Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_2001.755.702ON1006100641920.0
TPHA0D046105.702ON11835291577e-10
NCAS0A032005.702ON1788561202e-05
KNAG0C065905.702ON1651581103e-04
TDEL0B021905.702ON1810591094e-04
SAKL0E14916g5.702ON17793021060.001
KLTH0E01056g5.702ON1771314990.005
CAGL0G02497g5.702ON178061930.032
YIL149C (MLP2)5.702ON1679195900.064
Ecym_40185.702ON1769312900.067
Kpol_1043.705.702ON132143900.068
Suva_9.395.702ON168234900.068
NCAS0G002305.702ON173564880.097
TPHA0E002305.702ON128447860.17
NDAI0F002905.702ON1554113860.18
Skud_9.195.702ON168068860.21
Smik_9.205.702ON168280850.22
KNAG0L021405.702ON160826840.28
KLLA0A00594g5.702ON174851820.61
ZYRO0G06600g5.702ON1820308800.91
YKR095W (MLP1)5.702ON1875295791.3
AFR286W5.702ON175884781.6
NDAI0E050405.702ON197349781.8
Smik_11.3585.702ON187860781.8
Kpol_529.78.431ON69045772.1
YMR198W (CIK1)6.289ON59445753.0
TBLA0E017305.702ON182065753.3
Kwal_55.196975.702ON176040753.8
NOTE: 4 genes in the same pillar as Kpol_2001.75 were not hit in these BLAST results
LIST: KAFR0H00210 KAFR0D02220 Suva_11.331 Skud_11.334

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_2001.75
         (1006 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON} (206...  1619   0.0  
TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON} Anc_...    65   7e-10
NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {...    51   2e-05
KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_...    47   3e-04
TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {...    47   4e-04
SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON} sim...    45   0.001
KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {...    43   0.005
CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} simil...    40   0.032
YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}  M...    39   0.064
Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON} ...    39   0.067
Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON} (147...    39   0.068
Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON} ...    39   0.068
NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON...    39   0.097
TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON...    38   0.17 
NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON...    38   0.18 
Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON} ...    38   0.21 
Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON} ...    37   0.22 
KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5...    37   0.28 
KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {O...    36   0.61 
ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa] ...    35   0.91 
YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}  MLP1Myos...    35   1.3  
AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic h...    35   1.6  
NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_...    35   1.8  
Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR09...    35   1.8  
Kpol_529.7 s529 complement(14735..16807) [2073 bp, 690 aa] {ON} ...    34   2.1  
YMR198W Chr13 (659745..661529) [1785 bp, 594 aa] {ON}  CIK1Kines...    33   3.0  
TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {...    33   3.3  
Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {O...    33   3.8  

>Kpol_2001.75 s2001 (206286..209306) [3021 bp, 1006 aa] {ON}
            (206286..209306) [3021 nt, 1007 aa]
          Length = 1006

 Score = 1619 bits (4192), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 869/1006 (86%), Positives = 869/1006 (86%)

Query: 1    MSKNEISFSSISLEKENNSLKREIKRLSDKYNLLENNYKWLNERLVRDQKNYLIDTHDVK 60
            MSKNEISFSSISLEKENNSLKREIKRLSDKYNLLENNYKWLNERLVRDQKNYLIDTHDVK
Sbjct: 1    MSKNEISFSSISLEKENNSLKREIKRLSDKYNLLENNYKWLNERLVRDQKNYLIDTHDVK 60

Query: 61   YSSKNDNKLYNSHNKLLELQKEFLISHNEKLSDRLNENSIEFNDKFNSVVIDNLNNEKNL 120
            YSSKNDNKLYNSHNKLLELQKEFLISHNEKLSDRLNENSIEFNDKFNSVVIDNLNNEKNL
Sbjct: 61   YSSKNDNKLYNSHNKLLELQKEFLISHNEKLSDRLNENSIEFNDKFNSVVIDNLNNEKNL 120

Query: 121  ILFEKKLNLLNERYSIIIKDQKDVIDNDINNSKYLEFKSLNEKIIKQNSNMKSMESKIEK 180
            ILFEKKLNLLNERYSIIIKDQKDVIDNDINNSKYLEFKSLNEKIIKQNSNMKSMESKIEK
Sbjct: 121  ILFEKKLNLLNERYSIIIKDQKDVIDNDINNSKYLEFKSLNEKIIKQNSNMKSMESKIEK 180

Query: 181  LNAIIHNFIDINEFDNENTNKYSXXXXXXXXXXXXXXHEKNSNLKLQEELNSILLELNFK 240
            LNAIIHNFIDINEFDNENTNKYS              HEKNSNLKLQEELNSILLELNFK
Sbjct: 181  LNAIIHNFIDINEFDNENTNKYSLDLNDNKVLKKLLVHEKNSNLKLQEELNSILLELNFK 240

Query: 241  LPSLTSLKEKNHELQSVFENIISSNEELLQQFHSNTDKIASMNNKIVDYEQSLKQLLSQR 300
            LPSLTSLKEKNHELQSVFENIISSNEELLQQFHSNTDKIASMNNKIVDYEQSLKQLLSQR
Sbjct: 241  LPSLTSLKEKNHELQSVFENIISSNEELLQQFHSNTDKIASMNNKIVDYEQSLKQLLSQR 300

Query: 301  TXXXXXXXXXXXXXXXXSKYLNLSESEGCLIQNLFNNERIQRFLQEKNLTLTEIFDNLNT 360
            T                SKYLNLSESEGCLIQNLFNNERIQRFLQEKNLTLTEIFDNLNT
Sbjct: 301  TNLISYILNLLNVINLNSKYLNLSESEGCLIQNLFNNERIQRFLQEKNLTLTEIFDNLNT 360

Query: 361  VDITFNNFNRSDIKVLPPTESASXXXXXXXXXXXXXXXXXCDAYKMILYNNGITEDLDEK 420
            VDITFNNFNRSDIKVLPPTESAS                 CDAYKMILYNNGITEDLDEK
Sbjct: 361  VDITFNNFNRSDIKVLPPTESASKEEIINYKNEIILLENNCDAYKMILYNNGITEDLDEK 420

Query: 421  LKIESSSRMTELNEKNSRIQMLESKIDELNSIVTKLNEKNSRFMASINKNNSSESTILEK 480
            LKIESSSRMTELNEKNSRIQMLESKIDELNSIVTKLNEKNSRFMASINKNNSSESTILEK
Sbjct: 421  LKIESSSRMTELNEKNSRIQMLESKIDELNSIVTKLNEKNSRFMASINKNNSSESTILEK 480

Query: 481  YNLLNQSYKTLLEAYKSLKSNATDNKKAVLTSTLDDTKKIVEFKSTINYLNSTIKSLSAK 540
            YNLLNQSYKTLLEAYKSLKSNATDNKKAVLTSTLDDTKKIVEFKSTINYLNSTIKSLSAK
Sbjct: 481  YNLLNQSYKTLLEAYKSLKSNATDNKKAVLTSTLDDTKKIVEFKSTINYLNSTIKSLSAK 540

Query: 541  LVSIQESNDLLADENQKIKMEXXXXXXXXXKINTDKNSISNELSDLHSXXXXXXXXXXXX 600
            LVSIQESNDLLADENQKIKME         KINTDKNSISNELSDLHS            
Sbjct: 541  LVSIQESNDLLADENQKIKMENSNLSSLLNKINTDKNSISNELSDLHSKEILELETEKTK 600

Query: 601  XXXXXXXXXRKLKETNEKHNEQIKWFQNKIDNFNEETTKNQFNNALKNDYENLXXXXXXX 660
                     RKLKETNEKHNEQIKWFQNKIDNFNEETTKNQFNNALKNDYENL       
Sbjct: 601  LLEQLEEGERKLKETNEKHNEQIKWFQNKIDNFNEETTKNQFNNALKNDYENLKKSFEEK 660

Query: 661  XXXXXXANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINNL 720
                  ANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINNL
Sbjct: 661  SKEVEEANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINNL 720

Query: 721  NNALVEAEKKLSEENLKYETERQTGSTLRLKIDDLQXXXXXXXXXXXXXXXXXSTLKDKI 780
            NNALVEAEKKLSEENLKYETERQTGSTLRLKIDDLQ                 STLKDKI
Sbjct: 721  NNALVEAEKKLSEENLKYETERQTGSTLRLKIDDLQLNEDNLKEKVKNLEENESTLKDKI 780

Query: 781  KMIEGNEDDLMGKISVLQSNEIXXXXXXXXXXXXXXXXXELVDVEGLKKDWEKEYSHIIE 840
            KMIEGNEDDLMGKISVLQSNEI                 ELVDVEGLKKDWEKEYSHIIE
Sbjct: 781  KMIEGNEDDLMGKISVLQSNEILLKDKLNDLNSKSSNNSELVDVEGLKKDWEKEYSHIIE 840

Query: 841  KRIEYAEMQLEKRLKSEMEREMDDKMKVVEMKGFESGKASSEKTXXXXXXXXXXXXXQNN 900
            KRIEYAEMQLEKRLKSEMEREMDDKMKVVEMKGFESGKASSEKT             QNN
Sbjct: 841  KRIEYAEMQLEKRLKSEMEREMDDKMKVVEMKGFESGKASSEKTLNLLEHKLSLLEKQNN 900

Query: 901  EKSNKINTLIESENNNKTQKINPFTFSSVEPKISNLVSNDTIIEFSKAPAVSNNEGKETI 960
            EKSNKINTLIESENNNKTQKINPFTFSSVEPKISNLVSNDTIIEFSKAPAVSNNEGKETI
Sbjct: 901  EKSNKINTLIESENNNKTQKINPFTFSSVEPKISNLVSNDTIIEFSKAPAVSNNEGKETI 960

Query: 961  TESNSQIEGESSHQIPTKSVEAIDSQLKRNTDEESNSIDVKKPKLE 1006
            TESNSQIEGESSHQIPTKSVEAIDSQLKRNTDEESNSIDVKKPKLE
Sbjct: 961  TESNSQIEGESSHQIPTKSVEAIDSQLKRNTDEESNSIDVKKPKLE 1006

>TPHA0D04610 Chr4 (1006833..1010384) [3552 bp, 1183 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1183

 Score = 65.1 bits (157), Expect = 7e-10,   Method: Compositional matrix adjust.
 Identities = 136/529 (25%), Positives = 224/529 (42%), Gaps = 106/529 (20%)

Query: 424 ESSSRMTELNEKN-----------SRIQMLESKIDELNSIVTKLN--------------- 457
           E+  RM  L E+N           S  ++LE KI  LNS VT+LN               
Sbjct: 476 EAKQRMIVLKEENVKNKDIINQIISEKKLLEDKIHGLNSTVTELNKSMEIKREPTLKNLE 535

Query: 458 ---------EKNSRFMASINKNNSSESTIL-EKYNLLNQSYKTLLEAYKSLKSN-ATDNK 506
                    EKN++    I+ N S+E+ IL EK++LL +SY  L    K LKS  +T  K
Sbjct: 536 LQKTNQSLLEKNNQLSIEIS-NASNENKILKEKFDLLIKSYTEL----KELKSEISTYTK 590

Query: 507 KAVLTSTLDDTKKI---VEFKSTINYLNSTIKSLSAKLVSIQESNDLLADENQKIKMEXX 563
            +V++   ++T KI   V+ K+    L  + K   +K   ++  N+ + DE +K+  E  
Sbjct: 591 SSVISKDGNETAKISELVDLKAKCKNLEKSFKDRESKFQELEIENNNVKDELKKVLSEYN 650

Query: 564 XXXXXXXKI---NTDKNSISNELSDLHSXXXXXXXXXXXXXXXXXXXXXRKLKETN---- 616
                   I   N +KNSI   +++  +                      KL+E +    
Sbjct: 651 TFKSTRGTIDSFNQNKNSIG--INENTNKQLLKEELNTVKSLNKSLEAKIKLQENDIKIL 708

Query: 617 -EKHNEQIKWFQNKIDNFNEETTKNQFNNAL-----------KNDYENLXXXXXXXXXXX 664
            EK+  QIKW+Q+KID  N  T + + +N             KN+ + L           
Sbjct: 709 IEKYKSQIKWYQDKIDEMNT-TMEVKISNLASSAESAAMLKNKNEIDELKKQIETKSKEL 767

Query: 665 XXANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERT--------------NFKEHI 710
             + D+F+RLK+QA ++LN  K T+ +L ++   LE  +               + +E I
Sbjct: 768 TESLDRFARLKKQAKDKLNEFKGTENKLREDYCDLEKSKNELEQRLLLLESSEKSLQEEI 827

Query: 711 SKLEVDINNLNNALVEAEKKLSEENLKYETERQTGSTLRLKIDDLQXXXXXXXXXXXXXX 770
            K++ ++   NN L   ++  S+E L+ E E+Q     ++K ++L+              
Sbjct: 828 VKMKDELMTSNNELDNNQR--SQEELRNEYEKQ-NKLYKIKEEELESALNQLMLKENQN- 883

Query: 771 XXXSTLKDKIKMIEGNEDDLMGKISVLQSNEIX-----------XXXXXXXXXXXXXXXX 819
              S L      +E   DD+M K+  +   +I                            
Sbjct: 884 ---SALD-----LESLPDDVMLKLKEMVKKDIEIENDIILKAKLKEIEKNSAKDVNTDSI 935

Query: 820 ELVD--VEGLKKDWEKEYSHIIEKRIEYAEMQLEKRLKSEMEREMDDKM 866
           EL D  +  +K+ WEKEY HI++ RIE AE Q   R + E+E+E ++++
Sbjct: 936 ELSDDNISTMKEAWEKEYQHILKIRIEDAENQAMARTRKELEKEYEERL 984

>NCAS0A03200 Chr1 complement(627997..633363) [5367 bp, 1788 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1788

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 27/56 (48%), Positives = 39/56 (69%), Gaps = 3/56 (5%)

Query: 668  NDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINNLNNA 723
            ND+F+R+K+QA+ERLN+SK TQ+ L D +K LEDE  + +   S LE +  N+ N 
Sbjct: 1309 NDRFNRIKKQAHERLNSSKATQQTLIDQIKQLEDENAHIQ---SLLETERGNIQNT 1361

 Score = 39.7 bits (91), Expect = 0.046,   Method: Compositional matrix adjust.
 Identities = 22/61 (36%), Positives = 34/61 (55%), Gaps = 15/61 (24%)

Query: 821  LVDVEGLKKDWEKEYSHIIEKRIEYAEMQLEKRL---------------KSEMEREMDDK 865
            L D+   ++ WEKEY  I+ KRIE AE  L++R+               K+E+E+E D+K
Sbjct: 1492 LQDISAQREQWEKEYEEIVLKRIEQAEENLKRRIRLPTEEKINSVIQKKKNELEKEYDEK 1551

Query: 866  M 866
            +
Sbjct: 1552 V 1552

>KNAG0C06590 Chr3 (1276738..1281693) [4956 bp, 1651 aa] {ON} Anc_5.702
            YIL149C
          Length = 1651

 Score = 47.0 bits (110), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 25/58 (43%), Positives = 38/58 (65%)

Query: 669  DKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINNLNNALVE 726
            D+F RLKRQA ERL+ASK T   L DNV++L  ++T  ++ I + + ++N L   + E
Sbjct: 1197 DRFGRLKRQARERLDASKVTINSLRDNVETLTKDKTALQDVIERSKDELNELRAKIQE 1254

>TDEL0B02190 Chr2 complement(389562..394994) [5433 bp, 1810 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1810

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 25/59 (42%), Positives = 37/59 (62%)

Query: 668  NDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINNLNNALVE 726
            ND+F+RLK+QA+E+LNASK  Q  LS  V  L+  +T  +E + + +  + NL   L E
Sbjct: 1332 NDRFTRLKKQAHEKLNASKIAQANLSAEVNELQGTKTKMEEILKETQTKVLNLEKLLTE 1390

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 18/37 (48%), Positives = 25/37 (67%)

Query: 823  DVEGLKKDWEKEYSHIIEKRIEYAEMQLEKRLKSEME 859
            DV  LKK WE+EY  I ++RI+ AE  L+KR++   E
Sbjct: 1514 DVNSLKKQWEEEYEAISQQRIQEAEENLKKRIRMPTE 1550

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 72/311 (23%), Positives = 139/311 (44%), Gaps = 50/311 (16%)

Query: 21  KREIKRLSDKYNLLENNYKWLNERLVRDQKNYLIDTHDVKYSSKNDNKLYNSHNKLLELQ 80
           K E++ +  +  +L  + +WL E+ V  +   LI     KY  +ND +L  S  ++  L+
Sbjct: 192 KSELEIVKQQVGMLTKSNEWL-EKEVTSKTEQLI-----KYRQENDTELQKSLQEVARLK 245

Query: 81  ---------KEFLISHNE--------------KLSDRLNENSIEFNDKFN--SVVIDNLN 115
                    +EFL+  N+              KLSD LN    EF+ + +    ++D L 
Sbjct: 246 NDYQLEKSSREFLLKKNQEISQDLQNKLYEIKKLSDELNTEKQEFSREMSLKQKLLD-LQ 304

Query: 116 NEKNLILFEKKLNLLNERYSIIIKDQKDVIDNDINNSKYLEFKSLNEKIIKQ--NSNMKS 173
           +E+ L  F+++L L  E+++    D       ++ +++   F     ++ +Q   SN + 
Sbjct: 305 DEQ-LQSFKEELRLTEEKHNSTEAD-------NLQSTQQARFMDDLAQVRQQLEESNHER 356

Query: 174 MESKIEKLNAIIHNFI-DINEFDNENTNKYSXXXXXXXXXXXXXX--HEKNSNLKLQEEL 230
           +     +L A+++  + D  EFD ++T   S                 E++    LQ ++
Sbjct: 357 L-----RLQAVVNEVMGDSEEFDLDSTANVSIPKLYGDIGVLKKQLIKERHQKENLQRQI 411

Query: 231 NSILLELNFKLPSLTSLKEKNHELQSVFENIISSNEELLQQFHSNTDKIASMNNKIVDYE 290
            S ++EL +K+P + SLKE+++ L+    +I    E    +    T ++ S   KI   E
Sbjct: 412 ESFVVELEYKVPVINSLKERSYTLEKELSDIALLLEHTSHEKERKTRELESATGKIKQLE 471

Query: 291 QSLKQLLSQRT 301
            +   L+ QR+
Sbjct: 472 INTHTLIRQRS 482

>SAKL0E14916g Chr5 (1236762..1242101) [5340 bp, 1779 aa] {ON}
           similar to uniprot|Q02455 Saccharomyces cerevisiae
           YKR095W MLP1 Myosin-like protein associated with the
           nuclear envelope connects the nuclear pore complex with
           the nuclear interior involved in the Tel1p pathway that
           controls telomere length involved in the retention of
           unspliced mRNAs in the nucleus
          Length = 1779

 Score = 45.4 bits (106), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 66/302 (21%), Positives = 136/302 (45%), Gaps = 27/302 (8%)

Query: 21  KREIKRLSDKYNLLENNYKWLNERLVRDQKNYLIDTHDVKYSSKNDNKLYNSHNKLLELQ 80
           K E++RL+ + NLL++N +WL + L    + +        Y  + +++L  + ++L  ++
Sbjct: 191 KAEMQRLTQEMNLLKSNNQWLEKELASKSEEF------GSYRQRVNSELQTALSELNSIR 244

Query: 81  KEFLI--SHNEKLSDRLNENSIEFNDKF-------NSVVIDNLNNEKNLILFEKKLNLLN 131
            E  I  S ++ L  R N+ S +  DK        +S  I+     + + L ++ ++LL 
Sbjct: 245 SELEIERSSSQTLKSRANDLSQQLQDKMTELKSLRDSSSIEKQEFTREMTLKQRLIDLLE 304

Query: 132 ERYSIIIKDQKDVIDNDINNSKYL--EFKSLNEKIIKQNSNMKSMESKIEKLNAIIHNFI 189
           ++      + +   +  ++NS ++  E + + E++I+    ++  ESK  KL   +   +
Sbjct: 305 KQIESFKTELESARNKSVSNSDHVDAEREKIIEELIETKKKLEISESKAVKLEETVDELL 364

Query: 190 DIN-EFDNENTNKYSXXXXXXXXXXXXXX---------HEKNSNLKLQEELNSILLELNF 239
             + E    NT+K S                        E+    +LQ ++ + +LEL  
Sbjct: 365 STDGERGAGNTSKVSLDSKNSIVPKLHGDIGLLKKRLIQERRQKEQLQYQVEAFVLELEH 424

Query: 240 KLPSLTSLKEKNHELQSVFENIISSNEELLQQFHSNTDKIASMNNKIVDYEQSLKQLLSQ 299
           K+P L S KE+   L+    ++    E   +       ++ S+ +KI DYE  +  L+ Q
Sbjct: 425 KVPVLNSFKERTEMLEKELSDVALMLEATSKDKEEKEHELTSVKSKIADYETQIHSLVRQ 484

Query: 300 RT 301
           R+
Sbjct: 485 RS 486

 Score = 36.2 bits (82), Expect = 0.56,   Method: Compositional matrix adjust.
 Identities = 23/67 (34%), Positives = 41/67 (61%), Gaps = 1/67 (1%)

Query: 670  KFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINNLNNALVEAEK 729
            +F RLK+QA+E+LNA+KT Q  L+  +  L+  +   +  +   + ++ NL + + + EK
Sbjct: 1342 RFKRLKQQAHEKLNAAKTAQSTLTSQLNDLKATKEKLENDLGSQKEEVKNLESKITDIEK 1401

Query: 730  -KLSEEN 735
             K SE+N
Sbjct: 1402 NKSSEKN 1408

>KLTH0E01056g Chr5 complement(99471..104786) [5316 bp, 1771 aa] {ON}
           similar to uniprot|Q02455 Saccharomyces cerevisiae
           YKR095W MLP1 Myosin-like protein associated with the
           nuclear envelope, connects the nuclear pore complex with
           the nuclear interior; involved in the Tel1p pathway that
           controls telomere length; involved in the retention of
           unspliced mRNAs in the nucleus
          Length = 1771

 Score = 42.7 bits (99), Expect = 0.005,   Method: Compositional matrix adjust.
 Identities = 68/314 (21%), Positives = 135/314 (42%), Gaps = 55/314 (17%)

Query: 21  KREIKRLSDKYNLLENNYKWLNERLVRDQKNYLIDTHDVKYSSKNDNKLYNSHNKLLELQ 80
           K E+ RLS + +L  +N +WL  +L   QKN   +     Y     ++L     KL  L+
Sbjct: 189 KAELHRLSQELSLCRSNSEWLESQL--GQKNAEFNA----YRHTTQSQLAALTQKLETLE 242

Query: 81  KEFLIS---------HNEKLSDRLNENSIEFNDKFNSVVIDNLNNEKNLILFEKKLNLLN 131
           +E   S         HN +++     N +E   +    + DNLN+EK    F ++++L  
Sbjct: 243 QELQASTRTNKSLREHNARIT-----NDLETQLRNVKKLTDNLNSEKQE--FTREMSL-K 294

Query: 132 ERYSIIIKDQKDVIDNDI----------NNSKYLEFKSLNEKIIKQNSNMKSMESKIEKL 181
           ER   +++ Q   + +D+          + S      +L+E++ ++   ++  E K++KL
Sbjct: 295 ERLVDLLEGQVQSLKSDLELRSTAGEGDDGSFSNPLNALSEELAQKTQQLEESEFKVQKL 354

Query: 182 NAIIHNFIDIN----------EFDNENTNKYSXXXXXXXXXXXXXXHEKNSNLKLQEELN 231
              + + +  +          E+    T+ Y               HEK     LQ ++ 
Sbjct: 355 EQTVQDLVSTDKESRLKSSAHEYPASVTDLYGDISLLKRQVI----HEKRQKEHLQNQVE 410

Query: 232 SILLELNFKLPSLTSLKEKNHELQSVFENIISSNEELLQQFHSNTDKIA----SMNNKIV 287
           + ++EL  K+P L+S K++N     + E  ++    +L+    + + +A        +I 
Sbjct: 411 AFVVELESKVPMLSSFKDRN----DMLEEQLAETAYMLESISKDKESVALDLRRTKAQIH 466

Query: 288 DYEQSLKQLLSQRT 301
           D+E  + +L  QR+
Sbjct: 467 DFEIQISELTRQRS 480

 Score = 36.6 bits (83), Expect = 0.44,   Method: Compositional matrix adjust.
 Identities = 26/65 (40%), Positives = 39/65 (60%), Gaps = 4/65 (6%)

Query: 669  DKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINN-LNNAL--V 725
            D+F RLK+QA ERL+A+K  Q  LS  +    + ++N +  + K E D+N  L  +L  V
Sbjct: 1332 DRFQRLKKQARERLDAAKAVQNNLSVELAQAREAQSNMELQLRK-EQDVNKALQESLQRV 1390

Query: 726  EAEKK 730
            E+E K
Sbjct: 1391 ESEAK 1395

 Score = 33.1 bits (74), Expect = 5.0,   Method: Compositional matrix adjust.
 Identities = 21/54 (38%), Positives = 32/54 (59%), Gaps = 3/54 (5%)

Query: 822  VDVEGLKKDWEKEYSHIIEKRIEYAEMQLEKRLKSEMEREMDDKMKVVEMKGFE 875
            VD+E LKK WE++Y     KRIE +   L KR++   E +++   K+VE +  E
Sbjct: 1524 VDIETLKKQWEEDYEQKTIKRIEESNEILRKRIRLPTEEKIN---KIVETRKSE 1574

>CAGL0G02497g Chr7 (223375..228717) [5343 bp, 1780 aa] {ON} similar to
            uniprot|Q02455 Saccharomyces cerevisiae YKR095w MLP1
          Length = 1780

 Score = 40.4 bits (93), Expect = 0.032,   Method: Compositional matrix adjust.
 Identities = 23/61 (37%), Positives = 34/61 (55%), Gaps = 15/61 (24%)

Query: 822  VDVEGLKKDWEKEYSHIIEKRIEYAEMQLEKRL---------------KSEMEREMDDKM 866
            VDVE L+K WE++   +I+KRI  AE  L+KR+               +SE+E E D K+
Sbjct: 1528 VDVEALRKQWEEDSEELIQKRIAEAEDNLKKRIRLPSEEKINKIIEKRRSELESEFDQKI 1587

Query: 867  K 867
            +
Sbjct: 1588 R 1588

 Score = 36.2 bits (82), Expect = 0.57,   Method: Compositional matrix adjust.
 Identities = 17/43 (39%), Positives = 30/43 (69%)

Query: 668  NDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHI 710
            ND+F+RLK+QA+E+LN SK  Q  L + + +L  E+ + ++ +
Sbjct: 1345 NDRFNRLKKQAHEKLNTSKELQSSLQEQISNLISEKDDIRKQL 1387

 Score = 33.5 bits (75), Expect = 4.0,   Method: Compositional matrix adjust.
 Identities = 29/90 (32%), Positives = 46/90 (51%), Gaps = 12/90 (13%)

Query: 218 HEKNSNLKLQEELNSILLELNFKLPSLTSLKEKNHELQSVFENIISSNEELLQQFHSN-- 275
            EK    KLQ ++ S ++EL  K+P + S +E+     SV E  ++    LL+  H+   
Sbjct: 404 QEKRQKEKLQNQVESFVIELEHKIPVINSFQERT----SVLEKELTDTALLLE--HATKE 457

Query: 276 ----TDKIASMNNKIVDYEQSLKQLLSQRT 301
               T+++ S+  KI D    L+ LL QRT
Sbjct: 458 NELKTNELQSLKKKISDDNSQLEILLRQRT 487

>YIL149C Chr9 complement(63028..68067) [5040 bp, 1679 aa] {ON}
            MLP2Myosin-like protein associated with the nuclear
            envelope, connects the nuclear pore complex with the
            nuclear interior; involved in the Tel1p pathway that
            controls telomere length
          Length = 1679

 Score = 39.3 bits (90), Expect = 0.064,   Method: Compositional matrix adjust.
 Identities = 53/195 (27%), Positives = 92/195 (47%), Gaps = 28/195 (14%)

Query: 670  KFSRLKRQANERLNASKTTQKELS---DNVKSLEDERTNFKEHISKLEVDINNLNNALVE 726
            KF+RLK+QA+E+L+ASK  Q  L+   + +K+++D          KLE D++  N  +++
Sbjct: 1285 KFNRLKKQAHEKLDASKKQQAALTNELNELKAIKD----------KLEQDLHFENAKVID 1334

Query: 727  AEKKLSEENLKYET-----ERQTGSTLRLKIDDLQXXXXXXXXXXXXXXXXXSTLKDKIK 781
             + KL    L+ E      E+ T  TL  +I+ L+                 S   +K+K
Sbjct: 1335 LDTKLKAHELQSEDVSRDHEKDTYRTLMEEIESLK-----KELQIFKTANSSSDAFEKLK 1389

Query: 782  M-IEGNEDDLMGKISVLQSNEIXXXXXXXXXXXXXXXXXELVDVEGLKKDWEKEYSHIIE 840
            + +E  +D ++ +    ++ E                     D+E LKK+W KEY     
Sbjct: 1390 VNMEKEKDRIIDE----RTKEFEKKLQETLNKSTSSEAEYSKDIETLKKEWLKEYEDETL 1445

Query: 841  KRIEYAEMQLEKRLK 855
            +RI+ AE  L+KR++
Sbjct: 1446 RRIKEAEENLKKRIR 1460

>Ecym_4018 Chr4 complement(42777..48086) [5310 bp, 1769 aa] {ON}
           similar to Ashbya gossypii AFR286W
          Length = 1769

 Score = 39.3 bits (90), Expect = 0.067,   Method: Compositional matrix adjust.
 Identities = 71/312 (22%), Positives = 142/312 (45%), Gaps = 44/312 (14%)

Query: 21  KREIKRLSDKYNLLENNYKWLNERLVRDQKNYLIDTHDVKYSSKNDNKLYNSHNKL--LE 78
           K EI+RL  + NL+++N  WL++ L  + KN  +++    +  K +++L N + ++  L+
Sbjct: 188 KSEIQRLHQELNLVKSNADWLSKEL--ESKNEQLNS----FREKTNSELQNGYEQVNSLK 241

Query: 79  LQKEFLISHNEKLSDRLNENSIEFNDKFNSV--VIDNLNNEKNLILFEKKLNLLNERYSI 136
            Q EF  ++N  L  +  E S +  +K      + D LN EK    F ++++L  +R   
Sbjct: 242 SQLEFARANNSTLKAKTAELSNQLQEKLVETKKLADVLNTEKEE--FTREMSL-KQRLID 298

Query: 137 IIKDQKDVIDNDINNSKYLEFKSLNE-------------KIIKQNSNMKSMESKIEKLNA 183
           +++ Q   + +D+ N+    ++S N+             ++I    N+++ +++  KL A
Sbjct: 299 LLESQVSSMKSDLENA----YQSANQNGMSTPEKDQLLDELIDTKKNLEATQAENIKLEA 354

Query: 184 IIHNFIDIN-----EFDNENTNKYSXXXXXXXXXX---------XXXXHEKNSNLKLQEE 229
            ++  + +N        N N +  S                        E+    +LQ +
Sbjct: 355 TVNELLSVNGKNGVAVINSNVSDTSLDSKISTVPKLCGDIGILKKQLVQERRQKEELQNQ 414

Query: 230 LNSILLELNFKLPSLTSLKEKNHELQSVFENIISSNEELLQQFHSNTDKIASMNNKIVDY 289
           + S ++EL  K+P L S KE+   L+    ++    E   +Q    T ++    NKI +Y
Sbjct: 415 VESFVVELEHKIPILNSFKERTDMLERELNDVTLLLESTAKQRDQKTIELNQYKNKINNY 474

Query: 290 EQSLKQLLSQRT 301
           E  +  L+ QR+
Sbjct: 475 ESQVCSLIVQRS 486

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 49/158 (31%), Positives = 65/158 (41%), Gaps = 38/158 (24%)

Query: 494 AYKSLKSNATDNKKAVLTSTLDDTKKI-VEFK---STINYLNSTIKSLSAKLVSIQESND 549
           A KS  SN T +K A+LTS  D  +KI  E K     +   N+T K L ++L ++Q   D
Sbjct: 741 ATKSQLSNLT-SKLAILTSERDFLRKIEAELKNENEALTKENTTSKILVSQLQTLQRERD 799

Query: 550 LLADENQKIKMEXXXXXXXXXKINTDKNSISNELSDLHSXXXXXXXXXXXXXXXXXXXXX 609
           +L +E Q                N  KN I    SDLH                      
Sbjct: 800 ILLEEAQ---------------TNYRKN-IEKLESDLH------------ETREHLVRRT 831

Query: 610 RKLKETNEKHNEQIKWFQNKIDNFNEETTKNQFNNALK 647
           R+ +E       Q KWFQ K+D+ NE     Q +NA K
Sbjct: 832 REYEEQRVSDTSQYKWFQAKVDSLNE-----QLDNARK 864

>Kpol_1043.70 s1043 (147247..151212) [3966 bp, 1321 aa] {ON}
           (147247..151212) [3966 nt, 1322 aa]
          Length = 1321

 Score = 39.3 bits (90), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 30/43 (69%)

Query: 669 DKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHIS 711
           D+F+RLK+QANERL+ASK  Q  L++    L+   T+ + ++S
Sbjct: 937 DRFNRLKKQANERLHASKVAQNNLTEQSNELKARNTDLERNLS 979

>Suva_9.39 Chr9 complement(57700..62748) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score = 39.3 bits (90), Expect = 0.068,   Method: Compositional matrix adjust.
 Identities = 19/34 (55%), Positives = 27/34 (79%)

Query: 668  NDKFSRLKRQANERLNASKTTQKELSDNVKSLED 701
            NDKF+RLK+QA+E+L+ASK  Q  L++ V  L+D
Sbjct: 1285 NDKFNRLKKQAHEKLDASKKQQTALTNEVDELKD 1318

 Score = 39.3 bits (90), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 61/282 (21%), Positives = 127/282 (45%), Gaps = 19/282 (6%)

Query: 33  LLENNYKWLNERL-VRDQKNYLIDTHDVKYSSKNDNKLYNSHNKL--LELQKEFLISHNE 89
           L+  N KW+ E+L  RD+K  + D     +    + +L  + N    +    +FL++ N+
Sbjct: 183 LILENKKWMEEQLSFRDEKTLVDDVTRTSHVQNLEEQLNRTQNDYESVSTNNQFLLAQNK 242

Query: 90  KLSDRLNENSIEFNDKFNSVVIDNLNNEKNLIL-------FEKKLNLLNERYSIIIKDQK 142
           +LS  + +  +E  +  ++V I+  +  K + L          +L    + YS+  +++ 
Sbjct: 243 QLSHSMEQKILEIKNLKDTVNIEKADFSKEMTLQKNMNDLLRSQLTSFEKNYSLSAREKD 302

Query: 143 DVIDNDINNSKYLEFKSLNEKIIKQNSNMKSMESKIEKLNAIIHNFIDINE--FDNENTN 200
           +  D+   NS++    ++ +K+I     ++  + + ++L  I+ + I+ +E  FDN +  
Sbjct: 303 N--DDPCKNSQH---ANVVDKLIDTKLQLEKSKDECQRLQNIVADCIEEDEAAFDNTHNV 357

Query: 201 KYSXXXXXXXXXXXXXX--HEKNSNLKLQEELNSILLELNFKLPSLTSLKEKNHELQSVF 258
             S                 E+N   +LQ ++ S + EL  K P L S KE+   L+   
Sbjct: 358 DPSVNKVFSDIKALKRQLIKERNQKFQLQNQMESFIKELERKTPELISFKERTESLEQEL 417

Query: 259 ENIISSNEELLQQFHSNTDKIASMNNKIVDYEQSLKQLLSQR 300
           +N     E +      +  ++ S+  KI + E ++  L+ QR
Sbjct: 418 KNSTDLLETISLAKRKDEKELTSLRQKINNCEANIHSLVKQR 459

>NCAS0G00230 Chr7 complement(33629..38836) [5208 bp, 1735 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1735

 Score = 38.5 bits (88), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 23/64 (35%), Positives = 38/64 (59%), Gaps = 7/64 (10%)

Query: 668  NDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINNLNNALVEA 727
            ND+F+RLK+QA+E+L+A+K     L+  +  L D +       SKLE+D++     + E 
Sbjct: 1279 NDRFNRLKKQAHEKLDAAKAQNASLTAEITDLIDAK-------SKLEIDLDEERKRIQEV 1331

Query: 728  EKKL 731
            E +L
Sbjct: 1332 ESQL 1335

 Score = 33.5 bits (75), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 15/36 (41%), Positives = 25/36 (69%)

Query: 820  ELVDVEGLKKDWEKEYSHIIEKRIEYAEMQLEKRLK 855
            E +D+E +K +WE++   II +RI  AE  L+KR++
Sbjct: 1465 EPIDIEKMKSEWEEKQEEIIMQRIADAEENLKKRIR 1500

>TPHA0E00230 Chr5 complement(28358..32212) [3855 bp, 1284 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1284

 Score = 37.7 bits (86), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 22/47 (46%), Positives = 32/47 (68%), Gaps = 3/47 (6%)

Query: 669  DKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEV 715
            D+F+RLK+QAN RL++SK  Q  L++ + SL   + +  E  SKLEV
Sbjct: 989  DRFNRLKKQANARLHSSKEEQNALNEQISSL---KKDLAEVQSKLEV 1032

>NDAI0F00290 Chr6 complement(60327..64991) [4665 bp, 1554 aa] {ON}
           Anc_5.702 YIL149C
          Length = 1554

 Score = 37.7 bits (86), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 54/113 (47%), Gaps = 3/113 (2%)

Query: 226 LQEELNSILLELNFKLPSLTSLKEKNHELQSVFENIISSNEELLQQFHSNTDKIASMNNK 285
           LQ ++ S L+EL  KLP + S KE+N  L+     I SS EE  ++      ++ ++  K
Sbjct: 384 LQRQVESFLVELEQKLPMIDSFKERNSSLERELLRITSSLEETAKERDIKDRELTNLQKK 443

Query: 286 IVDYEQSLKQLLSQRTXXXXXXXXXXXXXXXXSKYLNLSESEGCLIQNLFNNE 338
           I + EQ   +LL QR+                S +   +E E  L++ + +NE
Sbjct: 444 ISNNEQFNDELLRQRSDLAHQVQYLLLCIDNKSPF---TEKEATLVKKIVSNE 493

 Score = 36.6 bits (83), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 35/51 (68%), Gaps = 1/51 (1%)

Query: 669  DKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINN 719
            D+F RLK+QA+E+L+A+KT Q  L+  +  L + + N ++ + + E++ NN
Sbjct: 1180 DRFDRLKKQAHEKLDAAKTMQINLTTQINELNETKVNLEKSLQQ-EIEKNN 1229

>Skud_9.19 Chr9 complement(40103..45145) [5043 bp, 1680 aa] {ON}
            YIL149C (REAL)
          Length = 1680

 Score = 37.7 bits (86), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 27/68 (39%), Positives = 42/68 (61%), Gaps = 7/68 (10%)

Query: 670  KFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINNLNNALVEAEK 729
            KF+RLK+QA+E+L+ASK  Q  L++ +  L       KE   KLE +++N  + +V+ E 
Sbjct: 1286 KFNRLKKQAHEKLDASKKQQTALTNELNEL-------KETKDKLEENLHNEESKVVDLEL 1338

Query: 730  KLSEENLK 737
            KL E  L+
Sbjct: 1339 KLKEHGLQ 1346

 Score = 34.3 bits (77), Expect = 2.4,   Method: Compositional matrix adjust.
 Identities = 22/59 (37%), Positives = 31/59 (52%), Gaps = 15/59 (25%)

Query: 824  VEGLKKDWEKEYSHIIEKRIEYAEMQLEKRL---------------KSEMEREMDDKMK 867
            +E LKK+W KEY     KRI+ AE  L+KR+               K E+E+E + K+K
Sbjct: 1432 IEALKKEWLKEYEEETVKRIKEAEENLKKRIRLPSEERIQKIISKRKGELEQEFERKLK 1490

>Smik_9.20 Chr9 complement(40653..45701) [5049 bp, 1682 aa] {ON}
            YIL149C (REAL)
          Length = 1682

 Score = 37.4 bits (85), Expect = 0.22,   Method: Compositional matrix adjust.
 Identities = 29/80 (36%), Positives = 45/80 (56%), Gaps = 13/80 (16%)

Query: 670  KFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINNLNNALVEAEK 729
            KF+RLK+QA+E+L+ASK  Q  L++ +K L+  R        KLE D+N+ N   V+ + 
Sbjct: 1286 KFNRLKKQAHEKLDASKKQQTALTNELKELKAVR-------DKLEQDLNSKNFKTVDLDT 1338

Query: 730  KLSEENLKYETERQTGSTLR 749
            +  E  +      Q+G  LR
Sbjct: 1339 EPKEHTV------QSGDLLR 1352

>KNAG0L02140 Chr12 (381286..386112) [4827 bp, 1608 aa] {ON} Anc_5.702
            YIL149C
          Length = 1608

 Score = 37.0 bits (84), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 16/26 (61%), Positives = 22/26 (84%)

Query: 668  NDKFSRLKRQANERLNASKTTQKELS 693
            ND+F+RLK+QA+E+LNASK T   L+
Sbjct: 1173 NDRFTRLKKQAHEKLNASKATSDSLA 1198

>KLLA0A00594g Chr1 complement(53304..58550) [5247 bp, 1748 aa] {ON}
            similar to uniprot|Q02455 Saccharomyces cerevisiae
            YKR095W MLP1 Myosin-like protein associated with the
            nuclear envelope connects the nuclear pore complex with
            the nuclear interior involved in the Tel1p pathway that
            controls telomere length involved in the retention of
            unspliced mRNAs in the nucleus
          Length = 1748

 Score = 36.2 bits (82), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 34/51 (66%), Gaps = 3/51 (5%)

Query: 822  VDVEGLKKDWEKEYSHIIEKRIEYAEMQLEKRLKSEMEREMDDKMKVVEMK 872
            +D++ LK +WEKEY     ++I+ AE  L+KR++   ++++D   K+VE +
Sbjct: 1547 IDIDALKNEWEKEYEKQTLEKIKLAEEALKKRIRLPTQQKID---KIVEAR 1594

 Score = 35.8 bits (81), Expect = 0.69,   Method: Compositional matrix adjust.
 Identities = 24/75 (32%), Positives = 40/75 (53%), Gaps = 7/75 (9%)

Query: 670  KFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINNLNNALVEAEK 729
            KF R++ QA +RLNASK  ++ LS  +  + + +       S++E D+     A  E E+
Sbjct: 1329 KFQRIRLQARDRLNASKEKEQSLSSEINQINEAK-------SQVEADLGKCKTACKELEE 1381

Query: 730  KLSEENLKYETERQT 744
            +L     + ET+ QT
Sbjct: 1382 RLQVVTQEAETKEQT 1396

>ZYRO0G06600g Chr7 complement(521893..527355) [5463 bp, 1820 aa]
           {ON} some similarities with uniprot|Q02455 Saccharomyces
           cerevisiae YKR095W MLP1 Myosin-like protein associated
           with the nuclear envelope, connects the nuclear pore
           complex with the nuclear interior; involved in the Tel1p
           pathway that controls telomere length; involved in the
           retention of unspliced mRNAs in the nucleus
          Length = 1820

 Score = 35.4 bits (80), Expect = 0.91,   Method: Compositional matrix adjust.
 Identities = 72/308 (23%), Positives = 136/308 (44%), Gaps = 42/308 (13%)

Query: 23  EIKRLSDKYNLLENNYKWLNERLVRDQKNYLIDTHDVKYSSKNDNKLYN------SHNKL 76
           EI+ ++ +  +L+ N +WL E  V  +   LI T       KND++L        S    
Sbjct: 198 EIQTITQRLTILQKNSQWLEEE-VTSKTEQLISTR-----RKNDDELDRLTSESLSCKNE 251

Query: 77  LELQK---EFLISHNEKLSDRLNENSIEFNDKFNSVVIDNLNNEKNLILFEKKLNLLNER 133
           L+L+K   + + + NE+L+  L E  +E  D  +S+  +       + + +K ++LL  +
Sbjct: 252 LQLEKSRNQVITTKNEELTKSLQEKLMEMKDLSDSLYREKQEFAHEMSMKQKLIDLLENQ 311

Query: 134 YSIIIKDQKDVIDNDINNSKYL---EFKSLNEKIIKQ----NSNMKSMESKIEKLNAIIH 186
              +  +    +D D  N + L   E  + NEK+I++      N +  E +  +L A++ 
Sbjct: 312 VKSLQGELNASLDKD--NVELLASGERNTENEKLIQELITLKENFEESERERLRLEALVQ 369

Query: 187 NFI--DINEFDNENTNKY------SXXXXXXXXXXXXXXHEKNSNLKLQEELNSILLELN 238
             I  D ++ D  NT+ +                      E++   +LQ ++ S ++EL 
Sbjct: 370 ELIPGDDSQDDINNTSSFISLRNKDSSLRDMGILKKELIKERHQKERLQRQVESFIVELE 429

Query: 239 FKLPSLTSLKEKNHELQSVFENIISSNEELLQQFHSN-----TDKIASMNNKIVDYEQSL 293
           +K+P + S KE+   L+    ++      LL    SN       +  +++ K+ D E S+
Sbjct: 430 YKIPVINSFKERTSMLEKELNDVA-----LLLDHTSNEKEKREREFEALSKKVKDSESSI 484

Query: 294 KQLLSQRT 301
             L  QRT
Sbjct: 485 HTLTRQRT 492

 Score = 35.0 bits (79), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 34/57 (59%)

Query: 668  NDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINNLNNAL 724
            +D+F+RLK+QA+E+LN+SK  Q  LS+ +  L + ++  +      E  ++ L   L
Sbjct: 1345 DDRFNRLKKQAHEKLNSSKIAQTTLSNQLNELREAKSELEGKFEAEERKVHELQERL 1401

>YKR095W Chr11 (619805..625432) [5628 bp, 1875 aa] {ON}
           MLP1Myosin-like protein associated with the nuclear
           envelope, connects the nuclear pore complex with the
           nuclear interior; involved with Tel1p in telomere length
           control; involved with Pml1p and Pml39p in nuclear
           retention of unspliced mRNAs
          Length = 1875

 Score = 35.0 bits (79), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 66/295 (22%), Positives = 131/295 (44%), Gaps = 26/295 (8%)

Query: 21  KREIKRLSDKYNLLENNYKWLNERLVRDQKNYLIDTHDVKYSSKNDNKLYNSHNKLLELQ 80
           + E++R + +  LL++N  WL + L    + YL       Y  K D  + +  N+L  L+
Sbjct: 194 RTELERKTQELTLLQSNNDWLEKELRSKNEQYL------SYRQKTDKVILDIRNELNRLR 247

Query: 81  KEFLI--SHNEKLSDRLNENSIEFNDKFNSV--VIDNLNNEKNLILFEKKLNLLNERYSI 136
            +F +  ++N+ L  + NE S    +K   +  + D+LN+EK     E  L    +R   
Sbjct: 248 NDFQMERTNNDVLKQKNNELSKSLQEKLLEIKGLSDSLNSEKQEFSAEMSLK---QRLVD 304

Query: 137 IIKDQKDVIDNDINNSKYLEFKSL-----------NEKIIKQNSNMKSMESKIEKLNAII 185
           +++ Q + +  ++N+ + L    +           NE ++K+    K   ++ EK    +
Sbjct: 305 LLESQLNAVKEELNSIRELNTAKVIADDSKKQTPENEDLLKELQLTKEKLAQCEKECLRL 364

Query: 186 HNFIDINEFDNENTNKYSXXXXXXXXXXXXXXHEKNSNLKLQEELNSILLELNFKLPSLT 245
            +  D  E D +N N  +               E+ +   LQ ++ + ++EL  K+P + 
Sbjct: 365 SSITD--EADEDNENLSAKSSSDFIFLKKQLIKERRTKEHLQNQIETFIVELEHKVPIIN 422

Query: 246 SLKEKNHELQSVFENIISSNEELLQQFHSNTDKIASMNNKIVDYEQSLKQLLSQR 300
           S KE+   L++   N     E    + ++   ++ + N K+V+ E  L+ L  QR
Sbjct: 423 SFKERTDMLENELNNAALLLEHTSNEKNAKVKELNAKNQKLVECENDLQTLTKQR 477

>AFR286W Chr6 (951485..956761) [5277 bp, 1758 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKR095W (MLP1) and
           YIL149C (MLP2)
          Length = 1758

 Score = 34.7 bits (78), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 23/84 (27%), Positives = 41/84 (48%)

Query: 218 HEKNSNLKLQEELNSILLELNFKLPSLTSLKEKNHELQSVFENIISSNEELLQQFHSNTD 277
            E+    +LQ ++ S ++EL  K+P L S K++  EL+     +    E   ++      
Sbjct: 400 QERRHKEELQLQVESFVVELEHKIPVLNSFKKRIEELEKQLNGVTLLLEATARERDEKVV 459

Query: 278 KIASMNNKIVDYEQSLKQLLSQRT 301
           +I    NK+ DYE  +  L+ QR+
Sbjct: 460 QIKQYKNKVGDYETQVGHLVQQRS 483

 Score = 32.3 bits (72), Expect = 9.2,   Method: Compositional matrix adjust.
 Identities = 15/32 (46%), Positives = 21/32 (65%)

Query: 824  VEGLKKDWEKEYSHIIEKRIEYAEMQLEKRLK 855
            +E LKK WE+EY     +RI  AE  L+KR++
Sbjct: 1532 LEALKKKWEEEYEQQTLQRIREAEEALKKRIR 1563

>NDAI0E05040 Chr5 (1150358..1156279) [5922 bp, 1973 aa] {ON} Anc_5.702
            YIL149C
          Length = 1973

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/49 (40%), Positives = 34/49 (69%), Gaps = 3/49 (6%)

Query: 668  NDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVD 716
             ++F +LK+QA+E+LNASK +Q  L+  +  LE ++   KE +S+LE +
Sbjct: 1341 GNRFEKLKKQAHEKLNASKISQNSLTIQINDLEAKK---KELLSQLETE 1386

>Smik_11.358 Chr11 (609897..615533) [5637 bp, 1878 aa] {ON} YKR095W
            (REAL)
          Length = 1878

 Score = 34.7 bits (78), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 20/60 (33%), Positives = 33/60 (55%)

Query: 667  ANDKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINNLNNALVE 726
            A ++F+RL+RQA ERL  SK +   L++ V  L++ +   ++ +      I  L NA  E
Sbjct: 1321 AEERFNRLRRQAQERLKTSKLSLDTLTEQVNDLKNAKIKLEKSLDDANTKIEELENAKAE 1380

 Score = 33.9 bits (76), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 67/300 (22%), Positives = 135/300 (45%), Gaps = 40/300 (13%)

Query: 21  KREIKRLSDKYNLLENNYKWLNERLVRDQKNYLIDTHDVKYSSKNDNKLYNSHNKLLELQ 80
           + E++R + + N+L++   WL + L    + YL       Y  K D  +    N+L  L+
Sbjct: 194 RAELERKAQELNILQSTNDWLEKELCSKNEQYL------SYRKKTDKIILEIRNELNHLR 247

Query: 81  KEF---------LISHNEKLSDRLNENSIEFNDKFNSVVIDNLNNEKNLILFEKKLNLLN 131
            +F         L   N++LS  L E  +E        + D L++EK    F  ++NL  
Sbjct: 248 SDFQVEKTKNDVLTQKNDELSKSLQEKLLEIKS-----LSDCLSSEKQE--FSTEINL-K 299

Query: 132 ERYSIIIKDQKDVIDNDINNSKYLEF-----KSLNEK--IIKQ----NSNMKSMESKIEK 180
           +R   +++ Q + +  ++++++ LE      K ++EK  ++K+       +   +S+  +
Sbjct: 300 QRLVDLLESQLNAVKEELDSTRGLETSNDSKKHMSEKEDLVKELQLTKEELAQCKSECIR 359

Query: 181 LNAIIHNFIDINEFDNENTNKYSXXXXXXXXXXXXXXHEKNSNLKLQEELNSILLELNFK 240
           L++II       E D E+ +  S               EK +   LQ ++ S +LEL  K
Sbjct: 360 LSSII------GETDEESGSSTSRSSSDFILLKKQLIKEKRAKEHLQNQIESFILELEHK 413

Query: 241 LPSLTSLKEKNHELQSVFENIISSNEELLQQFHSNTDKIASMNNKIVDYEQSLKQLLSQR 300
           +P + S KE+   L++   N     E    + ++   ++++ + K+   E  ++ L+ QR
Sbjct: 414 VPIINSFKERTDTLENELNNAALLLEHTSNEKNAKIRELSAKSEKLKQCENDIQTLIKQR 473

>Kpol_529.7 s529 complement(14735..16807) [2073 bp, 690 aa] {ON}
           complement(14735..16807) [2073 nt, 691 aa]
          Length = 690

 Score = 34.3 bits (77), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%)

Query: 695 NVKSLEDERTNFKEHISKLEVDINNLNNALVEAEKKLSEENLKYE 739
           +++S+EDE  N ++ +  L V +NNL N L + E  L +E  KYE
Sbjct: 165 SIRSIEDELANGQKEMETLNVTVNNLRNQLSDYESLLVQERTKYE 209

>YMR198W Chr13 (659745..661529) [1785 bp, 594 aa] {ON}
           CIK1Kinesin-associated protein required for both
           karyogamy and mitotic spindle organization, interacts
           stably and specifically with Kar3p and may function to
           target this kinesin to a specific cellular role; has
           similarity to Vik1p
          Length = 594

 Score = 33.5 bits (75), Expect = 3.0,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 30/45 (66%)

Query: 688 TQKELSDNVKSLEDERTNFKEHISKLEVDINNLNNALVEAEKKLS 732
           T  EL +N+K+  DE  +F++ I + EV+ +++  A+V  +KKL+
Sbjct: 279 THGELKENIKTCRDEFNDFEKRIGEAEVNFHSMELAVVPLKKKLA 323

>TBLA0E01730 Chr5 complement(417597..423059) [5463 bp, 1820 aa] {ON}
            Anc_5.702 YIL149C
          Length = 1820

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 23/65 (35%), Positives = 38/65 (58%)

Query: 669  DKFSRLKRQANERLNASKTTQKELSDNVKSLEDERTNFKEHISKLEVDINNLNNALVEAE 728
            ++F+ LK+QA+ERLNASK  Q  L+  +  L+   TN +  +S  +    +L N L + E
Sbjct: 1304 ERFNLLKKQAHERLNASKEIQSSLNKQINELKASNTNIELALSSEQKKSMDLQNTLSDNE 1363

Query: 729  KKLSE 733
             K ++
Sbjct: 1364 VKYTQ 1368

>Kwal_55.19697 s55 complement(82938..88220) [5283 bp, 1760 aa] {ON}
            YKR095W (MLP1) - colied-coil protein (putative), similar
            to myosin and TPR [contig 159] FULL
          Length = 1760

 Score = 33.5 bits (75), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 18/40 (45%), Positives = 26/40 (65%), Gaps = 7/40 (17%)

Query: 669  DKFSRLKRQANERLNASKTTQ-------KELSDNVKSLED 701
            D+F RLK+QA ERL+ ++TTQ        E  ++ K+LED
Sbjct: 1328 DRFQRLKKQARERLDNARTTQNTLNAELTEARESQKALED 1367

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.305    0.124    0.319 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 104,439,968
Number of extensions: 5050344
Number of successful extensions: 32850
Number of sequences better than 10.0: 1369
Number of HSP's gapped: 32835
Number of HSP's successfully gapped: 2603
Length of query: 1006
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 886
Effective length of database: 39,721,479
Effective search space: 35193230394
Effective search space used: 35193230394
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 43 (22.0 bits)
S2: 71 (32.0 bits)