGASQWVDGKCAPIAPREVQDKLIVDEYTKTN 242

Query: 255 MYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVVQHFW 314
            YC AI FI  VKSGPFSEHSPML+DIS+SV  WSKV+ GLLKMY  EVLNKFPVVQHFW
Sbjct: 243 FYCQAISFIFQVKSGPFSEHSPMLFDISRSVPTWSKVQRGLLKMYFAEVLNKFPVVQHFW 302

Query: 315 FGTGLFPWIDNNTKKSLPLYE--NDAKKTTSIHTKSPSPSPLGISTRR 360
           FGTGLFPW       +LP YE   +A+     HT +P+P+ L  + R+
Sbjct: 303 FGTGLFPWTSLGDGYALPTYEASQEAQGQVLQHTTAPAPTNLNSARRQ 350

>SAKL0E15070g Chr5 complement(1253760..1254917) [1158 bp, 385 aa]
           {ON} similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153W RRD1 Resistant to Rapamycin Deletion
          Length = 385

 Score =  395 bits (1015), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 189/338 (55%), Positives = 239/338 (70%), Gaps = 10/338 (2%)

Query: 3   MKQPLLNKEPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYV 62
           +  P ++    +F  PVK+I+D+QGT  FQSSV ++RL+ ++ KYI LV   +IP     
Sbjct: 5   ITTPKIDVSHTKFTEPVKKIFDTQGTQDFQSSVTMYRLQSYLHKYITLVGTKNIPS---T 61

Query: 63  SEIPTVNKLVKLISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDK 122
           S    VN+  ++I  LS  +DETPP PGPRRFGN +CR WH K+  +L +LL        
Sbjct: 62  SNNDAVNRFTQIIDALSRTIDETPPLPGPRRFGNFACRTWHVKMRGSLDALLQAF----- 116

Query: 123 QNISSKCKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDL 182
             I  K    +VE+ YYLGN+FGS  RLDYGTGHELSF+AV++ IDML LW  N  G D+
Sbjct: 117 --IPEKYHVCIVEIRYYLGNAFGSKERLDYGTGHELSFLAVVSAIDMLDLWGSNPSGEDI 174

Query: 183 LIIFNEYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIV 242
           L +FN YY L+KKLI TYTLEPAGSHGVWGLDDHFH AYILGS+Q +  ++ PL+P DI+
Sbjct: 175 LFLFNGYYTLVKKLIATYTLEPAGSHGVWGLDDHFHLAYILGSSQLAPISHNPLRPSDIL 234

Query: 243 NKDLVCEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVE 302
           ++  V +YA TN+Y  AI FID VKSG FSEHSPMLYDI+++V  WSKV+ GLLKMY  E
Sbjct: 235 DRHTVEDYAKTNLYFQAIAFIDKVKSGSFSEHSPMLYDIAKTVSTWSKVQRGLLKMYSAE 294

Query: 303 VLNKFPVVQHFWFGTGLFPWIDNNTKKSLPLYENDAKK 340
           VLNKFPVVQHFWFGTG FPW++  +   LP YE + ++
Sbjct: 295 VLNKFPVVQHFWFGTGFFPWVNVKSGAILPTYEANQEE 332

>TBLA0E01690 Chr5 (406884..408350) [1467 bp, 488 aa] {ON} Anc_5.709
           YIL153W
          Length = 488

 Score =  398 bits (1022), Expect = e-135,   Method: Compositional matrix adjust.
 Identities = 191/335 (57%), Positives = 241/335 (71%), Gaps = 18/335 (5%)

Query: 15  FCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIPTVNKLVKL 74
           F  P K+I+DSQGT  F  S+A  R++YFISKY +L+   +IP   Y S   T++ + K+
Sbjct: 15  FSAPTKQIFDSQGTQYFNRSIAFHRIQYFISKYTQLIQEENIPPTDYTSSNDTISGVSKI 74

Query: 75  ISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDSV- 133
           I++L  LV+ETPP PGPRR+GNLSCR+WHK+VD N+  L  K LT      +   KD + 
Sbjct: 75  INDLIKLVEETPPLPGPRRYGNLSCRQWHKRVDDNINELFEKYLTISNTKFN---KDQLF 131

Query: 134 VELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLIIFNEYYKLM 193
           +EL YY   S GS TRLDYGTGHELSF+A I  +DML L T+ I G D+L IFNEYY+L+
Sbjct: 132 LELIYYFNASLGSPTRLDYGTGHELSFLAFIGALDMLNLLTD-ISGTDILFIFNEYYRLI 190

Query: 194 KKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETN-------------NPPLKPMD 240
           +KLIL YTLEPAGSHGVWGLDDHFH  YI GS+QW   N               P+KP+D
Sbjct: 191 RKLILNYTLEPAGSHGVWGLDDHFHLIYIFGSSQWCPENADMTEPSISEPKFKAPIKPVD 250

Query: 241 IVNKDLVCEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYM 300
           I+NK+L+ ++ ++N YC +I FI  VK+GPF EHSP+L+DI+++VHNW KV SGLLKMYM
Sbjct: 251 ILNKNLIEKFKSSNFYCQSILFILTVKTGPFPEHSPILFDIAKNVHNWKKVRSGLLKMYM 310

Query: 301 VEVLNKFPVVQHFWFGTGLFPWIDNNTKKSLPLYE 335
           VEVLNKFPVVQHFWFGTG +PWI+++T   LP YE
Sbjct: 311 VEVLNKFPVVQHFWFGTGFYPWINSSTLMKLPTYE 345

>Kwal_55.19661 s55 (69740..70855) [1116 bp, 371 aa] {ON} YIL153W
           (RRD1) - Resistant to Rapamycin Deletion [contig 159]
           FULL
          Length = 371

 Score =  389 bits (998), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 187/341 (54%), Positives = 235/341 (68%), Gaps = 10/341 (2%)

Query: 3   MKQPLLNKEPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYV 62
           M+Q  ++     F  PVKRI+DS+GT +FQSSVA+ RLK  + KY+ ++    IP E+  
Sbjct: 1   MEQDQIDVGTTTFTEPVKRIFDSRGTHVFQSSVAMIRLKKHLHKYLGMLSGQRIPSET-- 58

Query: 63  SEIPTVNKLVKLISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDK 122
              P V  L K++   S LVDETP  PGPRR+GNL+CR+WH K++  ++  L + L +  
Sbjct: 59  -SNPNVISLRKILHFFSKLVDETPALPGPRRYGNLACRDWHDKMEEQIREQLQEFLPE-- 115

Query: 123 QNISSKCKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDL 182
                K   S+VEL+YYLGN+FGS  RLDYGTGHELSF +VI  +DMLG+W    +  DL
Sbjct: 116 -----KYYPSIVELAYYLGNAFGSRERLDYGTGHELSFFSVICALDMLGIWGSGFQAKDL 170

Query: 183 LIIFNEYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIV 242
           L +FNEYY L++KLI  Y+LEPAGSHGVWGLDDHFH  YI G++QW+++ +    P +I 
Sbjct: 171 LYLFNEYYSLVRKLITKYSLEPAGSHGVWGLDDHFHLIYIFGASQWADSKDAEASPREIQ 230

Query: 243 NKDLVCEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVE 302
           +K +V EYA +N YC AI FI  VKSGPFSEHSPMLYDIS+SV  WSKV+ GLLKMY  E
Sbjct: 231 SKMIVDEYAGSNFYCQAISFIFKVKSGPFSEHSPMLYDISRSVPTWSKVQRGLLKMYFAE 290

Query: 303 VLNKFPVVQHFWFGTGLFPWIDNNTKKSLPLYENDAKKTTS 343
           VLNKFPVVQHFWFGT LFPW   +    LP YE   +  T 
Sbjct: 291 VLNKFPVVQHFWFGTALFPWTSTDGGDVLPTYEVSQETDTQ 331

>Skud_9.15 Chr9 (32255..33463) [1209 bp, 402 aa] {ON} YIL153W (REAL)
          Length = 402

 Score =  389 bits (999), Expect = e-133,   Method: Compositional matrix adjust.
 Identities = 190/347 (54%), Positives = 246/347 (70%), Gaps = 11/347 (3%)

Query: 15  FCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPD-ESYVSEIPTVNKLVK 73
           F  PVKRI+D+Q T  FQSS+AI R+KY + KY  L+ +   PD  +  S I  VN L+ 
Sbjct: 22  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCPDPDAHAASSSIAMVNGLMG 81

Query: 74  LISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDSV 133
           ++ +L+ L+DETPP PGPRR+GNL+CREWH K+D +L   L +ML  +   +       V
Sbjct: 82  VLDKLAQLIDETPPLPGPRRYGNLACREWHYKLDEHLSQWLQEMLPAEYHVV-------V 134

Query: 134 VELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLIIFNEYYKLM 193
            EL YYLGNSFGSSTRLDYGTGHELSF+A +A +D+LG++  +++G D+ ++FN+YY +M
Sbjct: 135 PELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGVFP-HLRGNDVFLLFNKYYTIM 193

Query: 194 KKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETN-NPPLKPMDIVNKDLVCEYAN 252
           ++LILTYTLEPAGSHGVWGLDDHFH  YILGS+QW   +   PL+P ++++K LV +Y +
Sbjct: 194 RRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDARAPLQPREVLDKSLVHDYKD 253

Query: 253 TNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVVQH 312
           TN YC  I FI+ VK GPF EHSP+LYDI+ +V  WSKV  GLLKMY VEVL KFPVVQH
Sbjct: 254 TNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQH 313

Query: 313 FWFGTGLFPWIDNNTKKSLPLYENDAKKTTSIHTKSPSPSPLGISTR 359
           FWFGTG FPW++      LP++E    +T      + SP P   STR
Sbjct: 314 FWFGTGFFPWVNIQNGTDLPVFEEKEDETIE-QANAASPGPNHTSTR 359

>YIL153W Chr9 (55198..56379) [1182 bp, 393 aa] {ON}
           RRD1Peptidyl-prolyl cis/trans-isomerase; activator of
           the phosphotyrosyl phosphatase activity of PP2A;
           involved in G1 phase progression, microtubule dynamics,
           bud morphogenesis and DNA repair; required for rapid
           reduction of Sgs1p levels in response to rapamycin;
           subunit of the Tap42p-Sit4p-Rrd1p complex
          Length = 393

 Score =  387 bits (995), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 186/322 (57%), Positives = 236/322 (73%), Gaps = 10/322 (3%)

Query: 15  FCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPD-ESYVSEIPTVNKLVK 73
           F  PVKRI+D+Q T  FQSS+AI R+KY + KY  L+ +   PD  +  S I  VN L+ 
Sbjct: 13  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLISHCSDPDPHATASSIAMVNGLMG 72

Query: 74  LISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDSV 133
           ++ +L+ L+DETPP PGPRR+GNL+CREWH K+D  L   L +ML        S+  + V
Sbjct: 73  VLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLQEML-------PSEYHEVV 125

Query: 134 VELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLIIFNEYYKLM 193
            EL YYLGNSFGSSTRLDYGTGHELSF+A +A +DMLG++  +++G D+ ++FN+YY +M
Sbjct: 126 PELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDMLGMF-PHMRGADVFLLFNKYYTIM 184

Query: 194 KKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETN-NPPLKPMDIVNKDLVCEYAN 252
           ++LILTYTLEPAGSHGVWGLDDHFH  YILGS+QW   +   PL+P +I++K LV EY +
Sbjct: 185 RRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKD 244

Query: 253 TNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVVQH 312
           TN YC  I FI+ VK GPF EHSP+LYDI+ +V  WSKV  GLLKMY VEVL KFPVVQH
Sbjct: 245 TNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQH 304

Query: 313 FWFGTGLFPWIDNNTKKSLPLY 334
           FWFGTG FPW++      LP++
Sbjct: 305 FWFGTGFFPWVNIQNGTDLPVF 326

>Smik_9.16 Chr9 (32798..33979) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  386 bits (991), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 192/347 (55%), Positives = 247/347 (71%), Gaps = 11/347 (3%)

Query: 15  FCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPD-ESYVSEIPTVNKLVK 73
           F  PVKRI+D+Q T  FQSS+AI R+KY + KY  L+ +   PD ++  S IP  N L++
Sbjct: 13  FSTPVKRIFDTQTTLDFQSSLAIHRIKYHLHKYTTLMSHCADPDPQAVASSIPMDNGLMQ 72

Query: 74  LISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDSV 133
           ++ +L+ L+DETPP PGPRR+GNL+CREWH K+D  L   L +ML  +   +       V
Sbjct: 73  VLDKLAHLIDETPPLPGPRRYGNLACREWHHKLDERLPQWLREMLPPEYHVV-------V 125

Query: 134 VELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLIIFNEYYKLM 193
            EL YYLGNSFGSSTRLDYGTGHELSF+A +  +D+LG++  +++G D+ ++FN+YY +M
Sbjct: 126 PELQYYLGNSFGSSTRLDYGTGHELSFMATVTALDLLGMF-PHLRGTDVFLLFNKYYTIM 184

Query: 194 KKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETN-NPPLKPMDIVNKDLVCEYAN 252
           ++LILTYTLEPAGSHGVWGLDDHFH  YILGS+QW   +   PL+P +I++K LV EY N
Sbjct: 185 RRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPREILDKSLVREYKN 244

Query: 253 TNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVVQH 312
           TN YC  I FI+ VK GPF EHSP+LYDI+ +V  WSKV  GLLKMY VEVL KFPVVQH
Sbjct: 245 TNFYCQGINFINEVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLKKFPVVQH 304

Query: 313 FWFGTGLFPWIDNNTKKSLPLYENDAKKTTSIHTKSPSPSPLGISTR 359
           FWFGTG FPW++     +LP++E   ++T       P P P   STR
Sbjct: 305 FWFGTGFFPWVNIQNGTNLPVFEEKEEETIEQANAGP-PGPEHTSTR 350

>Suva_9.35 Chr9 (49860..51041) [1182 bp, 393 aa] {ON} YIL153W (REAL)
          Length = 393

 Score =  383 bits (984), Expect = e-131,   Method: Compositional matrix adjust.
 Identities = 198/398 (49%), Positives = 259/398 (65%), Gaps = 35/398 (8%)

Query: 15  FCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPD-ESYVSEIPTVNKLVK 73
           F  PVKRI+D+Q T  FQSS+AI R+KY + KY  L+ +   PD  +  S IP VN L+ 
Sbjct: 13  FSTPVKRIFDTQTTQDFQSSLAIHRIKYHLHKYTTLMSHCADPDPHATASSIPMVNGLMA 72

Query: 74  LISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDSV 133
           ++   + L+D+TPP PGPRR+GNL+CREWH K+D +L   L ++L      +       V
Sbjct: 73  VLDRFAQLIDDTPPLPGPRRYGNLACREWHYKLDAHLAQWLREVLPAQYHAV-------V 125

Query: 134 VELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLIIFNEYYKLM 193
            EL YYLGNSFGSSTRLDYGTGHELSF+A +A +D+LGL+  +++G D+ ++F++YY +M
Sbjct: 126 PELQYYLGNSFGSSTRLDYGTGHELSFMATVAALDLLGLF-PHLRGTDVFLLFSKYYAIM 184

Query: 194 KKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETN-NPPLKPMDIVNKDLVCEYAN 252
           ++LILTYTLEPAGSHGVWGLDDHFH  YILGS+QW   +   PL+P D+++K LV EY +
Sbjct: 185 RRLILTYTLEPAGSHGVWGLDDHFHLVYILGSSQWQLLDAQAPLQPRDVLDKSLVREYQD 244

Query: 253 TNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVVQH 312
           TN YC  I FI+ VK GPF EHSP+LYDI+ +V  WSKV  GLLKMY VEVL KFPVVQH
Sbjct: 245 TNFYCQGINFINQVKMGPFEEHSPILYDIAVTVPRWSKVCKGLLKMYSVEVLQKFPVVQH 304

Query: 313 FWFGTGLFPWIDNNTKKSLPLYENDAKKTTSIHTKSPSPSPLGISTRRDFSKFTSPALNR 372
           FWFGTG FPWI+      LP++E   +++      + S +P   STR             
Sbjct: 305 FWFGTGFFPWINVQNGTDLPVFEEKEEESID-QANATSATPDRTSTR------------- 350

Query: 373 NPICRNPNHLGIGANPLRKSNMGPPSTNSVNSIFTRNS 410
                        A+      M PPS N+VNS+ +  +
Sbjct: 351 -----------FPASTSMPPPMAPPSANNVNSLLSHQN 377

>KAFR0D02190 Chr4 (439664..440944) [1281 bp, 426 aa] {ON} Anc_5.709
           YIL153W
          Length = 426

 Score =  374 bits (960), Expect = e-127,   Method: Compositional matrix adjust.
 Identities = 205/412 (49%), Positives = 269/412 (65%), Gaps = 24/412 (5%)

Query: 5   QPLLNKEPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSE 64
           QP+++    +F +P KRI+DSQ T  FQ SVA +RLKYF +KYI LV  V +P    ++ 
Sbjct: 7   QPVVDPFASKFSIPAKRIFDSQTTQYFQHSVANYRLKYFTNKYINLVRGVPLPVSRNIT- 65

Query: 65  IPTVNKLVKLISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQN 124
           +     ++ L+ + S  +DETPP   PRRFGNLSCR WH K++  L   L K + D+   
Sbjct: 66  MTITRYILDLLDKCSQFIDETPPLIEPRRFGNLSCRTWHDKINSYLPGEL-KTIIDNFST 124

Query: 125 ISSKCKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLI 184
           I ++  +   EL+YYL NSFGS TRLDYGTGHELSF+A I+ IDM+ +  +++   D L+
Sbjct: 125 IENE--NMFNELNYYLLNSFGSKTRLDYGTGHELSFLAFISCIDMIRM-LQDMTADDFLL 181

Query: 185 IFNEYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNK 244
           I+  YY L +KLILTYTLEPAGSHGVWGLDDHFH AYI GS+Q   ++   L P DI+ K
Sbjct: 182 IWQSYYNLTRKLILTYTLEPAGSHGVWGLDDHFHLAYIFGSSQLI-SDISHLAPKDILKK 240

Query: 245 DLVCEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVL 304
           D+V E+   N+YC AI FI  VK GPF+EHSP+LYDIS++V +WSKV  GLLKMY  EVL
Sbjct: 241 DVVAEHKENNLYCQAINFIFTVKKGPFNEHSPILYDISKNVKSWSKVLKGLLKMYNDEVL 300

Query: 305 NKFPVVQHFWFGTGLFPWIDNNTKKSLPLYENDAKKTTSIHTKSPSPSPLGI----STRR 360
           NKFPVVQHFWFG G FPW DNN+ K LP++E         H++  SP+P  +    S+  
Sbjct: 301 NKFPVVQHFWFGDGFFPWKDNNSGKDLPVFE---------HSEGESPNPAIMTMMPSSTE 351

Query: 361 DFSKFTSPALNRNPICRNPNH-LGIGANPLRKSN---MGPPSTNSVNSIFTR 408
             + F     +++PI  NPN+ + +   P    N   M PPSTN +NS  +R
Sbjct: 352 TMASFNLARSSKSPIM-NPNYKMSMHRPPSLSKNSREMKPPSTNVINSYLSR 402

>Ecym_4012 Chr4 (29674..30861) [1188 bp, 395 aa] {ON} similar to
           Ashbya gossypii AFR293C
          Length = 395

 Score =  369 bits (946), Expect = e-125,   Method: Compositional matrix adjust.
 Identities = 178/330 (53%), Positives = 234/330 (70%), Gaps = 14/330 (4%)

Query: 14  EFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIPTVNKLVK 73
           +F  PVKRI+DS GT  FQ S+ ++RL+  + +Y+ LV N ++P    VS   +V+  V 
Sbjct: 9   KFSAPVKRIFDSHGTHDFQRSLTMYRLQSHLERYLGLVHNQEVPK---VSTNGSVSSFVS 65

Query: 74  LISELSL-LVDETPPAPG-PRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKD 131
           +  +  L L+DETPP    PRRFGN++CR+WH KV   + SL  + L  ++      C  
Sbjct: 66  IFLDRFLELIDETPPTTNTPRRFGNMACRDWHAKVQEEMDSLWRRFLPIERDAAYENC-- 123

Query: 132 SVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWT-----ENIKGGDLLIIF 186
            ++EL YYLGN+FGS  RLDYGTGHELSF+AV+  +DMLGLW        + G DLL ++
Sbjct: 124 -IIELRYYLGNAFGSPERLDYGTGHELSFLAVVVAVDMLGLWETSESGHGLTGTDLLYLW 182

Query: 187 NEYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETN-NPPLKPMDIVNKD 245
           N+YY ++ KLILTYTLEPAGSHGVWGLDDH H AYI+G++QWS+ + N P++  DI++  
Sbjct: 183 NKYYSIVHKLILTYTLEPAGSHGVWGLDDHIHLAYIIGASQWSDKDQNAPIQLSDILDMK 242

Query: 246 LVCEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLN 305
            + +Y +TN+YC++I F+  VKSGPFS+HSPMLYDIS++V  WSK  SGL+KMY VEVLN
Sbjct: 243 SLYQYEDTNLYCNSIAFVMKVKSGPFSQHSPMLYDISRTVPTWSKATSGLIKMYQVEVLN 302

Query: 306 KFPVVQHFWFGTGLFPWIDNNTKKSLPLYE 335
           KFPVVQHFWFGTG FPW+D     SLP YE
Sbjct: 303 KFPVVQHFWFGTGFFPWVDMKKGMSLPNYE 332

>AFR293C Chr6 complement(967308..968405) [1098 bp, 365 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YIL153W
           (RRD1)
          Length = 365

 Score =  366 bits (939), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 172/327 (52%), Positives = 229/327 (70%), Gaps = 12/327 (3%)

Query: 11  EPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIPTVNK 70
           E  +F  PVKRI+D+ GT  FQ S+ ++RL+  + +Y+KLV    IP  S   +   V +
Sbjct: 6   EGTQFSPPVKRIFDTAGTHDFQKSLTMYRLQSHLERYLKLVQGQKIPKSS---QNRAVVR 62

Query: 71  LVKLISELSLLVDETPPAPG-PRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKC 129
            V ++  L  L+DETPP  G  RRFG+L+CR+WH ++   L  LL  +L +         
Sbjct: 63  FVCILERLDALMDETPPRTGSARRFGDLACRDWHDRMQGELDGLLETLLPE-------AA 115

Query: 130 KDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTEN-IKGGDLLIIFNE 188
           + S  EL YYLG++FGS  RLDYGTGHEL+F+AV+  +DMLGLWTE+   G D+L ++  
Sbjct: 116 RRSAAELRYYLGSAFGSRERLDYGTGHELAFLAVVVALDMLGLWTEDKFTGEDMLYVWAR 175

Query: 189 YYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLVC 248
           YY L+ +LILTY LEPAGSHGVWGLDDH H AYILG++QW++  N P++P DI++   V 
Sbjct: 176 YYALVHRLILTYNLEPAGSHGVWGLDDHLHLAYILGASQWAQDRNVPMQPSDILDPKAVA 235

Query: 249 EYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFP 308
            Y+ TN+YC++I F+  VK+G F++HSPML+DI+Q+V  WSKV +GL+KMY VEVLNKFP
Sbjct: 236 RYSETNLYCNSIAFLLRVKTGHFAQHSPMLHDIAQTVPTWSKVTTGLIKMYRVEVLNKFP 295

Query: 309 VVQHFWFGTGLFPWIDNNTKKSLPLYE 335
           VVQHFWFGTG FPW+D     SLP YE
Sbjct: 296 VVQHFWFGTGFFPWVDMAHGMSLPNYE 322

>KLLA0A00462g Chr1 (38766..39827) [1062 bp, 353 aa] {ON} similar to
           uniprot|P40454 Saccharomyces cerevisiae YIL153W RRD1
           Resistant to Rapamycin Deletion
          Length = 353

 Score =  360 bits (923), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 184/358 (51%), Positives = 242/358 (67%), Gaps = 17/358 (4%)

Query: 8   LNKEPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIPT 67
            + E  +F +P KRI+DSQGT  FQ+SVA+ R++Y + KYI L     IPD   + E   
Sbjct: 3   FDYENAKFSMPEKRIFDSQGTLDFQNSVAMVRIQYHLQKYITLCKGQQIPDT--IKESFF 60

Query: 68  VNKLVKLISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISS 127
            N +V+L+  LS L+DETPP     R+GNLS R+W  K    L++ L ++L +       
Sbjct: 61  TNIVVELLKRLSALIDETPPERMHSRYGNLSYRDWQTKFQNQLENWLHELLPE------- 113

Query: 128 KCKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLIIFN 187
           K  +S++ELSYY+ N+FGS  R+DYGTGHELSF+AVI  +DML +  E IKG  LL  FN
Sbjct: 114 KYNNSIIELSYYISNAFGSKERIDYGTGHELSFLAVIICLDMLKI--ETIKGPALLYCFN 171

Query: 188 EYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLV 247
            YY +++KLILTY LEPAGSHGVWGLDDHFHF+YILG+ Q  + N   L P DI N  L+
Sbjct: 172 SYYDVIQKLILTYKLEPAGSHGVWGLDDHFHFSYILGATQLLDVNTS-LIPKDISNTRLM 230

Query: 248 CEYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKF 307
            + +++N++C +I+FI+ VKSGPFS HSP+LY+IS+SVH W K++ GL+KMY VEVLNKF
Sbjct: 231 EQNSSSNLFCKSIRFINVVKSGPFSNHSPLLYNISRSVHTWHKMQQGLIKMYKVEVLNKF 290

Query: 308 PVVQHFWFGTGLFPWIDNNTKKSLPLYE-----NDAKKTTSIHTKSPSPSPLGISTRR 360
           PVVQHFWFGT  FPW       SLP+Y+     +DA   T+ +  +  P PL  ST R
Sbjct: 291 PVVQHFWFGTAFFPWTSYGNNHSLPIYQPAENNDDADFLTANNATTKMPPPLSTSTSR 348

>CAGL0H06655g Chr8 complement(661713..662987) [1275 bp, 424 aa] {ON}
           similar to uniprot|P40454 Saccharomyces cerevisiae
           YIL153w RRD1
          Length = 424

 Score =  359 bits (922), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 190/377 (50%), Positives = 246/377 (65%), Gaps = 20/377 (5%)

Query: 15  FCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIPTVNKLVKL 74
           F  PVKRIYDSQG   FQSS AI RL+  I KY  LV + D+ D   +     V  +VK+
Sbjct: 2   FSEPVKRIYDSQGAYYFQSSEAIRRLEGAIVKYTDLVESRDVAD---LELSGVVGGVVKV 58

Query: 75  ISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDSVV 134
           +  L  LV ETPP PGPRR+GN++CR+WH+K++  +  LL  +++    +  S+ +  VV
Sbjct: 59  LDRLDQLVSETPPIPGPRRYGNMACRDWHEKIEREIPGLLEDLIS---SHFPSELQ-CVV 114

Query: 135 ELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLIIFNEYYKLMK 194
           EL YYL NSFGS+TRLD+GTGHELSF+A +A +DMLG    +  G  +L IF+ YY L+ 
Sbjct: 115 ELRYYLANSFGSATRLDFGTGHELSFLATVAALDMLG---ASFDGDQVLYIFDRYYSLVH 171

Query: 195 KLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLVCEYANTN 254
           +LIL+YTLEPAGSHGVWGLDDHFH AYILGS+QW       ++P D+ +  LV +Y+ TN
Sbjct: 172 RLILSYTLEPAGSHGVWGLDDHFHLAYILGSSQWCNRKKLAMEPNDLSDPVLVEQYSRTN 231

Query: 255 MYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVVQHFW 314
           ++C  + F+  VKSG F EHSPML+DIS+SV  W+KV  GL KMY  EVLNKFPV+QHFW
Sbjct: 232 IFCKTLNFVFTVKSGAFREHSPMLFDISRSVRTWAKVRKGLWKMYKDEVLNKFPVIQHFW 291

Query: 315 FGTGLFPWIDNNTKKSLPLYEN--DAKKTTSIHTKSPSPSPLGISTRRDFSKFTSPA--- 369
           FGTG +PW+D    K LP YEN  D  +T  + T++ +       TR   S+F SP    
Sbjct: 292 FGTGFYPWVDYKNGKPLPNYENSPDIDETNDLKTQAQANMD---GTRVVESRFLSPGNET 348

Query: 370 LNRNPICRNPNHLGIGA 386
             R P    P   G+G 
Sbjct: 349 FVRRPQL--PQDSGVGT 363

>KNAG0L02170 Chr12 complement(388956..390146) [1191 bp, 396 aa] {ON}
           Anc_5.709 YIL153W
          Length = 396

 Score =  312 bits (800), Expect = e-103,   Method: Compositional matrix adjust.
 Identities = 169/407 (41%), Positives = 235/407 (57%), Gaps = 35/407 (8%)

Query: 8   LNKEPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIPT 67
           L+ E   F  P KRI+DSQ T+ FQ SVA+ R+++ I KY++++       ++      +
Sbjct: 16  LDVEHAVFRQPQKRIFDSQTTATFQESVALARIRFHIEKYMRMMRG-----DTSGGISAS 70

Query: 68  VNKLVKLISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISS 127
           V ++++++  L  LVDETPP  GPRR+GNL+CR+WH KVD +L  L  ++   D      
Sbjct: 71  VARMLQILDRLDALVDETPPLVGPRRYGNLACRDWHDKVDSSLPGLTSQV---DCLAGGG 127

Query: 128 KCKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLIIFN 187
            C    +E  YYL NSFGS  RLDYGTGHELSF+A +A +DM+      I   +L  +++
Sbjct: 128 AC----IEAEYYLRNSFGSKIRLDYGTGHELSFLAFVAALDMMSQ-PRGITPVELSRLWD 182

Query: 188 EYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNP-PLKPMDIVNKDL 246
            YY+L+++LI+ Y LEPAGSHGVWGLDDHFH AY+ G++Q++  NNP  ++P D+++  +
Sbjct: 183 RYYRLVRRLIVDYNLEPAGSHGVWGLDDHFHLAYLWGASQFA--NNPVGVQPRDVLSGVI 240

Query: 247 VC-EYANTNMYCSAIKFIDCVKSGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLN 305
              + A  N    AI F+  VK GPF E+SPML DI   V +W K++ GL +MY  EVLN
Sbjct: 241 PGRDDAPANFLVEAIGFVKSVKHGPFWENSPMLNDILSGVSSWRKIQRGLFRMYNAEVLN 300

Query: 306 KFPVVQHFWFGTGLFPWIDNNTKKSLPLYENDAKKTTSIHTKSPSPSPLGISTRRDFSKF 365
           KFPVVQHFWFGT  FPW        LP+YE  A            P P            
Sbjct: 301 KFPVVQHFWFGTAFFPWTSVRDGTPLPVYEQSADTEQETFDSGAPPGP---------GTT 351

Query: 366 TSPALNRNPICRNPNHLGIGANPLRKSNMGPPSTNSVNSIFTRNSPS 412
           T PAL+ + +   P+         R+  MGPP+   VN      + S
Sbjct: 352 TLPALDTSTMASVPS---------RRPAMGPPAGRQVNKFIQHTTAS 389

>Suva_16.158 Chr16 (274228..275304) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  169 bits (429), Expect = 2e-48,   Method: Compositional matrix adjust.
 Identities = 110/310 (35%), Positives = 170/310 (54%), Gaps = 21/310 (6%)

Query: 17  LPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIPTVNKLVKLIS 76
           LP KR+  ++   L++ S        F+   I L  +V+  + S   E P   ++ +++S
Sbjct: 2   LPEKRLLTAEDMKLWEKSQTRADFTKFV---IDLAKSVEGHENSQYKE-PVSEQITRMLS 57

Query: 77  ELSLLVDETPPAP-----GPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKD 131
            LS + D     P        RFG +  R+++ +V  N + LL       K   S    +
Sbjct: 58  LLSRVRDIIEKHPVVHDVDSSRFGKVEFRDFYDEVSQNSRKLL-------KSEFSLLTDE 110

Query: 132 SVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLI-IFNEYY 190
            + +LS YL  S+G+  R+DYG+GHEL+F+ ++ G+   G++  +    +L++ +F EY 
Sbjct: 111 QLEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYNYGVFNLSNDSTNLILKVFIEYL 170

Query: 191 KLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLVCEY 250
            +M+ L   Y LEPAGSHGVWGLDD+    ++ G+ Q   T +  LKP+ I N +LV  +
Sbjct: 171 DIMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQL--TTHKHLKPISIHNSELVEMF 228

Query: 251 ANTNMYCSAIKFIDCVKS-GPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPV 309
           ++  +Y   I FI+ VKS      HSPML DIS  V  WSKV  G++KMY  EVL+K P+
Sbjct: 229 SDRYLYFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPI 287

Query: 310 VQHFWFGTGL 319
           +QHF+F   L
Sbjct: 288 MQHFYFSEFL 297

>NCAS0C01690 Chr3 complement(311102..312181) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  169 bits (429), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 112/309 (36%), Positives = 171/309 (55%), Gaps = 19/309 (6%)

Query: 17  LPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSE--IPTVNKLVKL 74
           +P KRI       ++++S     L  FIS    L  +V+  + S + E   P++  L  L
Sbjct: 2   VPEKRILTENDMEVWKNSATRKDLLNFIST---LAESVEGHENSQIVEPISPSIASLSSL 58

Query: 75  ISELSLLVDETPPAPGPR--RFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDS 132
           + E++ LVD+ P     +  RFG +  R+++ +++    SL+       K   S+   + 
Sbjct: 59  LDEVNKLVDKHPVIKEAKVSRFGKVEFRDFYDELNEKSSSLI-------KTRFSTLSDEQ 111

Query: 133 VVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDL-LIIFNEYYK 191
           + +LS YL  S+G+  R+DYG+GHEL+FI  + G+   GL+       +L L++F +Y  
Sbjct: 112 LEQLSIYLDESWGNKRRIDYGSGHELNFICFLFGLYSYGLFDLEKDAINLVLVVFLKYLN 171

Query: 192 LMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLVCEYA 251
           +M+ L   Y LEPAGSHGVWGLDD+    ++ G+ Q     +  LKPM I N++LV  + 
Sbjct: 172 IMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQL--VPHKHLKPMSIHNEELVELFK 229

Query: 252 NTNMYCSAIKFIDCVKSG-PFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVV 310
           +  +Y   I FI+ VK+      HSPML DIS  V  WSKV  G++KMY  EVL K P++
Sbjct: 230 DKFLYFGCISFINSVKTTTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYTAEVLGKLPIM 288

Query: 311 QHFWFGTGL 319
           QHF+F   L
Sbjct: 289 QHFYFSEFL 297

>Skud_16.130 Chr16 (236660..237736) [1077 bp, 358 aa] {ON} YPL152W
           (REAL)
          Length = 358

 Score =  169 bits (427), Expect = 5e-48,   Method: Compositional matrix adjust.
 Identities = 112/309 (36%), Positives = 173/309 (55%), Gaps = 27/309 (8%)

Query: 17  LPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIPTVNKLVKLIS 76
           LP KR+  +    L++ S        FI   I+L  +V    E+Y  + P   +++ +++
Sbjct: 2   LPEKRLLTAGDMKLWEESQTRADFTKFI---IELAESVK-GHENYQFKEPISEQIISMMN 57

Query: 77  ELSLLVDETPPAP-----GPRRFGNLSCREWHKKVDLNLKSLLMK---MLTDDKQNISSK 128
            LS + D     P        RFG +  R+++ +V  N + LL      LTD++      
Sbjct: 58  LLSQIKDIIQKHPVVQDADSSRFGKVEFRDFYDEVSQNSRKLLRSEFPHLTDEQ------ 111

Query: 129 CKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLI-IFN 187
               + +LS YL  S+G+  R+DYG+GHEL+F+ ++ G+   G++  +    +L++ +F 
Sbjct: 112 ----LEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYNYGIFNLSDDSTNLILKVFI 167

Query: 188 EYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLV 247
           EY ++M+ L   Y LEPAGSHGVWGLDD+    ++ G+ Q   T +  LKP+ I N +LV
Sbjct: 168 EYLQIMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQL--TTHKHLKPISIHNNELV 225

Query: 248 CEYANTNMYCSAIKFIDCVKS-GPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNK 306
             +A+  +Y   I FI+ VKS      HSPML DIS  V  WSKV  G++KMY VEVL+K
Sbjct: 226 EMFAHRYLYFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKVEVLSK 284

Query: 307 FPVVQHFWF 315
            P++QHF+F
Sbjct: 285 LPIMQHFYF 293

>YPL152W Chr16 (265028..266104) [1077 bp, 358 aa] {ON}
           RRD2Activator of the phosphotyrosyl phosphatase activity
           of PP2A,peptidyl-prolyl cis/trans-isomerase; regulates
           G1 phase progression, the osmoresponse, microtubule
           dynamics; subunit of the Tap42p-Pph21p-Rrd2p complex
          Length = 358

 Score =  168 bits (426), Expect = 7e-48,   Method: Compositional matrix adjust.
 Identities = 109/309 (35%), Positives = 169/309 (54%), Gaps = 19/309 (6%)

Query: 17  LPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSE--IPTVNKLVKL 74
           LP KR+       L++ S        FI   I L  +V   + S   E    ++N ++ L
Sbjct: 2   LPEKRLLTPDDMKLWEESPTRAHFTKFI---IDLAESVKGHENSQYKEPISESINSMMNL 58

Query: 75  ISELSLLVDETP--PAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDS 132
           +S++  +  + P        RFG +  R+++ +V  N + +L       +    S   + 
Sbjct: 59  LSQIKDITQKHPVIKDADSSRFGKVEFRDFYDEVSRNSRKIL-------RSEFPSLTDEQ 111

Query: 133 VVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLI-IFNEYYK 191
           + +LS YL  S+G+  R+DYG+GHEL+F+ ++ G+   G++  +    +L++ +F EY K
Sbjct: 112 LEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYSYGIFNLSNDSTNLVLKVFIEYLK 171

Query: 192 LMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLVCEYA 251
           +M+ L   Y LEPAGSHGVWGLDD+    ++ G+ Q   T +  LKP+ I N +LV  +A
Sbjct: 172 IMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQL--TTHKHLKPISIHNNELVEMFA 229

Query: 252 NTNMYCSAIKFIDCVKS-GPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVV 310
           +  +Y   I FI+ VKS      HSPML DIS  V  WSKV  G++KMY  EVL+K P++
Sbjct: 230 HRYLYFGCIAFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYKAEVLSKLPIM 288

Query: 311 QHFWFGTGL 319
           QHF+F   L
Sbjct: 289 QHFYFSEFL 297

>ACR139C Chr3 complement(592864..593943) [1080 bp, 359 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YPL152W
           (RRD2)
          Length = 359

 Score =  168 bits (426), Expect = 8e-48,   Method: Compositional matrix adjust.
 Identities = 95/256 (37%), Positives = 147/256 (57%), Gaps = 19/256 (7%)

Query: 66  PTVNKLVKLISELSLLVDETP--PAPGPRRFGNLSCREWHKKVDLNLKSLLMKM---LTD 120
           P +  L  L+ E+  +    P        RFG +  R++HK+V    ++L++++   LTD
Sbjct: 58  PAIEALEALLEEMQGIAAHHPVLQDAATSRFGKVEFRDFHKEVQARAEALVLQVDPSLTD 117

Query: 121 DKQNISSKCKDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGG 180
           ++            EL+ YLGN++G   R+DYG+GHEL+F+  + G+   G+ +E+    
Sbjct: 118 EQAQ----------ELAVYLGNAWGDCKRIDYGSGHELNFVCFLYGLWKYGVLSEHDFTN 167

Query: 181 DLLIIFNEYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMD 240
            +L +F +Y  +M+ L   Y LEPAGSHGVWGLDD+    ++ G+ Q +   +  LKP  
Sbjct: 168 AVLRVFVKYMDVMRVLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLATHKH--LKPKS 225

Query: 241 IVNKDLVCEYANTNMYCSAIKFIDCVK-SGPFSEHSPMLYDISQSVHNWSKVESGLLKMY 299
           I N ++V  + N  +Y   I FI+ VK +     HSPML DIS  V +W+KV  G++KMY
Sbjct: 226 IHNPEVVELFENRYLYFGCIAFINRVKTTASLRWHSPMLDDIS-GVRSWTKVSEGMVKMY 284

Query: 300 MVEVLNKFPVVQHFWF 315
             EVL K P++QHF+F
Sbjct: 285 KAEVLGKLPIMQHFFF 300

>Kpol_1013.4 s1013 complement(5948..7024) [1077 bp, 358 aa] {ON}
           complement(5948..7024) [1077 nt, 359 aa]
          Length = 358

 Score =  168 bits (425), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 106/308 (34%), Positives = 172/308 (55%), Gaps = 17/308 (5%)

Query: 17  LPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEI-PTVNKLVKLI 75
           +P KR+   +   L+  S     L  FI K  K V   +  ++ Y   I P +   + L+
Sbjct: 2   IPEKRLLTPEDLELWDKSQTKHDLLEFIEKLAKSVEGHE--NKQYQEPITPQIESFMGLL 59

Query: 76  SELSLLVDETPPAPGPR--RFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDSV 133
             ++ ++D+ P     +  RFG +  R+++ ++    K+L+            S  +D +
Sbjct: 60  KSVNNIIDKHPVVQDAKSSRFGKIEFRDFYDELTSQSKTLI-------SNAYPSLTEDQL 112

Query: 134 VELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLI-IFNEYYKL 192
            +L  YL  S+G+  R+DYG+GHEL+F+ ++ G+    ++ E+    ++++ IF EY ++
Sbjct: 113 DQLYVYLDESWGNKQRIDYGSGHELNFLCLLYGLHKYKIFDESKDFTNMVLKIFIEYLRV 172

Query: 193 MKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLVCEYAN 252
           M+ L   Y LEPAGSHGVWGLDD+    ++ G+ Q +   +  LKP+ I N++LV  + +
Sbjct: 173 MRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLA--THKHLKPLSIHNEELVEMFQD 230

Query: 253 TNMYCSAIKFIDCVK-SGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVVQ 311
             +Y S + FI+ VK S     HSPML DIS  V  WSKV  G++KMY  EVL+K P++Q
Sbjct: 231 KYLYFSCVAFINSVKTSTSLRFHSPMLDDIS-GVKKWSKVAEGMIKMYRAEVLSKLPIMQ 289

Query: 312 HFWFGTGL 319
           HF+FG  L
Sbjct: 290 HFYFGEFL 297

>Smik_6.349 Chr6 complement(558150..559226) [1077 bp, 358 aa] {ON}
           YPL152W (REAL)
          Length = 358

 Score =  168 bits (425), Expect = 1e-47,   Method: Compositional matrix adjust.
 Identities = 109/309 (35%), Positives = 171/309 (55%), Gaps = 19/309 (6%)

Query: 17  LPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIPT--VNKLVKL 74
           LP KR+  S    L++ S        FI   I L  +V   + S   E  +  +++++ L
Sbjct: 2   LPEKRLLTSGDMKLWEESQTRANFTKFI---IDLAESVKGHENSQYEEPVSEPISRMMNL 58

Query: 75  ISELSLLVDETPPA--PGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDS 132
           +S +  ++ + P        RFG +  R+++ +V  + +  L       +    S   + 
Sbjct: 59  LSYIRDIIQKHPVVKDANSSRFGKIEFRDFYDEVSQSSRKFL-------RSEFPSLTDEQ 111

Query: 133 VVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLI-IFNEYYK 191
           + +LS YL  S+G+  R+DYG+GHEL+F+ ++ G+   G++  +    +L++ +F EY K
Sbjct: 112 LEQLSIYLDESWGNKRRIDYGSGHELNFMCLLYGLYKYGVFNLSNDSTNLILKVFIEYLK 171

Query: 192 LMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLVCEYA 251
           +M+ L   Y LEPAGSHGVWGLDD+    ++ G+ Q   T++  LKP+ I N +LV  +A
Sbjct: 172 IMRILETRYWLEPAGSHGVWGLDDYHFLPFLFGAFQL--TSHKHLKPISIHNNELVEMFA 229

Query: 252 NTNMYCSAIKFIDCVKS-GPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVV 310
           N  +Y   I FI+ VKS      HSPML DIS  V  WSKV  G++KMY  EVL+K P++
Sbjct: 230 NRYLYFGCIDFINKVKSSASLRWHSPMLDDIS-GVKTWSKVAEGMIKMYEAEVLSKLPIM 288

Query: 311 QHFWFGTGL 319
           QHF+F   L
Sbjct: 289 QHFYFSDFL 297

>NDAI0E02410 Chr5 complement(500623..501702) [1080 bp, 359 aa] {ON}
           Anc_8.674
          Length = 359

 Score =  165 bits (418), Expect = 9e-47,   Method: Compositional matrix adjust.
 Identities = 107/309 (34%), Positives = 168/309 (54%), Gaps = 19/309 (6%)

Query: 17  LPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSE--IPTVNKLVKL 74
           LP KR+       L+++S     L  FIS   + V   +    S +SE   P +N L ++
Sbjct: 2   LPEKRLLTEDDMKLWEASSTKKELLDFISTLAEAVKGCE---NSQISEPISPAINTLEQI 58

Query: 75  ISELSLLVDETPPAPGPR--RFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDS 132
           +  +  ++D+ P        RFG    R ++ +++   + L+        +N  S   + 
Sbjct: 59  LVSIDKIIDKHPVLEDKEISRFGKKEFRGFYDEINEVSEKLI-------HENFPSLTHEQ 111

Query: 133 VVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDL-LIIFNEYYK 191
           + +L+ YL  S+G+  R+DYG+GHEL+F+  + G+    +   +I   ++ LIIF +Y  
Sbjct: 112 LEQLTIYLDESWGNKQRIDYGSGHELNFMCFLFGLYKYDVLKLDIDARNMVLIIFIKYLD 171

Query: 192 LMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLVCEYA 251
           +M+ L   Y LEPAGSHGVWGLDD+    ++ G+ Q +   +  LKP+ I N++LV  +A
Sbjct: 172 IMRSLETKYWLEPAGSHGVWGLDDYHFLPFLFGAYQLA--THKHLKPLSIHNEELVEMFA 229

Query: 252 NTNMYCSAIKFIDCVKS-GPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVV 310
              +Y   I FI+ VK+      HSPML DIS  V  WSKV  G++KMY  EVL+K P++
Sbjct: 230 KKYLYFGCIAFINSVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYNAEVLSKLPIM 288

Query: 311 QHFWFGTGL 319
           QHF+F   L
Sbjct: 289 QHFYFSEFL 297

>Kwal_26.8783 s26 complement(941317..942384) [1068 bp, 355 aa] {ON}
           YPL152W (RRD2) - similar to hosphotyrosyl phosphatase
           activator (PTPA) from several organisms [contig 67] FULL
          Length = 355

 Score =  164 bits (415), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 107/307 (34%), Positives = 162/307 (52%), Gaps = 17/307 (5%)

Query: 18  PVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEI-PTVNKLVKLIS 76
           P KR+  SQ    +       +L  FIS+  + V  ++  +  Y   I  +++K   L+ 
Sbjct: 3   PQKRLLTSQDIETWVDCATFDQLIEFISELAESVKGLE--NNQYQEPIGASIDKCCSLLD 60

Query: 77  ELSLLVDETPPAPGPR--RFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDSVV 134
           E+  +  + P        RFG +  R ++  + +  + L+ K      Q       D   
Sbjct: 61  EVFSIAKQHPVKEDAETSRFGKIEFRHFYDDLRIKAQDLISKEFDQLSQ-------DQAE 113

Query: 135 ELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLI-IFNEYYKLM 193
           EL  Y   S+G   R+DYG+GHEL+FI  + G+   GL+  +    +L++ +F  Y +LM
Sbjct: 114 ELVAYFVESWGDRERIDYGSGHELNFICFLYGLKDCGLFERSRDYRNLVLKVFIHYLELM 173

Query: 194 KKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLVCEYANT 253
           + L  TY LEPAGSHGVWGLDD+    ++ G++Q +   +  LKP  I N +LV  +A+ 
Sbjct: 174 RVLETTYWLEPAGSHGVWGLDDYHFLPFLFGASQLAPHKH--LKPKSIHNNELVDMFASR 231

Query: 254 NMYCSAIKFIDCVKS-GPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVVQH 312
            +Y   I FI+ VK+      HSPML DIS    +WSKV  G++KMY  EVL K P++QH
Sbjct: 232 YLYFGCIDFINRVKTTASLRWHSPMLDDIS-GAKSWSKVAEGMIKMYRKEVLAKLPIMQH 290

Query: 313 FWFGTGL 319
           F FG+ L
Sbjct: 291 FLFGSFL 297

>ZYRO0F07326g Chr6 complement(592906..593964) [1059 bp, 352 aa] {ON}
           highly similar to uniprot|Q12461 Saccharomyces
           cerevisiae YPL152W
          Length = 352

 Score =  164 bits (415), Expect = 2e-46,   Method: Compositional matrix adjust.
 Identities = 94/252 (37%), Positives = 148/252 (58%), Gaps = 14/252 (5%)

Query: 72  VKLISELSLLVDETP--PAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKC 129
           ++L+ +++ L+D+ P        RFG +  R+++  +  + + L+            S  
Sbjct: 56  MQLLKKVNDLIDKYPVIQDANTSRFGKVEFRDFYDDLQTHAEELV-------ATTYPSLN 108

Query: 130 KDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLI-IFNE 188
           KD V EL+ YL  S+G+  R+DYG+GHEL+F+  I G+ +  ++       DL++ +F E
Sbjct: 109 KDQVEELAVYLYESWGNKRRIDYGSGHELNFVCFIYGLYVYKVFDLERDAADLVLKVFVE 168

Query: 189 YYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLVC 248
           Y ++M+ L   Y LEPAGSHGVWGLDD+    ++ G+ Q +   +P L+P  I N+++V 
Sbjct: 169 YLRIMRILETKYWLEPAGSHGVWGLDDYHFLPFLFGAHQLA--THPHLRPKSIHNEEVVE 226

Query: 249 EYANTNMYCSAIKFIDCVKS-GPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKF 307
            + +  +Y   I FI+ VKS      HSPML DIS  V  W+KV  G++KMY  EVL+K 
Sbjct: 227 MFMDKYIYFGCIAFINSVKSTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLSKL 285

Query: 308 PVVQHFWFGTGL 319
           P++QHF+FG  L
Sbjct: 286 PIMQHFYFGNIL 297

>KNAG0J01690 Chr10 complement(308576..309667) [1092 bp, 363 aa] {ON}
           Anc_8.674 YPL152W
          Length = 363

 Score =  164 bits (416), Expect = 3e-46,   Method: Compositional matrix adjust.
 Identities = 108/309 (34%), Positives = 167/309 (54%), Gaps = 23/309 (7%)

Query: 16  CLPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEI-PTVNKLVKL 74
            +P KR+   +   L++SS     L +FI +    V   +  +E Y   I  +V  L+ L
Sbjct: 4   AMPCKRLLMKRDLDLWESSETRAHLVHFIEQLADAVRGRE--NEQYDLPISASVEALMGL 61

Query: 75  ISELSLLVDETPPAPG---PRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKD 131
           + ++  +++  P A       RFG +  R+++ ++     SL+        QN       
Sbjct: 62  LQQVRGVIERHPVAKKDAPASRFGKVEFRDFYDELRAESASLITGAFPQLTQN------- 114

Query: 132 SVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGD----LLIIFN 187
            V +L  YL  S+G   R+DYG+GHEL+F+  + G+    ++  ++ G D    +L  F 
Sbjct: 115 QVRQLQTYLEESWGDKRRIDYGSGHELNFMCFLYGLTAYKVF--DLGGTDRANLVLKPFI 172

Query: 188 EYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLV 247
           EY K+M+ L   Y LEPAGSHGVWGLDD+    ++ G+ Q S   +  LKP+ I N+++V
Sbjct: 173 EYLKIMRVLETEYWLEPAGSHGVWGLDDYHFLPFLFGAFQLS--THKHLKPLSIHNEEVV 230

Query: 248 CEYANTNMYCSAIKFIDCVKS-GPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNK 306
             +A+  +Y   I FI+ VK+      HSPML DIS  V  WSKV  G++KMY  EVL+K
Sbjct: 231 ELFADKYLYFGCIHFINSVKTTATLRWHSPMLDDIS-GVKKWSKVAEGMVKMYQAEVLSK 289

Query: 307 FPVVQHFWF 315
            P++QHF+F
Sbjct: 290 LPIMQHFYF 298

>KAFR0H02440 Chr8 (467656..468717) [1062 bp, 353 aa] {ON} Anc_8.674
           YPL152W
          Length = 353

 Score =  164 bits (414), Expect = 4e-46,   Method: Compositional matrix adjust.
 Identities = 113/321 (35%), Positives = 169/321 (52%), Gaps = 26/321 (8%)

Query: 18  PVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIPT-VNKLVKLIS 76
           P KR+       ++ SS     L  FI+   + V + D  +  +   I   V+  + L+ 
Sbjct: 5   PQKRLLTKDDMEIWDSSQTKKELINFITDLAEAVKDRD--NTQFKEPISAEVSSTLALLD 62

Query: 77  ELSLLVDETPPA-PGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDSVVE 135
            +  +VDE P       RFG    R +++ V  N  +LL K       N        + +
Sbjct: 63  SVLSVVDEHPVLNDTTSRFGKTEFRSFYQDVKSNCHNLLSKAFDTLTTN-------QIEQ 115

Query: 136 LSYYLGNSFGSSTRLDYGTGHELSFIAVIAGI---DMLGLWTENIKGGDLLIIFNEYYKL 192
           LS Y   S+G+  R+DYG+GHEL+FI  + G+   D+  L  E      ++++F +Y K+
Sbjct: 116 LSIYFYESWGNEERIDYGSGHELNFICFLYGLYKYDVFRL--ERDSTNIVILVFVKYLKI 173

Query: 193 MKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLVCEYAN 252
           M++L   Y LEPAGSHGVWGLDD+    ++ G+ Q S  N+  LKP  I N ++V  + +
Sbjct: 174 MRRLETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQLS--NHKHLKPKSIHNDEIVDMFKD 231

Query: 253 TNMYCSAIKFIDCVKS-GPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVVQ 311
             +Y   I FI+ VK+      HSPML DIS  V  WSKV  G++KMY+ EVL+K PV+Q
Sbjct: 232 KYLYFGCIAFINSVKTTASLRWHSPMLDDIS-GVKKWSKVSEGMIKMYVAEVLSKLPVMQ 290

Query: 312 HFWFG------TGLFPWIDNN 326
           HF+F       TG+ P+ + N
Sbjct: 291 HFYFSEFLACPTGISPYDERN 311

>Ecym_2399 Chr2 (778448..779503) [1056 bp, 351 aa] {ON} similar to
           Ashbya gossypii ACR139C
          Length = 351

 Score =  161 bits (407), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 97/256 (37%), Positives = 143/256 (55%), Gaps = 15/256 (5%)

Query: 68  VNKLVKLISELSLLVDETPPAP--GPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNI 125
           +  L  L+  ++ +VD+ P     G  RFG +  R+++ +V    K L+         ++
Sbjct: 52  IENLCALLDTVAKIVDKHPVVQDKGTSRFGKVEFRDFYDEVRETTKELI--------SSL 103

Query: 126 SSKCKDSVVE-LSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLI 184
           SS+  D  VE L+ Y   S+G   R+DYG+GHEL+FI  + G+    + ++  K   +L 
Sbjct: 104 SSELTDEQVEELAVYFTESWGDRKRIDYGSGHELNFICFLYGLTHYSVLSDADKVNLVLK 163

Query: 185 IFNEYYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNK 244
           +F +Y  +M+ L   Y LEPAGSHGVWGLDD+    ++ G+ Q   T +  LKP  I N 
Sbjct: 164 VFIKYLDVMRLLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQL--TTHKHLKPKSIHNP 221

Query: 245 DLVCEYANTNMYCSAIKFIDCVK-SGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEV 303
           ++V  +    MY   + FI+ VK +     HSPML DIS  V  WSKV  G++KMY  EV
Sbjct: 222 EIVEVFEKRYMYFECVAFINKVKTTASLRWHSPMLDDIS-GVRTWSKVAEGMVKMYKAEV 280

Query: 304 LNKFPVVQHFWFGTGL 319
           L K P++QHF+F T L
Sbjct: 281 LGKLPIMQHFFFSTFL 296

>TPHA0D01240 Chr4 complement(259089..260168) [1080 bp, 359 aa] {ON}
           Anc_8.674 YPL152W
          Length = 359

 Score =  161 bits (407), Expect = 4e-45,   Method: Compositional matrix adjust.
 Identities = 104/303 (34%), Positives = 162/303 (53%), Gaps = 15/303 (4%)

Query: 17  LPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIPTVNKLVKLIS 76
           LP KR+  +    ++  S     L  F+ +  K V   +  D +     P V  ++KL+ 
Sbjct: 2   LPQKRLLTNADMEIWDRSQTQADLLNFLKQLAKSVEGKENTDYTLPISQP-VESMMKLLH 60

Query: 77  ELSLLVDETPPAPGPR--RFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDSVV 134
           ++  ++ + P        RFG +  R+++  +    K+LL       K+   S     + 
Sbjct: 61  KVQSILFKHPVVKDAHSSRFGKVEFRDFYDDLTSQSKTLL-------KECFPSLTDSQIE 113

Query: 135 ELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLI-IFNEYYKLM 193
           +L  Y+  S+G+  R+DYG+GHEL+F+  I G+    ++       +L++ +F +Y KLM
Sbjct: 114 QLYVYVDESWGNKQRIDYGSGHELNFMCFIYGLTSFKIFDLERDATNLVLKVFIQYLKLM 173

Query: 194 KKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLVCEYANT 253
           + L L Y LEPAGSHGVWGLDD+    ++ G+ Q S   +  LKP  I N DL+  +A+ 
Sbjct: 174 RVLELQYWLEPAGSHGVWGLDDYHFLPFLFGAYQLS--THKHLKPSSIHNDDLIEMFADK 231

Query: 254 NMYCSAIKFIDCVKSGP-FSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVVQH 312
            +Y   I+FI+ VK+      HSPML DIS  V  WSKV  G+ KMY  EV+ K P++QH
Sbjct: 232 YLYFGCIEFINSVKTTTTLRWHSPMLDDIS-GVKKWSKVAEGMFKMYEAEVIKKLPIMQH 290

Query: 313 FWF 315
           F+F
Sbjct: 291 FYF 293

>CAGL0M02255g Chr13 (270614..271690) [1077 bp, 358 aa] {ON} highly
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152w RRD2
          Length = 358

 Score =  159 bits (403), Expect = 1e-44,   Method: Compositional matrix adjust.
 Identities = 106/309 (34%), Positives = 162/309 (52%), Gaps = 19/309 (6%)

Query: 17  LPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSE--IPTVNKLVKL 74
           +P KRI   +   +++ S     +  FI    K V   +      VSE    +V   + +
Sbjct: 2   IPSKRILTDKDVKIWEESETREDILSFIESLAKAVEGFE---NDQVSEPVSDSVQSTIAV 58

Query: 75  ISELSLLVDETP--PAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDS 132
           ++E+  L+   P        RFG +  R+++  V      LL         +  +   + 
Sbjct: 59  LTEIDKLIKLHPVIQDKNTSRFGKVEFRDFYDDVCEKADDLL-------SSHFPALTSEQ 111

Query: 133 VVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDL-LIIFNEYYK 191
           + +LS YL  S+G+  R+DYG+GHEL+FI  + G+    ++       +L L++F EY K
Sbjct: 112 IEQLSIYLQESWGNKRRIDYGSGHELNFICFLYGLTHYKIFDLQRDARNLVLVLFIEYLK 171

Query: 192 LMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLVCEYA 251
           +M+++   Y LEPAGSHGVWGLDD+    ++ G+ Q +   +  LKP  I N++LV  +A
Sbjct: 172 IMREIETLYWLEPAGSHGVWGLDDYHFLPFLFGAFQLAPHKH--LKPKSIHNEELVEMFA 229

Query: 252 NTNMYCSAIKFIDCVK-SGPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVV 310
           +  +Y   I FI+ VK S     HSPML DIS  V  WSKV  G++KMY  EVL K P++
Sbjct: 230 DKYLYFGCIAFINSVKTSTSLRWHSPMLDDIS-GVKKWSKVAEGMIKMYKAEVLGKLPIM 288

Query: 311 QHFWFGTGL 319
           QHF+F   L
Sbjct: 289 QHFYFSEFL 297

>TBLA0C01860 Chr3 complement(437987..439057) [1071 bp, 356 aa] {ON}
           Anc_8.674 YPL152W
          Length = 356

 Score =  157 bits (397), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 100/312 (32%), Positives = 170/312 (54%), Gaps = 23/312 (7%)

Query: 17  LPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIP---TVNKLVK 73
           +P KR+  SQ  +++ +S    + K  +  +I+ + N  +  ++    +P   ++N    
Sbjct: 1   MPEKRLLSSQDLTIWINS----KTKQDLVDFIETLANSIVDYQNSQLSLPLSDSINNAFS 56

Query: 74  LISELSLLVDETPPAPG----PRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKC 129
           L+ ++  +++  P          RFG +  + ++  ++ N + L+       K + +   
Sbjct: 57  LLQDIRDIIERYPVESDIESTKSRFGKVEFKSFYDDINQNSEKLI-------KSHFNGLD 109

Query: 130 KDSVVELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLI-IFNE 188
            + + ELS YL  S+G+  R+DYG+GHEL+FI  + G+    ++       +L++ IF E
Sbjct: 110 PNQIQELSIYLVESWGNRQRIDYGSGHELNFICFLYGLTKYNIFNLLEDSTNLVLKIFME 169

Query: 189 YYKLMKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLVC 248
           Y  +M+ +   Y LEPAGSHGVWGLDD+    ++ G+ Q S+  +  LKP+ I N+++V 
Sbjct: 170 YINIMRIIETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLSKHKH--LKPISIHNEEMVE 227

Query: 249 EYANTNMYCSAIKFIDCVKS-GPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKF 307
            + +  MY   I FI+ +K+      HSPML DIS  V  WSKV  G++KMY  EVL K 
Sbjct: 228 MFKDKYMYFGCIDFINSIKTTATLRWHSPMLDDIS-GVKKWSKVSEGMIKMYSAEVLGKL 286

Query: 308 PVVQHFWFGTGL 319
           P++QHF+F   L
Sbjct: 287 PIMQHFYFSDFL 298

>KLTH0D11176g Chr4 complement(913077..914138) [1062 bp, 353 aa] {ON}
           similar to uniprot|Q12461 Saccharomyces cerevisiae
           YPL152W RRD2 Resistant to Rapamycin
          Length = 353

 Score =  156 bits (395), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 103/306 (33%), Positives = 163/306 (53%), Gaps = 15/306 (4%)

Query: 18  PVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIPTVNKLVKLISE 77
           P KR+       ++  S     L  F+S   + V  ++  +E       ++    +L+ E
Sbjct: 3   PQKRLLTQDDMDIWSHSETFNNLISFLSGLAESVKGLE-NNEYQKPTGSSIESCCQLLEE 61

Query: 78  LSLLVDETPPAPGPR--RFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDSVVE 135
           ++ L ++ P        RFG +  R ++   DL  KS  +     D  +  ++C+    E
Sbjct: 62  VASLAEQYPVKQDAETSRFGKVEFRYFYD--DLKSKSQGLIQRAFDALD-GTQCE----E 114

Query: 136 LSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDLLI-IFNEYYKLMK 194
           LS Y   S+G  +R+DYG+GHEL+F+  + G+   G++ E     ++++ +F +Y  +M+
Sbjct: 115 LSVYFAESWGDRSRIDYGSGHELNFLCFLYGLKEFGVFKEPADYRNMVLKLFIKYLGVMR 174

Query: 195 KLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLVCEYANTN 254
            L   Y LEPAGSHGVWGLDD+    ++ G+ Q S   +  LKP  I N ++V  +    
Sbjct: 175 TLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLS--THKHLKPKSIHNSEVVEMFGKRY 232

Query: 255 MYCSAIKFIDCVKS-GPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVVQHF 313
           +Y   I FI+ VK+      HSPML DIS  V  W+KV  G++KMY  EVLNK P++QHF
Sbjct: 233 LYFGCIDFINKVKTTASLRWHSPMLDDIS-GVKTWAKVAEGMIKMYKAEVLNKLPIMQHF 291

Query: 314 WFGTGL 319
           +FG+ L
Sbjct: 292 FFGSFL 297

>TDEL0A06200 Chr1 complement(1085066..1086133) [1068 bp, 355 aa]
           {ON} Anc_8.674 YPL152W
          Length = 355

 Score =  156 bits (395), Expect = 2e-43,   Method: Compositional matrix adjust.
 Identities = 102/303 (33%), Positives = 158/303 (52%), Gaps = 16/303 (5%)

Query: 17  LPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIP-TVNKLVKLI 75
           LP KR+       L+Q+      L  F+ +    V  ++  +  Y   I  ++  +  LI
Sbjct: 3   LPEKRLLTKDDMQLWQNCQTKSDLLKFLCELADAVKGLE--NSQYSQPIGGSIQSVEALI 60

Query: 76  SELSLLVDETP-PAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDSVV 134
             +   ++  P  + GP RFG    R+ +  +      L+       K+   S   + V 
Sbjct: 61  ECVDQCIENHPVESTGPSRFGKGEFRDLYDDISGRSSVLI-------KEKFGSLTDEQVA 113

Query: 135 ELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWTENIKGGDL-LIIFNEYYKLM 193
           +LS Y   S+G  +R+DYG+GHEL+F+  + G+   G++       +L LI+F +Y K M
Sbjct: 114 QLSVYFNESWGDKSRIDYGSGHELNFLCFLYGLYRCGVFDLAKDNRNLVLIVFMKYLKTM 173

Query: 194 KKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLVCEYANT 253
           + +   Y LEPAGSHGVWGLDD+    ++ G++Q S   +  LKP  I N ++V  ++  
Sbjct: 174 RVIETVYWLEPAGSHGVWGLDDYHFLPFLFGASQLSTHRH--LKPKSIHNPEVVEMFSEK 231

Query: 254 NMYCSAIKFIDCVKS-GPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVVQH 312
            +Y   I FI+ VK+      HSPML DIS  V  W+KV  G++KMY  EVL K P++QH
Sbjct: 232 YLYFGCIDFINSVKTTASLRWHSPMLDDIS-GVKEWAKVYQGMVKMYDAEVLCKLPIMQH 290

Query: 313 FWF 315
           F+F
Sbjct: 291 FYF 293

>SAKL0H06622g Chr8 (583484..584551) [1068 bp, 355 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W
          Length = 355

 Score =  155 bits (392), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 108/307 (35%), Positives = 162/307 (52%), Gaps = 17/307 (5%)

Query: 18  PVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIPT-VNKLVKLIS 76
           P KR+       ++  S     L  FI+K  + V   +  +  YV  I + +++L  L+ 
Sbjct: 3   PQKRLLSQHDMEIWTESNTFNELTGFITKLGESVKGRE--NTQYVEPISSSIDELCSLLD 60

Query: 77  ELSLLVDETP--PAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDSVV 134
           +++ +V   P        RFG +  R+++   DL+ +S  M     DK +        V 
Sbjct: 61  KVNKVVSSHPVIQDANTSRFGKVEFRDFYD--DLSSRSSEMISSLSDKLSTPQ-----VD 113

Query: 135 ELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWT-ENIKGGDLLIIFNEYYKLM 193
           EL+ Y   S+G+ TR+DYG+GHEL+FI  + G++    +  E      +L +F +Y  +M
Sbjct: 114 ELAAYFRKSWGNRTRIDYGSGHELNFICFLYGLNKCNFFDLEKDATNVVLRVFIKYLDVM 173

Query: 194 KKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLVCEYANT 253
           + L   Y LEPAGSHGVWGLDD+    ++ G+ Q +   +  LKP  I NK+ V  +   
Sbjct: 174 RTLETKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLA--THKHLKPKSIHNKEFVEMFEKR 231

Query: 254 NMYCSAIKFIDCVKSG-PFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVVQH 312
            +Y   I FI+ VK+      HSPML DIS  V  WSKV  G++KMY  EVL K P++QH
Sbjct: 232 YLYFGCIGFINSVKTSISLRWHSPMLDDIS-GVKTWSKVAEGMVKMYKAEVLGKLPIMQH 290

Query: 313 FWFGTGL 319
           F+FG  L
Sbjct: 291 FYFGDFL 297

>KLLA0F11187g Chr6 (1031839..1032921) [1083 bp, 360 aa] {ON} similar
           to uniprot|Q12461 Saccharomyces cerevisiae YPL152W RRD2
           Resistant to Rapamycin Deletion 2; similar to
           hosphotyrosyl phosphatase activator (PTPA) from several
           organisms
          Length = 360

 Score =  153 bits (387), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 109/349 (31%), Positives = 178/349 (51%), Gaps = 16/349 (4%)

Query: 17  LPVKRIYDSQGTSLFQSSVAIFRLKYFISKYIKLVPNVDIPDESYVSEIP-TVNKLVKLI 75
           + +KR+ +     L+ +S     +  FI+     V   +  D  Y   I   V ++  L+
Sbjct: 1   MAIKRLINEHDMELWNNSKTFEDVIGFINTLALSVRGRENND--YTQPISDNVQRVSNLL 58

Query: 76  SELSLLV--DETPPAPGPRRFGNLSCREWHKKVDLNLKSLLMKMLTDDKQNISSKCKDSV 133
           S+++ ++   E        RFG +  R+++  +  +   L+ K+    ++  + K  D  
Sbjct: 59  SKVTEIIGKHEVIKDANTSRFGKIEFRDFYDDISEHSNELISKIFEGIEKPDTGKLDD-- 116

Query: 134 VELSYYLGNSFGSSTRLDYGTGHELSFIAVIAGIDMLGLWT-ENIKGGDLLIIFNEYYKL 192
             +  Y  NS+G  +R+DYG+GHEL+FI  +  +    ++  EN     +L++F +Y  +
Sbjct: 117 --ICTYFINSWGDRSRIDYGSGHELNFICFLYCLTESKVFDLENDSSNIVLMLFIKYLGI 174

Query: 193 MKKLILTYTLEPAGSHGVWGLDDHFHFAYILGSAQWSETNNPPLKPMDIVNKDLVCEYAN 252
           M+ L L Y LEPAGSHGVWGLDD+    ++ G+ Q S   +  LKP  I N ++V  + +
Sbjct: 175 MRSLELKYWLEPAGSHGVWGLDDYHFLPFLFGAFQLS--THKHLKPKSIHNPEVVEMFQD 232

Query: 253 TNMYCSAIKFIDCVKS-GPFSEHSPMLYDISQSVHNWSKVESGLLKMYMVEVLNKFPVVQ 311
             +Y   I FI+ VK+      HSPML DIS  V  WSKV  G++KMY  EVL K P++Q
Sbjct: 233 RYLYFGCIAFINKVKTTASLRWHSPMLDDIS-GVKRWSKVAEGMVKMYKAEVLQKLPIMQ 291

Query: 312 HFWFGTGLF--PWIDNNTKKSLPLYENDAKKTTSIHTKSPSPSPLGIST 358
           HF+FG  L     +   + ++   +E+D+  T   H  S      GI+ 
Sbjct: 292 HFYFGYFLKCPEGVSEPSARAQDHHEDDSCCTDGSHGHSTWADCCGIAV 340

>Kwal_14.819 s14 complement(63184..64890) [1707 bp, 568 aa] {ON}
           [contig 245] FULL
          Length = 568

 Score = 32.3 bits (72), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 25/84 (29%), Positives = 41/84 (48%), Gaps = 10/84 (11%)

Query: 10  KEPIEFCLPVKRIYDSQGTSLFQSSVAIFRLKYFIS-------KYIKLVPNVDIPDESYV 62
           ++P +    +KRI  S G SLF+  V +  L++ +S       + + L   V I  E +V
Sbjct: 114 EDPQDALAAIKRIQSSVGCSLFEEIVDLGALEHTLSSGREVDYQGLILTYAVIIVSERFV 173

Query: 63  SEIPTVNKLVKLISELSLLVDETP 86
           +  P V     LI EL+  ++E P
Sbjct: 174 TPAPDV---ADLIDELTFAIEECP 194

>ADL177C Chr4 complement(383367..386084) [2718 bp, 905 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL313C
          Length = 905

 Score = 30.4 bits (67), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 19/65 (29%), Positives = 30/65 (46%), Gaps = 7/65 (10%)

Query: 52  PNVDIPDESYVSEIPTVNKLVKLISELSLLVDETPPAPGPRRFGNLSCREWHKKVDLNLK 111
           P+++I +  + S + T  +LV     L        P  G    G+L C++W  K    +K
Sbjct: 827 PDLEINEGVWNSTVDTCEELVAAYESLG-------PMEGKHGAGDLVCKDWKYKARSTIK 879

Query: 112 SLLMK 116
           SLL K
Sbjct: 880 SLLNK 884

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.318    0.136    0.414 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 49,661,220
Number of extensions: 2379478
Number of successful extensions: 6340
Number of sequences better than 10.0: 55
Number of HSP's gapped: 6479
Number of HSP's successfully gapped: 55
Length of query: 413
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 301
Effective length of database: 40,638,807
Effective search space: 12232280907
Effective search space used: 12232280907
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 67 (30.4 bits)