Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_2001.745.700ON1113111354630.0
TPHA0D045905.700ON1127114231880.0
NCAS0G002505.700ON1183117931210.0
CAGL0H06567g5.700ON1169115930840.0
ZYRO0G06644g5.700ON1166112630810.0
KNAG0L021105.700ON1200119830570.0
KAFR0D022405.700ON1187116230430.0
TDEL0B022105.700ON1095112230360.0
SAKL0E14872g5.700ON1140114930070.0
Kwal_55.197075.700ON1143114630040.0
KLLA0A00638g5.700ON1155115529030.0
AFR284W5.700ON1103112725690.0
Kpol_1043.685.700ON1042110925550.0
Ecym_40205.700ON1125112025540.0
TPHA0E002505.700ON1068112525090.0
TBLA0E021005.700ON1140114321340.0
NDAI0F003105.700ON125973119980.0
YIL147C (SLN1)5.700ON122071319510.0
Suva_9.415.700ON121971319230.0
Skud_9.215.700ON122171419200.0
Smik_9.225.700ON123071618990.0
TBLA0I016805.700ON121473618660.0
KLTH0E01100g5.700ON117770017760.0
TPHA0C001504.385ON5101311585e-10
YHR206W (SKN7)4.385ON6221581551e-09
Smik_8.2964.385ON6251941532e-09
ADL388W4.385ON4821621522e-09
Skud_8.2734.385ON6231581514e-09
CAGL0F09097g4.385ON6301281504e-09
Suva_15.4124.385ON6171581488e-09
TDEL0D003204.385ON5471441461e-08
KAFR0B069904.385ON5451281452e-08
Kpol_265.24.385ON5491281433e-08
YLR006C (SSK1)5.230ON7122371433e-08
KNAG0M001804.385ON6151281424e-08
SAKL0B12408g4.385ON4651281424e-08
Ecym_74744.385ON4961211414e-08
KLTH0D17182g4.385ON4641741414e-08
NCAS0A064504.385ON6091831416e-08
TDEL0E039805.230ON7301871407e-08
TBLA0A107004.385ON5871271381e-07
NDAI0D034304.385ON5971271381e-07
Ecym_50775.230ON7951641381e-07
Kwal_47.167704.385ON4611281371e-07
KNAG0B051405.230ON6481341353e-07
ZYRO0G00484g4.385ON6471281353e-07
KLLA0A10219g4.385ON4751691343e-07
Suva_10.845.230ON6951721353e-07
KAFR0J007005.230ON6201281335e-07
KLTH0B02684g5.230ON5951441301e-06
Skud_12.725.230ON7021641291e-06
ZYRO0A11154g5.230ON7761891291e-06
NCAS0D029005.230ON7621651291e-06
Kwal_33.152885.230ON5871931272e-06
CAGL0D02882g5.230ON6671491272e-06
Smik_12.685.230ON7122211273e-06
ADR343C5.230ON7491481245e-06
Kpol_1004.45.230ON7141521202e-05
NDAI0I020005.230ON8901691192e-05
TPHA0N008505.230ON6702691183e-05
TBLA0D031705.230ON7651571094e-04
SAKL0G12100g5.230ON738781050.001
KLLA0E09505g5.230ON635741030.002
TBLA0B015507.222ON39486890.060
KLLA0E04533g7.222ON42181880.089
SAKL0F08184g7.222ON41281850.18
NCAS0C037708.34ON1598131860.23
CAGL0K12562g8.34ON168289820.68
NDAI0G031108.34ON1707113810.72
Kwal_26.87518.668ON84857810.77
KLTH0F03674g1.137ON119850810.86
TBLA0G034508.34ON197295791.6
Skud_2.3258.541ON46436753.2
Skud_6.388.34ON1758110763.3
TBLA0E049804.385ON79169753.3
YFL033C (RIM15)8.34ON1770109763.3
ACR218W8.34ON156989753.6
SAKL0B01210g8.34ON1588109754.2
KNAG0D017507.222ON40998735.1
KLTH0G18612g8.34ON152486745.6
ADR293C5.368ON113455737.3
Smik_6.468.34ON1760110737.5
Suva_6.268.34ON1753110738.0
YMR025W (CSI1)2.575ON29538718.2
NDAI0C035605.47ON667185729.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_2001.74
         (1113 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON} (202...  2108   0.0  
TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_...  1232   0.0  
NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON...  1206   0.0  
CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} simil...  1192   0.0  
ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] ...  1191   0.0  
KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5...  1182   0.0  
KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {...  1176   0.0  
TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {...  1174   0.0  
SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} sim...  1162   0.0  
Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {O...  1161   0.0  
KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {O...  1122   0.0  
AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic h...   994   0.0  
Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON} (141...   988   0.0  
Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON} ...   988   0.0  
TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON...   971   0.0  
TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5....   826   0.0  
NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON...   774   0.0  
YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}  S...   756   0.0  
Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON} ...   745   0.0  
Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON} ...   744   0.0  
Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON} ...   736   0.0  
TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5....   723   0.0  
KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa] ...   688   0.0  
TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}...    65   5e-10
YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclea...    64   1e-09
Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W ...    64   2e-09
ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homo...    63   2e-09
Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W ...    63   4e-09
CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} simila...    62   4e-09
Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206...    62   8e-09
TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}...    61   1e-08
KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4...    60   2e-08
Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..1149...    60   3e-08
YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON} ...    60   3e-08
KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON...    59   4e-08
SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} simi...    59   4e-08
Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar t...    59   4e-08
KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa]...    59   4e-08
NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4...    59   6e-08
TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.2...    59   7e-08
TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4...    58   1e-07
NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385     58   1e-07
Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar t...    58   1e-07
Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206...    57   1e-07
KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.2...    57   3e-07
ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON...    57   3e-07
KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} simila...    56   3e-07
Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {O...    57   3e-07
KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5....    56   5e-07
KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some s...    55   1e-06
Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {O...    54   1e-06
ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} simila...    54   1e-06
NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {O...    54   1e-06
Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa]...    54   2e-06
CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {...    54   2e-06
Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {O...    54   3e-06
ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}...    52   5e-06
Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}...    51   2e-05
NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {O...    50   2e-05
TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {...    50   3e-05
TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {O...    47   4e-04
SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weak...    45   0.001
KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly...    44   0.002
TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.2...    39   0.060
KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} simila...    39   0.089
SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} simila...    37   0.18 
NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {...    38   0.23 
CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} si...    36   0.68 
NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {...    36   0.72 
Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {O...    36   0.77 
KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} simil...    36   0.86 
TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8....    35   1.6  
Skud_2.325 Chr2 (586584..587978) [1395 bp, 464 aa] {ON} YBR199W ...    33   3.2  
Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON} ...    34   3.3  
TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4...    33   3.3  
YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}  R...    34   3.3  
ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic h...    33   3.6  
SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] ...    33   4.2  
KNAG0D01750 Chr4 complement(294787..296016) [1230 bp, 409 aa] {O...    33   5.1  
KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} sim...    33   5.6  
ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON...    33   7.3  
Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON} ...    33   7.5  
Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON} ...    33   8.0  
YMR025W Chr13 (323300..324187) [888 bp, 295 aa] {ON}  CSI1Subuni...    32   8.2  
NDAI0C03560 Chr3 complement(816972..818975) [2004 bp, 667 aa] {O...    32   9.5  

>Kpol_2001.74 s2001 (202108..205449) [3342 bp, 1113 aa] {ON}
            (202108..205449) [3342 nt, 1114 aa]
          Length = 1113

 Score = 2108 bits (5463), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1038/1113 (93%), Positives = 1038/1113 (93%)

Query: 1    MRQSWRKAFKPPYRITIRAQLTXXXXXXXXXXXXXXXXTTGVYFTENYKELRSGRLNIAA 60
            MRQSWRKAFKPPYRITIRAQLT                TTGVYFTENYKELRSGRLNIAA
Sbjct: 1    MRQSWRKAFKPPYRITIRAQLTALVSLVAIISLIILAVTTGVYFTENYKELRSGRLNIAA 60

Query: 61   KLKSSQIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDL 120
            KLKSSQIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDL
Sbjct: 61   KLKSSQIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDL 120

Query: 121  FYVARLYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNG 180
            FYVARLYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNG
Sbjct: 121  FYVARLYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNG 180

Query: 181  SIYLMSMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYN 240
            SIYLMSMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYN
Sbjct: 181  SIYLMSMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYN 240

Query: 241  DQGKVDGFHFVFEVENDDFSTLIEYPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGY 300
            DQGKVDGFHFVFEVENDDFSTLIEYPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGY
Sbjct: 241  DQGKVDGFHFVFEVENDDFSTLIEYPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGY 300

Query: 301  SPCSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVR 360
            SPCSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVR
Sbjct: 301  SPCSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVR 360

Query: 361  LQKATELISQGRGLKPXXXXXXXXXXXXXXXWRESVESHVRASLGIFKSLRNNGSNELQS 420
            LQKATELISQGRGLKP               WRESVESHVRASLGIFKSLRNNGSNELQS
Sbjct: 361  LQKATELISQGRGLKPTSNFSNGDSSSTSDNWRESVESHVRASLGIFKSLRNNGSNELQS 420

Query: 421  NDDMNEINERSSKNNSTGDNIKXXXXXXXXXFQRYTTSNLVQARVPVYGRFLQDELSELT 480
            NDDMNEINERSSKNNSTGDNIK         FQRYTTSNLVQARVPVYGRFLQDELSELT
Sbjct: 421  NDDMNEINERSSKNNSTGDNIKSSDNDSSSSFQRYTTSNLVQARVPVYGRFLQDELSELT 480

Query: 481  DTFNAMTNALDQHYTLLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGI 540
            DTFNAMTNALDQHYTLLEDRVRARTKQL             KTVFIANISHELRTPLNGI
Sbjct: 481  DTFNAMTNALDQHYTLLEDRVRARTKQLEAAKIEAEAANEAKTVFIANISHELRTPLNGI 540

Query: 541  LGMTAISMEEDDSDKIKENLKLIFRSGXXXXXXXXXXXXFSKNVLKRTNLEKRDFCITEI 600
            LGMTAISMEEDDSDKIKENLKLIFRSG            FSKNVLKRTNLEKRDFCITEI
Sbjct: 541  LGMTAISMEEDDSDKIKENLKLIFRSGELLLHILTELLTFSKNVLKRTNLEKRDFCITEI 600

Query: 601  ALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVMNLVSNALKFTPIDGK 660
            ALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVMNLVSNALKFTPIDGK
Sbjct: 601  ALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVMNLVSNALKFTPIDGK 660

Query: 661  VDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNGKKTDMVRKKIQELSEKDCIEGDT 720
            VDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNGKKTDMVRKKIQELSEKDCIEGDT
Sbjct: 661  VDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNGKKTDMVRKKIQELSEKDCIEGDT 720

Query: 721  AXXXXXXXXXXKIDKLIEDEEKNSFSDNEDTNNDIEILSMTTSSTRSYDDAALQRQFKKT 780
            A          KIDKLIEDEEKNSFSDNEDTNNDIEILSMTTSSTRSYDDAALQRQFKKT
Sbjct: 721  ASSGSHMSGSSKIDKLIEDEEKNSFSDNEDTNNDIEILSMTTSSTRSYDDAALQRQFKKT 780

Query: 781  PDLDDKEETLGVELSEPKTWVISVEVEDTGPGIEPKLQEAVFEPFVQGDQALSRQYGGTG 840
            PDLDDKEETLGVELSEPKTWVISVEVEDTGPGIEPKLQEAVFEPFVQGDQALSRQYGGTG
Sbjct: 781  PDLDDKEETLGVELSEPKTWVISVEVEDTGPGIEPKLQEAVFEPFVQGDQALSRQYGGTG 840

Query: 841  LGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPLKQTREIHFDDEKFEDEFNAESKKNR 900
            LGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPLKQTREIHFDDEKFEDEFNAESKKNR
Sbjct: 841  LGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPLKQTREIHFDDEKFEDEFNAESKKNR 900

Query: 901  RIKFKIYDSSKSHDSNDEDEEGIKSSRDIDSSNNEHKDENGTSPDNHSKVRLDRPFLQST 960
            RIKFKIYDSSKSHDSNDEDEEGIKSSRDIDSSNNEHKDENGTSPDNHSKVRLDRPFLQST
Sbjct: 901  RIKFKIYDSSKSHDSNDEDEEGIKSSRDIDSSNNEHKDENGTSPDNHSKVRLDRPFLQST 960

Query: 961  GTATSSQKIPTLINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDA 1020
            GTATSSQKIPTLINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDA
Sbjct: 961  GTATSSQKIPTLINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDA 1020

Query: 1021 FDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKEC 1080
            FDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKEC
Sbjct: 1021 FDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKEC 1080

Query: 1081 LDAGMDGFLGKPIKRPKLKQILQEYIDTEKQIN 1113
            LDAGMDGFLGKPIKRPKLKQILQEYIDTEKQIN
Sbjct: 1081 LDAGMDGFLGKPIKRPKLKQILQEYIDTEKQIN 1113

>TPHA0D04590 Chr4 (1001887..1005270) [3384 bp, 1127 aa] {ON} Anc_5.700
            YIL147C
          Length = 1127

 Score = 1232 bits (3188), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 668/1142 (58%), Positives = 804/1142 (70%), Gaps = 63/1142 (5%)

Query: 6    RKAFKPPYRITIRAQLTXXXXXXXXXXXXXXXXTTGVYFTENYKELRSGRLNIAAKLKSS 65
            +K +KPPYRI+IRAQLT                T GVYFT NYK L++GRL IAA+LK+S
Sbjct: 6    KKFWKPPYRISIRAQLTALVSLVAIISLIILAVTAGVYFTANYKNLKTGRLYIAAQLKAS 65

Query: 66   QIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVAR 125
            QIDQTLNYL+YQC YL+S +TLQN+L++Y AGN +  NW ES  V++KFL+SSDLF VAR
Sbjct: 66   QIDQTLNYLYYQCYYLSSGETLQNSLVSYSAGNISSTNWYESSLVLEKFLTSSDLFSVAR 125

Query: 126  LYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLM 185
            LYD NF  ++NATNN +G+ +P  V+ +LF LS N SLPSSL   GI TDPVLNGS +LM
Sbjct: 126  LYDTNFNIMINATNNASGNYVPESVIDKLFTLSLNISLPSSLETIGICTDPVLNGSNFLM 185

Query: 186  SMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGKV 245
            SMSLPI  NPSIILS SR+YGY++++MSA+GLK+V+ + TALENS V VISA Y+    +
Sbjct: 186  SMSLPIFANPSIILSDSRIYGYLSVIMSAEGLKSVFNDTTALENSEVFVISADYSITTNL 245

Query: 246  DGFHFVFE--VENDDFSTLIEYPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYSPC 303
            + F+F+F    +N D    + Y I N T++ + LV GK G++KKT        A+GYS C
Sbjct: 246  EYFNFLFASAYDNADKDYDLHYRIDNDTFVYNGLVNGKGGAVKKTNGFLGTAAAVGYSSC 305

Query: 304  SFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQK 363
            SFSL NW+A+V QPEA F   +TKLE+IISG VVA+AVFVCL+TFPLSHWAV+P++RLQK
Sbjct: 306  SFSLVNWLAIVAQPEAAFSESATKLERIISGVVVAVAVFVCLLTFPLSHWAVQPLIRLQK 365

Query: 364  ATELISQGRGLKPXX-XXXXXXXXXXXXXWRESVESHVRASLGI-FKSLRNNGSNELQSN 421
            ATE I++GRGL+P                WR S+E+HVR+SLG     L ++GS    + 
Sbjct: 366  ATERIAEGRGLRPPQPTVGSSVSRNSSIKWRNSLENHVRSSLGFNANKLSDSGSITANNF 425

Query: 422  DDMNEINERSSKNNSTGDNIKXXXXX-------XXXXFQRYTTS-NLVQARVPVYGRFLQ 473
             +    +   + ++  G+N                   Q+Y TS NL++ARVPVY R LQ
Sbjct: 426  KNNTSSSNSITSSHIYGNNNSSHSSMGINPDDDLSSSSQKYKTSANLIEARVPVYWRLLQ 485

Query: 474  DELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHEL 533
            DELSELTDTFN MT+ALDQHY LLE+RVRARTKQL             KTVFIANISHEL
Sbjct: 486  DELSELTDTFNTMTDALDQHYCLLEERVRARTKQLEAAKIQAESANEAKTVFIANISHEL 545

Query: 534  RTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGXXXXXXXXXXXXFSKNVLKRTNLEKR 593
            RTPLNGILGMTAISMEEDD DKI+ NLKLIFRSG            FSKNVL+RT LEKR
Sbjct: 546  RTPLNGILGMTAISMEEDDVDKIRGNLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKR 605

Query: 594  DFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVMNLVSNALK 653
            DFCITE+ALQIKSIFGK+A+DQHVKL IILMPN +RS VLWGDSNRIIQ+VMNLVSNALK
Sbjct: 606  DFCITEVALQIKSIFGKLAKDQHVKLSIILMPNILRSYVLWGDSNRIIQVVMNLVSNALK 665

Query: 654  FTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIG-----NGKKTDMVRKKIQ 708
            FTP+DG VDVRI LLGEYDEERS  +DYK+VY+K GTELP+        +  D+ RK   
Sbjct: 666  FTPVDGNVDVRINLLGEYDEERSKAEDYKKVYVKQGTELPLNISHLKTEENNDISRKSET 725

Query: 709  ELSEKDCIEGDTAXXXXXXXXXXKIDKLIEDEEKNSFSDNEDTNNDIEILSMTTSSTRSY 768
            EL+  D  E  T           KI    ED E +         + + + S+ T+S++SY
Sbjct: 726  ELN-NDENETHTISKDDTADSSIKIGN--EDVEISEV-------DKMGMASLVTTSSKSY 775

Query: 769  DDAALQRQFKKTPDLDDKEETLGVELSEPKTWVISVEVEDTGPGIEPKLQEAVFEPFVQG 828
            DD AL +Q  K+ DLDD E  LGVEL E KTWVISVEV+DTG GI+PKLQE+VFEPFVQG
Sbjct: 776  DDTALMKQLIKSTDLDDDENKLGVELKEQKTWVISVEVKDTGSGIDPKLQESVFEPFVQG 835

Query: 829  DQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPLKQTREIHF-DDEK 887
            DQALSRQYGGTGLGLSIC+QL+TMM+GTM+LES VGVGSKFIFT+PLKQTREI   DDE 
Sbjct: 836  DQALSRQYGGTGLGLSICKQLSTMMNGTMELESEVGVGSKFIFTLPLKQTREISIPDDEL 895

Query: 888  FEDEFNAESKKNRRIKFKIYDSSKSHDSNDEDEEGIKSSRDIDSS-NNEHKDENGTSPDN 946
            F DEFNA SKKNR++KFK   SS +        + IK+   I SS NN H   +  S  +
Sbjct: 896  FNDEFNAVSKKNRKVKFKFSGSSSA--------KSIKTRNSIGSSLNNRHSTTSIDSSSS 947

Query: 947  H---------SKVRLDRPFLQSTGTATSSQKIPTL------------INKEDTNIEKSIR 985
                      S VRL+RPFLQSTGTATS+Q +PTL            +NK D      I 
Sbjct: 948  DSDEEDNVRPSSVRLNRPFLQSTGTATSTQNVPTLNAHTDDKSKNKVLNKMDL-----IY 1002

Query: 986  ILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPK 1045
            ILVAEDNHVNQEVIKRML LE I+NIDLA DGQDAFDK K L++N   YDIIFMDVQMP+
Sbjct: 1003 ILVAEDNHVNQEVIKRMLKLEGINNIDLARDGQDAFDKTKMLSENNGNYDIIFMDVQMPR 1062

Query: 1046 VDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
            +DGL +TKMIR++LNY  PIVAL+AF  ++N+KECLD GM+ FL KPIKRP LK IL++Y
Sbjct: 1063 LDGLAATKMIREELNYTQPIVALSAFPKEENVKECLDVGMNDFLSKPIKRPDLKIILKKY 1122

Query: 1106 ID 1107
            I+
Sbjct: 1123 IE 1124

>NCAS0G00250 Chr7 complement(40367..43918) [3552 bp, 1183 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1183

 Score = 1206 bits (3121), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 646/1179 (54%), Positives = 796/1179 (67%), Gaps = 105/1179 (8%)

Query: 9    FKPPYRITIRAQLTXXXXXXXXXXXXXXXXTTGVYFTENYKELRSGRLNIAAKLKSSQID 68
             KPP+R+ IR QLT                TTGVYFT NYK LRS RL IAA+LKSSQID
Sbjct: 11   LKPPFRLGIRTQLTVLVSVVALCSLVILAITTGVYFTSNYKNLRSDRLYIAAQLKSSQID 70

Query: 69   QTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVARLYD 128
            Q LNYL+YQ  +L+SRDTLQ  L NY AGNKT ENW +SE V+QKFL+S++LF  A+LYD
Sbjct: 71   QNLNYLYYQSYWLSSRDTLQIGLTNYVAGNKTAENWADSEQVIQKFLTSNNLFSNAQLYD 130

Query: 129  LNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLMSMS 188
             +F  V+ ATNNGTGDLIP  VL +L+PL+TNQ L SSL   GILTDPVLNGS Y+MSMS
Sbjct: 131  SSFNAVLTATNNGTGDLIPESVLKKLYPLATNQPLSSSLETIGILTDPVLNGSTYIMSMS 190

Query: 189  LPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGKVDGF 248
            LPI  NPSIIL+ S+VYGYITIVMSA+GLK V+ + TALE SNV ++S +YN++  ++ +
Sbjct: 191  LPIFANPSIILTDSKVYGYITIVMSAEGLKTVFNDTTALEQSNVAIVSGVYNNESTLNAY 250

Query: 249  HFVFE-------VENDDFSTLIEYPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYS 301
            HFVF        V N  F       I N ++L++AL EGK GS+KKTK+ + + +A+GYS
Sbjct: 251  HFVFAPYGAPSYVINSTFR------IMNNSFLNTALREGKGGSVKKTKFFYTKNIAVGYS 304

Query: 302  PCSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRL 361
            PC+FS  NW+A+V+Q E+VFLSPSTKL KIISGTVVAI VFV LITFPL+HWAVKPIVRL
Sbjct: 305  PCTFSFVNWIAIVSQDESVFLSPSTKLAKIISGTVVAIGVFVFLITFPLAHWAVKPIVRL 364

Query: 362  QKATELISQGRGLKPXXXXXXXXXXXXXXXWRESVESHVRASLGIFKSLRNNGSNELQSN 421
            QKATEL+S+GRGLK                   S++ +VR+++    S  +N S +  S 
Sbjct: 365  QKATELMSEGRGLKSTTPGSKNVSRS------SSIKHYVRSNIPSTASSVHNFSGDNLST 418

Query: 422  DDMNEINER---------------SSKNNSTGDNIKXXXXXXXXXFQRYT---------- 456
                 +N+R               S  N +T                R+T          
Sbjct: 419  TTNGHLNQRGLTPTPMPTTDLPSPSDSNFATEMISNANTSQRANSISRFTDHTDLSNRSK 478

Query: 457  ----TSNLVQARVPVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLXXXX 512
                ++NL++ARVP Y R   DELS+LTDTFNAMT+ALDQHY LLEDRVRARTKQL    
Sbjct: 479  KLTTSANLIEARVPDYRRLFSDELSDLTDTFNAMTDALDQHYALLEDRVRARTKQLEAAK 538

Query: 513  XXXXXXXXXKTVFIANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGXXXXX 572
                     KT+FIANISHELRTPLNGILGMTAISMEE D  KI+ +LKLIFRSG     
Sbjct: 539  IEAETANEAKTIFIANISHELRTPLNGILGMTAISMEETDIAKIRSSLKLIFRSGELLLH 598

Query: 573  XXXXXXXFSKNVLKRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMV 632
                   FSKNVLKRT LEKRDFCIT++ALQIKSIFGKVA+DQ V+L I+L+PN IR+M+
Sbjct: 599  ILTELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVRLSIVLLPNIIRTMI 658

Query: 633  LWGDSNRIIQIVMNLVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTEL 692
            L+GDSNRIIQIVMNLVSNALKFTP+DGKV+VRIKL+GEYDE  S   ++K+V +KSGTE 
Sbjct: 659  LFGDSNRIIQIVMNLVSNALKFTPVDGKVNVRIKLMGEYDENLSRESNFKKVLVKSGTEF 718

Query: 693  -------PIGNGKKTDMVRKKIQELSEKDCIEGDTAXXXXXXXXXXKIDKLIEDEEK--- 742
                    +G  KK D       + S +  ++               I     DE+K   
Sbjct: 719  IETKAKAILGAPKKDD------PKTSTESVVQIKENLNSNTSSSSNDIISTTSDEKKYDE 772

Query: 743  ------NSFSDNEDTNNDIEILSMTTSSTRSYDDAALQRQFKKTPDL-DDKEETLGVELS 795
                     SDN++ +  +E  S+ ++ST SYDDA    QFKKTP+L +D++  LG+EL+
Sbjct: 773  KEDEGEEDNSDNDNDDTSMETQSIVSTSTSSYDDAVFNNQFKKTPELYEDEDGNLGIELT 832

Query: 796  EPKTWVISVEVEDTGPGIEPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHG 855
             PKTWVI++EV+DTGPGI+P LQ++VFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM+G
Sbjct: 833  NPKTWVIAIEVQDTGPGIDPSLQKSVFEPFVQGDQTLSRQYGGTGLGLSICRQLANMMNG 892

Query: 856  TMKLESTVGVGSKFIFTVPLKQTREIHF--DDEKFEDEFNAESKKNRRIKFKI------- 906
            TM+L+S VGVGS F FTVPL QTRE+    DD  FEDEFN  S+KNRR+KFK+       
Sbjct: 893  TMELKSEVGVGSTFTFTVPLMQTRELELNEDDHPFEDEFNPASRKNRRVKFKLAKSLRSR 952

Query: 907  -----------------YDSSKSHDSNDEDEEGIKSSRDIDSSN-NEHKDENGTSPDNH- 947
                                 K  D   ++EE     ++ D+     H  +     +NH 
Sbjct: 953  KSRSSTTTFSTTNSLHNVQEEKEEDKLGDNEETKDGGKEEDAHQERRHSHDKNNEHNNHL 1012

Query: 948  -SKVRLDRPFLQSTGTATSSQKIPTLINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLE 1006
               V +DRPFLQSTGTATS++ I T+      +  K  +ILVAEDNHVNQEVIKRMLNLE
Sbjct: 1013 LGTVNMDRPFLQSTGTATSTRTIQTV-----PDAGKKFKILVAEDNHVNQEVIKRMLNLE 1067

Query: 1007 KIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIV 1066
             ++NI+LA DGQDAF++VK++ +  E++D+IFMDVQMPKVDGL+STKMIR DL+Y +PIV
Sbjct: 1068 GVENIELARDGQDAFNEVKAMVEQGEHFDMIFMDVQMPKVDGLLSTKMIRNDLHYTYPIV 1127

Query: 1067 ALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
            ALTAFA+D NIKECL+AGM+GFL KPIKRPK+K IL+EY
Sbjct: 1128 ALTAFADDSNIKECLEAGMNGFLSKPIKRPKVKTILEEY 1166

>CAGL0H06567g Chr8 (645707..649216) [3510 bp, 1169 aa] {ON} similar to
            uniprot|P39928 Saccharomyces cerevisiae YIL147c SLN1
          Length = 1169

 Score = 1192 bits (3084), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 647/1159 (55%), Positives = 795/1159 (68%), Gaps = 87/1159 (7%)

Query: 6    RKAFKPPYRITIRAQLTXXXXXXXXXXXXXXXXTTGVYFTENYKELRSGRLNIAAKLKSS 65
            R+  KPP+RI IRAQLT                TTGVYFT NYK LRS RL IAA+LKSS
Sbjct: 11   RRFLKPPFRIGIRAQLTALVSIVACLSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSS 70

Query: 66   QIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVAR 125
            Q+DQ LNYL+YQC +L SRDTLQNAL +Y AGNKT ENW ES NV+QKFLSSS+LF+++R
Sbjct: 71   QLDQNLNYLYYQCYWLASRDTLQNALASYVAGNKTEENWEESTNVIQKFLSSSNLFFLSR 130

Query: 126  LYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLM 185
            +YD +FK V+N TNNGTGD +P  + ++LFPLST+  LPSSL  +G+LTDPVLNG+ YLM
Sbjct: 131  VYDYDFKPVLNTTNNGTGDEVPESIQNQLFPLSTDVPLPSSLMTNGMLTDPVLNGTDYLM 190

Query: 186  SMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGKV 245
            SMSLPI  NPSII S  +VYGYIT+VMSA+GL++V+ + TALE SNV ++SA Y++  K+
Sbjct: 191  SMSLPIFANPSIIFSDLKVYGYITVVMSAEGLRSVFNDTTALEKSNVAIVSARYSNYTKI 250

Query: 246  DGFHFVFEVENDDFSTLIE-YPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYSPCS 304
            D + FVF       S L   + + + ++L+ A  + K GSIKKTK+ + +++AIGY PCS
Sbjct: 251  DSYRFVFPPYGVSPSILNRTFELDDSSFLNGAFKQAKGGSIKKTKFFYTKDVAIGYYPCS 310

Query: 305  FSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQKA 364
            F+  NWVA+V+Q E+VFLSPSTKL KIISGTVV IAVFV L+TFPL+ WAVKPIVRLQKA
Sbjct: 311  FNFVNWVAVVSQAESVFLSPSTKLTKIISGTVVGIAVFVSLLTFPLASWAVKPIVRLQKA 370

Query: 365  TELISQGRGLKPXXXXXXXXXXXXXXXWRESVESHVRASLGIFKSLRNNGSNELQSNDDM 424
            TELI++GRGL+P                ++ +       L     L  +  N   + D  
Sbjct: 371  TELIAEGRGLRPAGAGSGSRSGSRTSSMKKDIND-----LNFISRLSLSEKNHRPAYDSA 425

Query: 425  NEIN-----------ERSSKNNSTGDNIKXXXXXXXXXFQRYTTSNLVQARVPVYGRFLQ 473
            ++ N           + S  +N   DN +             T++NL +AR+P Y R   
Sbjct: 426  SDSNYATDGSLSHDLQTSQASNRPSDNDRSSSRSRFLT----TSTNLNEARLPDYRRLFS 481

Query: 474  DELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHEL 533
            DELS+LT+TFNAMT+ALDQHY LLEDRVRARTKQL             KTVFIANISHEL
Sbjct: 482  DELSDLTNTFNAMTDALDQHYALLEDRVRARTKQLEAAKIQAEAANEAKTVFIANISHEL 541

Query: 534  RTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGXXXXXXXXXXXXFSKNVLKRTNLEKR 593
            RTPLNGILGMTAISMEE D  KI+ +LKLIFRSG            FSKNVLKRT LEKR
Sbjct: 542  RTPLNGILGMTAISMEETDIAKIRNSLKLIFRSGELLLHILTELLTFSKNVLKRTALEKR 601

Query: 594  DFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVMNLVSNALK 653
            +FCIT++ALQIKSIFGKVA+DQHV+L I L PN IR+MVLWGDSNRIIQIVMNLVSNALK
Sbjct: 602  NFCITDVALQIKSIFGKVAKDQHVRLSISLTPNVIRTMVLWGDSNRIIQIVMNLVSNALK 661

Query: 654  FTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTEL----PIGNGKKTDMVRKKIQE 709
            FTP+DGKV+VRIKLLGEYDEE +  D++K+++  + ++     P+ +     +V+     
Sbjct: 662  FTPVDGKVNVRIKLLGEYDEEATKADNFKQIHTIADSDAHQQHPVSSSPNGVLVKHLST- 720

Query: 710  LSEKDCIEGDTAXXXXXXXXXXKIDKLIEDEEKNSFSDNEDTNNDIEILSMTTSSTRSYD 769
                      ++          K ++   DE+ +  S    +++  ++ S+ +SST SYD
Sbjct: 721  ----------SSDSNSNLSDSDKYNEKTYDEDDDEHSITNISDHSDDLSSLVSSSTSSYD 770

Query: 770  DAALQRQFKKTPDL-DDKEETLGVELSEPKTWVISVEVEDTGPGIEPKLQEAVFEPFVQG 828
            +A    QFKKTPDL +D  + LG EL++ KTWV ++EVEDTGPGI+PKL E+VFEPFVQG
Sbjct: 771  NALFNTQFKKTPDLYEDSNDGLGTELADQKTWVFAIEVEDTGPGIDPKLHESVFEPFVQG 830

Query: 829  DQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPLKQTREIH--FDDE 886
            DQ LSRQYGGTGLGLSICRQLATMMHGTMKLES VGVGSKF FTVPLKQTR I    +++
Sbjct: 831  DQTLSRQYGGTGLGLSICRQLATMMHGTMKLESKVGVGSKFTFTVPLKQTRVIKFDEEED 890

Query: 887  KFEDEFNAESKKNRRIKFKIYDSSKS---------------HDSNDEDEEGIKSSRDIDS 931
             FEDEFN ESKKNRR+KFK  DS++S               H  + +  EG  +S  I  
Sbjct: 891  LFEDEFNPESKKNRRVKFK--DSTRSLHSRRSRTSVDRITNHSGDKQSSEGHSTSFKISE 948

Query: 932  SNNEHKDENGTSPDN-------------------------HSKVRLDRPFLQSTGTATSS 966
              +E   E    PDN                           KV LDRPFLQSTGTATSS
Sbjct: 949  VKDEDI-EQSPEPDNLPKVGDENDSKASSSSSKSDNIKEKEEKVHLDRPFLQSTGTATSS 1007

Query: 967  QKIPTLINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKS 1026
            + +PT+      ++    +ILVAEDNHVNQEVIKRMLNLE I+NIDLACDGQDAFDKV+S
Sbjct: 1008 RNVPTM-----ADVTMRFKILVAEDNHVNQEVIKRMLNLEGINNIDLACDGQDAFDKVQS 1062

Query: 1027 LADNEEYYDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMD 1086
            L +  + YD+IFMD+QMPKVDGL+STKMIR+DLNYK  IVALTAFA+D NIKEC++AGM+
Sbjct: 1063 LVEQNDSYDMIFMDIQMPKVDGLLSTKMIRRDLNYKGSIVALTAFADDSNIKECIEAGMN 1122

Query: 1087 GFLGKPIKRPKLKQILQEY 1105
            GFL KPIKRPKLK IL+EY
Sbjct: 1123 GFLSKPIKRPKLKMILEEY 1141

>ZYRO0G06644g Chr7 complement(528671..532171) [3501 bp, 1166 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1166

 Score = 1191 bits (3081), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 645/1126 (57%), Positives = 788/1126 (69%), Gaps = 46/1126 (4%)

Query: 1    MRQSWRKAFKPPYRITIRAQLTXXXXXXXXXXXXXXXXTTGVYFTENYKELRSGRLNIAA 60
            MRQ     F+ P R+ IRAQLT                +TGVYFT+NYK LRS RL +AA
Sbjct: 3    MRQLMFGKFQSPIRLGIRAQLTALVSIVALVSLIILAVSTGVYFTDNYKNLRSERLYMAA 62

Query: 61   KLKSSQIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDL 120
            +LKS+QIDQ LNY++YQC +L+SRDTLQ AL NY AGNKTY NW++S NV+QKFL+SS L
Sbjct: 63   QLKSTQIDQNLNYMYYQCYWLSSRDTLQEALANYVAGNKTYANWVDSGNVIQKFLTSSGL 122

Query: 121  FYVARLYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNG 180
            F VA +YD  F  V++ATNNGTG+ IP   L  L PLS N+ LPSSL ++GILT+PVLNG
Sbjct: 123  FSVATIYDATFTPVLSATNNGTGNHIPESTLDRLMPLSGNKPLPSSLQSEGILTNPVLNG 182

Query: 181  SIYLMSMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYN 240
            + YLMSMSLPI  NPSIIL++S VYGYITIVMSAD LKNV+ + TALE SNV ++SA+Y+
Sbjct: 183  TSYLMSMSLPIFANPSIILTTSHVYGYITIVMSADSLKNVFDDTTALEKSNVAILSAVYD 242

Query: 241  DQGKVDGFHFVFEVENDDFSTLIE-YPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIG 299
                +  ++FVF       S L E  PI+NGT+LSSAL +GK G++++TK+ + +++A+G
Sbjct: 243  QNETLSSYNFVFAPLGVPSSILAETIPIKNGTFLSSALRQGKGGALERTKFLYTKKVAVG 302

Query: 300  YSPCSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIV 359
            YSPCS    NW+A+V Q EAVF+ P+TKL KIISGTVV I VFVCL+TFPL+HWAVKPIV
Sbjct: 303  YSPCSVVFVNWIAVVLQSEAVFMEPATKLTKIISGTVVGIGVFVCLVTFPLAHWAVKPIV 362

Query: 360  RLQKATELISQGRGLKPXXXXXXXXXXXXXXXWRESVESHVRASLGI-FKSLRNNGSNEL 418
            RLQKATELI++GRGL+                 R S   H  ++ G   +S   +  NE 
Sbjct: 363  RLQKATELITEGRGLRASSPGAGSSNVS-----RRSSFFHRPSNCGSSIRSRVTDNHNEK 417

Query: 419  QSNDDMNEINE-----RSSKNNSTGDNIKXXXXXXXXXFQR--YTTSNLVQARVPVYGRF 471
              +    +I         S N+S   +I            +   T++NL++ARVPVY RF
Sbjct: 418  GHDLHGEQIQHGFFAMNGSINHSLAASIASSGNEALSDKSKGLTTSANLIEARVPVYRRF 477

Query: 472  LQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISH 531
              DELSELTDTFN MT+ALDQHY LLEDRVRART+QL             KTVFIANISH
Sbjct: 478  FSDELSELTDTFNTMTDALDQHYALLEDRVRARTRQLEAAKIDAEAANEAKTVFIANISH 537

Query: 532  ELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGXXXXXXXXXXXXFSKNVLKRTNLE 591
            ELRTPLNGILGMTAISMEE D DKI+ +LKLIFRSG            FSKNVLKRT LE
Sbjct: 538  ELRTPLNGILGMTAISMEERDIDKIQNSLKLIFRSGELLLHILTELLTFSKNVLKRTKLE 597

Query: 592  KRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVMNLVSNA 651
            KR+F +T++ALQIKSIFGKVA+DQ V+L I L PN IR+MVL+GDSNRIIQIVMNLVSNA
Sbjct: 598  KRNFSVTDVALQIKSIFGKVAKDQRVRLSITLYPNLIRTMVLFGDSNRIIQIVMNLVSNA 657

Query: 652  LKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNGKKTDMVRKKIQELS 711
            LKFTP+DGKV+V + LLGEYD ERS N+++K+VY+  GTE P GN +K    +  I+E  
Sbjct: 658  LKFTPVDGKVNVYMSLLGEYDAERSENENHKKVYVIPGTE-PKGNDEKD---KGGIEE-K 712

Query: 712  EKDCIE---GDTAXXXXXXXXXXKIDKLIEDEEKNSFSDNEDTN----NDIEILSMTTSS 764
            E+  IE    DT+          +    + D ++   SD+ D       D + +S  ++S
Sbjct: 713  ERFSIENTPNDTSSNSSNKHSDTETTPGLNDTDEKQASDDMDGGEEDVEDADEVSSFSTS 772

Query: 765  TRSYDDAALQRQFKKTPDL-DDKEETLGVELSEPKTWVISVEVEDTGPGIEPKLQEAVFE 823
            T SY+D     QFKKTP + DD  E LGVE+ + K WVIS+ VEDTGPGI+  L E+VFE
Sbjct: 773  TSSYNDTVFHSQFKKTPKVCDDSSEELGVEVKDKKKWVISIVVEDTGPGIDSSLHESVFE 832

Query: 824  PFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPLKQTREIHF 883
            PFVQGDQALSRQYGGTGLGLSICRQLATMM+GTM L+S +GVGS+F FTVPL QTREI+F
Sbjct: 833  PFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMDLKSKLGVGSRFTFTVPLTQTREINF 892

Query: 884  DD--EKFEDEFNAESKKNRRIKFKIYDSSKSHDSNDEDEEGIKSSRDIDSSNNEHKDENG 941
            DD    FEDEFN +SKKNR++KFKI  S KS  S          S   D S ++ K    
Sbjct: 893  DDIPAAFEDEFNPDSKKNRKVKFKIAKSLKSKRSKSSLMTVGPKSSSSDKSLSQLK---- 948

Query: 942  TSPDNHSKVRLDRPFLQSTGTATSSQKIPT--LINKEDTNIEKSIRILVAEDNHVNQEVI 999
               D+   VRLDRPFLQSTGTA+S+  + T   INK          ILVAEDN VNQEVI
Sbjct: 949  -LTDSDRSVRLDRPFLQSTGTASSNTNLGTTSTINK----------ILVAEDNDVNQEVI 997

Query: 1000 KRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKDL 1059
            KRMLNLE + NI+L CDGQ+A DKVK L +N E+Y++IFMDVQMPK+DGL+STKMIR+DL
Sbjct: 998  KRMLNLEGVHNIELVCDGQEALDKVKQLVENGEHYNLIFMDVQMPKMDGLLSTKMIRRDL 1057

Query: 1060 NYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
            NY HPIVALTAFA+D NI+ECLDAGMDGFL KPIKR +L++I++E+
Sbjct: 1058 NYTHPIVALTAFADDSNIRECLDAGMDGFLAKPIKRAQLRKIIEEF 1103

>KNAG0L02110 Chr12 (376096..379698) [3603 bp, 1200 aa] {ON} Anc_5.700
            YIL147C
          Length = 1200

 Score = 1182 bits (3057), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 656/1198 (54%), Positives = 793/1198 (66%), Gaps = 112/1198 (9%)

Query: 10   KPPYRITIRAQLTXXXXXXXXXXXXXXXXTTGVYFTENYKELRSGRLNIAAKLKSSQIDQ 69
            KPPYR+ IRAQLT                TTGVYFT NYK LRS RL IAA+LKSSQIDQ
Sbjct: 11   KPPYRVGIRAQLTMLVSIVAIISLVILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQ 70

Query: 70   TLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVARLYDL 129
             LNYL+YQC ++ SRDTLQ  L NY AGNK+  NW++S++V++KFL SS+LF VAR+YD 
Sbjct: 71   NLNYLYYQCYWVASRDTLQTGLANYVAGNKSDANWMDSQSVLEKFLGSSNLFSVARVYDS 130

Query: 130  NFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLMSMSL 189
            +F  V+N TNN TGDLIP +VL++L PLSTN  LPSSL  +GI+T+PV NGS YLMSMSL
Sbjct: 131  SFTTVLNTTNNSTGDLIPEDVLTQLLPLSTNVPLPSSLETNGIVTNPVKNGSSYLMSMSL 190

Query: 190  PILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGKVDGFH 249
            PI  NPSIIL+ SRVYGY+T+VMSA+GL +V+ + TALE S V ++SA+Y +  K+D + 
Sbjct: 191  PIFANPSIILTDSRVYGYVTVVMSAEGLLSVFNDTTALERSYVAIVSAVYTNATKLDAYR 250

Query: 250  FVFEVENDDFSTLIE-YPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYSPCSFSLS 308
            FVF       S L E +P+ N T+LSSAL +GK G++K T+  +  +LA+GYSP + +L+
Sbjct: 251  FVFPPFGSTSSILNETFPLNNNTFLSSALRQGKGGALKSTRLFYRLKLAVGYSPSTSNLA 310

Query: 309  NWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQKATELI 368
            NWVA+V Q E+VF+SP+TKL KII+GTVV I VF  LITFPL+HWAVKPIVRLQKATELI
Sbjct: 311  NWVAIVAQAESVFISPATKLAKIIAGTVVGIGVFAMLITFPLAHWAVKPIVRLQKATELI 370

Query: 369  SQGRGLKPXXXXXXXXXXXXXXXWRESVESHVRASLGIFKSLRNNGSNELQ--SNDDMNE 426
            ++ RGL+P                + S+ S     +       NN + + Q  S+ D N 
Sbjct: 371  TESRGLRPTTPTSGSRANSILRD-KSSLISFPLHPVSTNNINNNNSNEKAQPPSDQDTNT 429

Query: 427  INERSS--------KNNSTGD---------NIKXXXXXXXXXFQRYTTS-NLVQARVPVY 468
             N  SS        +++   D         N+           + YTT+ NL+QARVP Y
Sbjct: 430  NNSSSSIAVSNIREEHSPHADGVFSGISLSNVSDRLERLSNTSKHYTTAVNLIQARVPSY 489

Query: 469  GRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLXXXXXXXXXXXXXKTVFIAN 528
                +DELS+LT+TFN MT+ALDQHY LLE+RVRARTKQL             KTVFIAN
Sbjct: 490  RALFKDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEAETANEAKTVFIAN 549

Query: 529  ISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGXXXXXXXXXXXXFSKNVLKRT 588
            ISHELRTPLNGILGMTAISMEE D DKI+ +LKLIFRSG            FSKNVLKRT
Sbjct: 550  ISHELRTPLNGILGMTAISMEETDIDKIRNSLKLIFRSGELLLHILTELLTFSKNVLKRT 609

Query: 589  NLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVMNLV 648
             LEKR+FCIT++ALQIKSIFGKVA+DQHV+L IIL PN IRSMVL+GDSNRIIQIVMNLV
Sbjct: 610  KLEKRNFCITDVALQIKSIFGKVAKDQHVRLSIILSPNMIRSMVLYGDSNRIIQIVMNLV 669

Query: 649  SNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTEL----PIGNGKKTDMVR 704
            SNALKFTP+DGKVDVR+K+LG YDE  S   ++ +VY+K GTE+    P  N K     +
Sbjct: 670  SNALKFTPVDGKVDVRMKVLGLYDEALSEKYNHNKVYVKPGTEITDSTPSLNVKSEGQGK 729

Query: 705  KKI-QELSEKDCIEGDTAXXXXXXXXXXKIDKLI-EDEEKNSFSDNEDTNNDIEILSMTT 762
             K   + + K+    DTA            D++  E +E N + DNE         SM +
Sbjct: 730  DKFTSDTASKNNTSSDTAYDATPTT-----DRVAQESDEDNMYEDNE---------SMIS 775

Query: 763  SSTRSYDDAALQRQFKKTPDL--DDKEETLGVELSEPKTWVISVEVEDTGPGIEPKLQEA 820
            S+T SYDDA    QFKKT +L  +D E  +GVEL  PKTWVIS EVED+GPGI+  LQE+
Sbjct: 776  STTSSYDDAIFNSQFKKTTNLYDEDDESEMGVELETPKTWVISFEVEDSGPGIDKGLQES 835

Query: 821  VFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPLKQTRE 880
            VFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM G M LES VGVGSKF FT+PL QTRE
Sbjct: 836  VFEPFVQGDQTLSRQYGGTGLGLSICRQLAGMMKGKMLLESKVGVGSKFTFTLPLTQTRE 895

Query: 881  IHFD--DEKFEDEFNAESKKNRRIKFKIYDS--------------SKSHDS--------- 915
            I+F   ++ FEDEFNA+SKKNR++KF++  S              + SH S         
Sbjct: 896  INFANVEDPFEDEFNAKSKKNRKVKFRMARSLNSRKSRSSIVTAGASSHHSVHTRTPTKS 955

Query: 916  ---------------NDEDEEG----IKSSRDIDSSN---NEHKDENGTSPDNHSKVRLD 953
                           N  +  G     +S  D   S+   N  KD    S  N S + LD
Sbjct: 956  PRLKCDRSVSDRVVINSPERTGENITFRSESDDHLSHMHRNRDKDHERLSASN-STMSLD 1014

Query: 954  RPFLQSTGTATSSQKIPTLIN-KEDT------NIEKSI-------------RILVAEDNH 993
            RPFLQSTGTATS++ IP L + KE+       N+  S              +ILVAEDNH
Sbjct: 1015 RPFLQSTGTATSTRSIPHLSSFKEEKPNDPLLNVSSSAEQTKKTSEGNGAYKILVAEDNH 1074

Query: 994  VNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTK 1053
            VNQEVIKRML LE + +IDLACDGQDAFDKVK L D    Y++IFMDVQMPKVDGL STK
Sbjct: 1075 VNQEVIKRMLQLEGVKDIDLACDGQDAFDKVKQLQDKGSRYNLIFMDVQMPKVDGLTSTK 1134

Query: 1054 MIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEYIDTEKQ 1111
            MIR DL+   PIVALTAFA+D NIKECLDAGMDGFL KPIKR KLK IL+E+   E++
Sbjct: 1135 MIRHDLHCDFPIVALTAFADDSNIKECLDAGMDGFLSKPIKRTKLKTILKEFCSDERE 1192

>KAFR0D02240 Chr4 complement(450837..454400) [3564 bp, 1187 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1187

 Score = 1176 bits (3043), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 618/1162 (53%), Positives = 786/1162 (67%), Gaps = 87/1162 (7%)

Query: 10   KPPYRITIRAQLTXXXXXXXXXXXXXXXXTTGVYFTENYKELRSGRLNIAAKLKSSQIDQ 69
            KPPYRI+IR QL                 TTGVYFT +YK LR+ RL IAA+LKSSQIDQ
Sbjct: 24   KPPYRISIRTQLIAVVSLVAILSLLILAVTTGVYFTSSYKNLRANRLYIAAQLKSSQIDQ 83

Query: 70   TLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVARLYDL 129
            TL YL+YQ  ++++RDTLQ++L N+ AGNK+  NW  +E+V++KFLSSSD F   ++YD 
Sbjct: 84   TLTYLYYQSYWISTRDTLQDSLANFVAGNKSSSNWESTESVLEKFLSSSDYFSAVKVYDE 143

Query: 130  NFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLMSMSL 189
            NF  V++ TNNGTG+ I  +VL +LFPLSTN  L SSL   GILTDPVLNG+ YLMSMSL
Sbjct: 144  NFDTVLSVTNNGTGNQIAADVLEKLFPLSTNIPLSSSLETTGILTDPVLNGTSYLMSMSL 203

Query: 190  PILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGKVDGFH 249
            P+  NPSIILS+SRVYGYITI+M+ADGL +V+ + TA+E SNV ++SA+YN+Q ++D +H
Sbjct: 204  PVFANPSIILSTSRVYGYITIIMTADGLLSVFNDTTAIEKSNVAIVSAVYNNQSELDAYH 263

Query: 250  FVFEVENDDFS-TLIEYPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYSPCSFSLS 308
                      S T I + ++N ++L+ AL +GK GSIKKT + +N+ +A+GYSPCSF L+
Sbjct: 264  LALPPYGFTASVTDINFQLKNSSFLNGALKQGKGGSIKKTHFLYNKAVAVGYSPCSFELA 323

Query: 309  NWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQKATELI 368
            NWV++V+Q E+VF  PSTKL KII+G VV I+VFV L+T PL+++AVKPIVRL+KATE+I
Sbjct: 324  NWVSVVSQAESVFSGPSTKLTKIIAGVVVGISVFVMLVTLPLAYFAVKPIVRLKKATEII 383

Query: 369  SQGRGLKPXXXXXXXXXXXXXXXWRESVESHVRASLGIFKSLRNNGSNELQSND------ 422
            ++GRGL+P                 +S  + + +S    KS     SN L  N       
Sbjct: 384  TEGRGLRPTTPGSGSVSRTSSMRREKSPRTSIVSSR---KSTATGNSNSLNENSASLSSH 440

Query: 423  ----------------------DMN-EINERSSKNNSTGDNIKXXXXXXXXXFQRYTTSN 459
                                  +MN E+ +R+S +      I              T +N
Sbjct: 441  PMVLTSENVLVTNHSGLSRIPVNMNQELLDRASASTVNTLTIDSNDRLSERSKHLITFTN 500

Query: 460  LVQARVPVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLXXXXXXXXXXX 519
            L +ARVP+  +   DELS+LT+TFN MT+ALD+HYTLLEDRVRARTKQL           
Sbjct: 501  LTEARVPIARKLFFDELSDLTETFNTMTDALDEHYTLLEDRVRARTKQLEAAKIQAEAAN 560

Query: 520  XXKTVFIANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGXXXXXXXXXXXX 579
              KTVFIANISHELRTPLNGILGMTAISMEE+D  KI+ +LKLIFRSG            
Sbjct: 561  EAKTVFIANISHELRTPLNGILGMTAISMEEEDITKIRSSLKLIFRSGELLLHILTELLT 620

Query: 580  FSKNVLKRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNR 639
            FSKNVL+RT LEKR+FCIT++ALQ+KSIFGKVA+DQHV+L IIL PN +R+MVL+GDSNR
Sbjct: 621  FSKNVLQRTKLEKRNFCITDVALQMKSIFGKVAKDQHVRLSIILSPNIMRTMVLYGDSNR 680

Query: 640  IIQIVMNLVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNGKK 699
            IIQ+VMNLVSNALKFTP+DGKV V+IKLLGEYDEE S N  +++VY+K GTE        
Sbjct: 681  IIQVVMNLVSNALKFTPVDGKVQVKIKLLGEYDEESSKNSKFEKVYVKGGTEF------- 733

Query: 700  TDMVRKKIQELSEKDCIEGDTAXXXXXXXXXXKIDKLIEDEEKNSFSDNEDTNNDIEILS 759
               +  ++  LS++     ++            I + ++    N F+ + D+++  E  +
Sbjct: 734  -TSIPAELAALSKR-----ESTAGSHFSGSSSHIKEKLDGIPANVFASDSDSDDPSEGTT 787

Query: 760  MTTSSTRS-------------------YDDAALQRQFKKTPDL-DDKEETLGVELSEPKT 799
            + TS  R+                   YDDA    QFKKTPDL +D++  LG ELS+ KT
Sbjct: 788  INTSQQRTSSNEDYVDNISIASTSTSSYDDAIFNSQFKKTPDLYEDEDGNLGEELSQQKT 847

Query: 800  WVISVEVEDTGPGIEPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKL 859
            WV  +EV DTGPGI+  LQE+VFEPFVQGDQ LSRQYGGTGLGLSICRQLATMM+GTM L
Sbjct: 848  WVFRIEVIDTGPGIDSSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMNGTMTL 907

Query: 860  ESTVGVGSKFIFTVPLKQTREIHFDDEK--FEDEFNAESKKNRRIKFKI----------- 906
            ESTVG GSKFIFTVPL QTR I  D+ +  +EDEFN +SK NR++KF +           
Sbjct: 908  ESTVGSGSKFIFTVPLTQTRVIKLDESEHPYEDEFNPKSKMNRKVKFNVARSINSRRSRS 967

Query: 907  --YDSSKSHDSNDEDEEGIKSSRDIDSSNNEHKDENGT-SPDNHSKVRLDRPFLQSTGTA 963
                S+ S  +   +E  +++  +    +  +K+E+ +  P++ S + LDRPFLQSTGTA
Sbjct: 968  SLITSNSSRIATVREESRLETRSNHSDVSTSNKNESASPQPESGSNLNLDRPFLQSTGTA 1027

Query: 964  TSSQKIPTLINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDK 1023
             SS  +PT+       + K++ +LVAEDNHVNQEVIKRML+LE + NIDLACDGQDAFD 
Sbjct: 1028 ISSANVPTV-----ATLGKTLNVLVAEDNHVNQEVIKRMLSLEGVKNIDLACDGQDAFDN 1082

Query: 1024 VKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDA 1083
            VKSL +  E+YD+IFMDVQMPKVDGL +TKMIR DL Y+HPIVALTAFA+D NIKECLDA
Sbjct: 1083 VKSLKERGEFYDMIFMDVQMPKVDGLSATKMIRNDLKYEHPIVALTAFADDSNIKECLDA 1142

Query: 1084 GMDGFLGKPIKRPKLKQILQEY 1105
            GMDGFL KPIKRP+LK IL EY
Sbjct: 1143 GMDGFLSKPIKRPQLKTILLEY 1164

>TDEL0B02210 Chr2 complement(396111..399398) [3288 bp, 1095 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1095

 Score = 1174 bits (3036), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 634/1122 (56%), Positives = 780/1122 (69%), Gaps = 53/1122 (4%)

Query: 6    RKAFKPPYRITIRAQLTXXXXXXXXXXXXXXXXTTGVYFTENYKELRSGRLNIAAKLKSS 65
            ++ F PP+RI+IR QLT                TTGVYFT NYK LRS RL +AA+LKSS
Sbjct: 8    KEKFSPPFRISIRTQLTALVSLVALVSLIILAVTTGVYFTSNYKSLRSERLYVAAQLKSS 67

Query: 66   QIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVAR 125
            QIDQ LNYL+YQC +L+S+ TLQ +L NY +GNKT  NW++S +V+QKFLSSS LF VAR
Sbjct: 68   QIDQNLNYLYYQCYWLSSQSTLQTSLANYVSGNKTDANWVDSSSVLQKFLSSSALFSVAR 127

Query: 126  LYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLM 185
            +YD +F+ V+NATNNGTGD++ ++VL++L PLS+N +LP+SL ++G+LTDPVLNG+ YLM
Sbjct: 128  VYDADFQTVLNATNNGTGDVLGDDVLAKLMPLSSNMALPASLESEGMLTDPVLNGTSYLM 187

Query: 186  SMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGKV 245
            SMSLPI  NPSIIL+ SRVYGY+TI+MSAD LK+VY + TALE S+VT++SAIY     +
Sbjct: 188  SMSLPIYANPSIILTESRVYGYVTIIMSADSLKSVYDDRTALEKSSVTIVSAIYKKDQGL 247

Query: 246  DGFHFVFEVENDDFSTLIE-YPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYSPCS 304
              + FVF         L E +PI N ++LS+AL +GK+GS ++T   +NR  A+GYSPCS
Sbjct: 248  GSYRFVFAPYGTTPGILDETWPINNNSFLSAALRQGKAGSEQRTDLFYNRPSAVGYSPCS 307

Query: 305  FSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQKA 364
            F   NWVA+++Q EAVF+ PST+L KII G VV I  FVC+ TFPL+HWAV+PIVRLQKA
Sbjct: 308  FKFVNWVAIISQSEAVFMEPSTRLTKIIIGVVVGIGAFVCIATFPLAHWAVQPIVRLQKA 367

Query: 365  TELISQGRGLKPXXXXXXXXXXXXXXXWRE--SVESHVRASLGIFKSLRNNGSNELQSND 422
            TE+I++GRGL+                 R      S    SL   K      S E   N 
Sbjct: 368  TEIITEGRGLRSGTPGSSSVSRNSSFIRRRFSGSSSVRSPSLADEKGAVGRASTEGSFNY 427

Query: 423  DMNEINERSSKNNSTGDNIKXXXXXXXXXFQRYTTSNLVQARVPVYGRFLQDELSELTDT 482
            D   +   +S    + D  +          +  T+SNLV+ARVPVY  F  DE SELTDT
Sbjct: 428  D-QAVPSLNSNAEISSDRTR----------KYMTSSNLVEARVPVYRIFFSDEFSELTDT 476

Query: 483  FNAMTNALDQHYTLLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLNGILG 542
            FN MTNALDQHY LLEDRVRARTKQL             KTVFIANISHELRTPLNGILG
Sbjct: 477  FNTMTNALDQHYALLEDRVRARTKQLEAAKVEAEAANEAKTVFIANISHELRTPLNGILG 536

Query: 543  MTAISMEEDDSDKIKENLKLIFRSGXXXXXXXXXXXXFSKNVLKRTNLEKRDFCITEIAL 602
            MTAISMEE D DKI+ +LKLIFRSG            FSKNVL+RT LEKRDF IT++A+
Sbjct: 537  MTAISMEERDIDKIQSSLKLIFRSGELLLHILTELLTFSKNVLQRTKLEKRDFSITDVAV 596

Query: 603  QIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVMNLVSNALKFTPIDGKVD 662
            QIKSIFGKVA+DQ VK  I L PN+IR MVL+GDSNRIIQIVMNLVSNALKFTP+DGKV 
Sbjct: 597  QIKSIFGKVAKDQRVKFSITLFPNQIRKMVLYGDSNRIIQIVMNLVSNALKFTPVDGKVS 656

Query: 663  VRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNGKKTDMVRKKIQELSEKDCIEGDTAX 722
            VR++LLGEYD++RS N+D+K VY+  GTE P  +G    ++   +++  +++ +E +   
Sbjct: 657  VRMRLLGEYDKQRSENEDFKAVYVIDGTE-PREDG----LIPPPVKQFEKQEDLEKE--- 708

Query: 723  XXXXXXXXXKIDKLIEDEEKNSFSDNEDTNNDIEI-----------LSMTTSSTRSYDDA 771
                     KI +   +EE+ S SD+E TN D +            +S+ + ST SYDD 
Sbjct: 709  ---------KISEK-HNEEEASTSDSEKTNLDDKTPDSKRSDADDQVSLISISTSSYDDT 758

Query: 772  ALQRQFKKTPDLDDKEETLGVELSEPKTWVISVEVEDTGPGIEPKLQEAVFEPFVQGDQA 831
                QFKK       E   G  L  PK W ISVEVEDTGPGI+P L E+VFEPFVQGDQA
Sbjct: 759  IFHTQFKKHTSSSGDEN--GHLLEHPKNWAISVEVEDTGPGIDPSLHESVFEPFVQGDQA 816

Query: 832  LSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPLKQTREIHFDDE-KFED 890
            LSRQYGGTGLGLSICRQLATMM+GTMKL+S +GVGSKF FT+PL QTREI F+DE  FED
Sbjct: 817  LSRQYGGTGLGLSICRQLATMMNGTMKLDSKLGVGSKFTFTLPLTQTREIEFEDENAFED 876

Query: 891  EFNAESKKNRRIKFKIYDSSKSHDSNDEDEEGIKSSRDIDSSNNEHKDENGTSPDNHSKV 950
            EFN  SKKNR++KFK+  S KS  S              D S+ + K     S  +   V
Sbjct: 877  EFNPLSKKNRKVKFKVAKSIKSRKSKSSLSNSSGKGGSSDKSSKQLK--GSESEFSVGNV 934

Query: 951  RLDRPFLQSTGTATSSQKIPTLINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDN 1010
             LDRPFLQSTGTA+SS+ +  +     +N+ KS RILVAEDNHVNQEVIKRML LE ID 
Sbjct: 935  SLDRPFLQSTGTASSSKNVTVV-----SNVNKSYRILVAEDNHVNQEVIKRMLTLEGIDR 989

Query: 1011 IDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTA 1070
            IDLA DGQDAFDKVK+L +  E+Y++IFMDVQMPKVDGL++TKMIRKDL+Y++PIVALTA
Sbjct: 990  IDLAADGQDAFDKVKALQEKGEHYELIFMDVQMPKVDGLLATKMIRKDLDYQYPIVALTA 1049

Query: 1071 FANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEYIDTEKQI 1112
            FA+D NI+ CL+AGM+GFL KPIKRPKLK I+ +Y   + ++
Sbjct: 1050 FADDSNIRVCLEAGMNGFLSKPIKRPKLKTIIAQYCHDDSKV 1091

>SAKL0E14872g Chr5 (1231857..1235279) [3423 bp, 1140 aa] {ON} similar
            to uniprot|P39928 Saccharomyces cerevisiae YIL147C SLN1
            Histidine kinase osmosensor that regulates a MAP kinase
            cascade; transmembrane protein with an intracellular
            kinase domain that signals to Ypd1p and Ssk1p, thereby
            forming a phosphorelay system similar to bacterial
            two-component regulators
          Length = 1140

 Score = 1162 bits (3007), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 613/1149 (53%), Positives = 782/1149 (68%), Gaps = 79/1149 (6%)

Query: 6    RKAFKPPYRITIRAQLTXXXXXXXXXXXXXXXXTTGVYFTENYKELRSGRLNIAAKLKSS 65
            R   KPP+++ IR QL                 TTGVYFT NYK LR+ RL++AA+LKSS
Sbjct: 8    RSKLKPPFKVGIRTQLIALVCVVALLSLVILAVTTGVYFTANYKSLRADRLHVAAQLKSS 67

Query: 66   QIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVAR 125
            QIDQ LNYL+YQC +L++RDTLQ++LI Y AGN T ENW E+E V++KFL SSDLF VAR
Sbjct: 68   QIDQNLNYLYYQCYWLSTRDTLQDSLIRYRAGNTTKENWSEAEIVLEKFLGSSDLFSVAR 127

Query: 126  LYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLM 185
            +YD  FK V+NATNNG+G+L+P  VL+ LFPLST+  L SSL   GILTDPVLN ++Y+M
Sbjct: 128  IYDSTFKTVLNATNNGSGNLVPEHVLTNLFPLSTDDPLASSLQTSGILTDPVLNDTVYVM 187

Query: 186  SMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGKV 245
            SMSLPI  +PSI+L++S + GYIT+VMSA+ LK V+ + TAL+ S+V ++SA Y++Q   
Sbjct: 188  SMSLPIFASPSIMLTNSEISGYITVVMSAESLKIVFNDTTALDKSDVAILSAEYSNQSLP 247

Query: 246  DGFHFVFEVENDDFSTLIEYP--IQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYSPC 303
              +HFVF       + +I+Y   I+NG+++ SA  + KSGS+K+T + + +++A+GYSPC
Sbjct: 248  VSYHFVFPPHGVG-ADIIDYSFTIENGSFIQSAFDDRKSGSVKRTSFFYGKDVAVGYSPC 306

Query: 304  SFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQK 363
             F    WVA+++QPE VFLSPST+L  II GT + IAVF+CL+TFPL+HWAVKPIVRLQK
Sbjct: 307  LFKQVQWVAVISQPENVFLSPSTRLTNIIIGTALGIAVFMCLVTFPLAHWAVKPIVRLQK 366

Query: 364  ATELISQGRGLKPXXXXXXXXXXXXXXXWRESVESHVRASLGIFKSL------RNNG--- 414
            ATE+I+  RGL+                 R S  S + +   +F+++      R+NG   
Sbjct: 367  ATEIITARRGLRSYNQSAPASRTNSFRK-RPSTSSSIGS---VFRTITDRPHERDNGHSN 422

Query: 415  -------SNELQSNDDMNEINERSSKNNSTGDNIKXXXXXXXXXFQR---YTTSNLVQAR 464
                   SN + S +   E+ E S     T              ++      ++NL+ AR
Sbjct: 423  FELHHRTSNSVDSQEARMEL-EISGALPDTNPTTPTSYTNDQHSYKSDNFVNSTNLIDAR 481

Query: 465  VPVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLXXXXXXXXXXXXXKTV 524
            VPVYGR   DELSELTDTFN MT+ LD+HY LLEDRVRARTKQL             KTV
Sbjct: 482  VPVYGRLFSDELSELTDTFNTMTDELDRHYALLEDRVRARTKQLEAAKIEAEAANEAKTV 541

Query: 525  FIANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGXXXXXXXXXXXXFSKNV 584
            FIANISHELRTPLNGILGMTAISM E D  K++ +LKLIFRSG            FSKNV
Sbjct: 542  FIANISHELRTPLNGILGMTAISMAEKDMQKVQNSLKLIFRSGELLLHILTELLTFSKNV 601

Query: 585  LKRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIV 644
            L+RT LE+R+F I ++ALQ+KSIFGK+A+DQHV L IIL PN IR+M+LWGDSNRIIQIV
Sbjct: 602  LQRTKLEERNFAIMDVALQVKSIFGKLAKDQHVNLSIILSPNVIRTMILWGDSNRIIQIV 661

Query: 645  MNLVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNGKKT---- 700
            MNLVSNALKF+P+DGKV VRIKLLGEYD ++S + +Y +V+IK GTE+P  +  K+    
Sbjct: 662  MNLVSNALKFSPVDGKVGVRIKLLGEYDGKKSKDSNYNDVFIKPGTEIPDASASKSSLST 721

Query: 701  ------DMVRKKI-------QELSEKDCIEGDTAXXXXXXXXXXKIDKLIEDEEKNSFSD 747
                  D +++++       Q+L E+     D +            D    D +K S S+
Sbjct: 722  LEYTKVDAIQRRLASKSSDSQKLKEEPIASSDVSSSDGKDESEADTDT---DTDKRSNSE 778

Query: 748  NEDTNNDIEILSMTTSSTRSYDDAALQRQFKKTPDL---DDKEETLGVELSEPKTWVISV 804
              D+       S+ +S+  SYDDA L  Q +K P     +D  ++LG +L   KTWVI++
Sbjct: 779  ISDSL------SLVSSNNSSYDDAILHAQLRKVPSCGNGEDSGDSLGRKLEISKTWVIAI 832

Query: 805  EVEDTGPGIEPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVG 864
            EVEDTGPGIEP L E+VFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM GTMKLES VG
Sbjct: 833  EVEDTGPGIEPALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLESKVG 892

Query: 865  VGSKFIFTVPLKQTREIHFDD--EKFEDEFNAESKKNRRIKFKIYDSSKSHDSNDEDEEG 922
            VGSKF FTVPL QTRE+ FDD    FEDEFNA SKKNR++KFK+          +++  G
Sbjct: 893  VGSKFTFTVPLTQTREVSFDDVENPFEDEFNAHSKKNRKVKFKM----------NKNSGG 942

Query: 923  IKSSRDIDSSNNEHKDENG------TSPDNHSKVRLDRPFLQSTGTATSSQKIPTLINKE 976
             KS   +++S N   D          S  +   VR+DRPFLQSTGTATS++ I T+    
Sbjct: 943  SKSRPSVNTSLNSGTDSTAEKMALSESEVSVGSVRVDRPFLQSTGTATSTRSITTV---- 998

Query: 977  DTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDI 1036
              ++E+  +ILVAEDN+VNQEV+KRMLNLE + +IDLACDGQ+AFDKVK+L +  ++Y I
Sbjct: 999  -KSLERPFKILVAEDNNVNQEVVKRMLNLEGLSDIDLACDGQEAFDKVKALQEANDHYRI 1057

Query: 1037 IFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRP 1096
            IFMDVQMP+VDGL+STKMIR++L Y HPIVALTAFA+D NIK CLD+GM+GFL KPIKRP
Sbjct: 1058 IFMDVQMPRVDGLLSTKMIRQELRYSHPIVALTAFADDSNIKVCLDSGMNGFLSKPIKRP 1117

Query: 1097 KLKQILQEY 1105
            KLK +L E+
Sbjct: 1118 KLKSVLSEF 1126

>Kwal_55.19707 s55 complement(89757..93188) [3432 bp, 1143 aa] {ON}
            YIL147C (SLN1) - histidine kinase osmosensor that
            regulates an osmosensing MAP kinase cascade and is
            similar to bacterial two-component regulators [contig
            159] FULL
          Length = 1143

 Score = 1161 bits (3004), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 607/1146 (52%), Positives = 790/1146 (68%), Gaps = 78/1146 (6%)

Query: 5    WRKAFKPPYRITIRAQLTXXXXXXXXXXXXXXXXTTGVYFTENYKELRSGRLNIAAKLKS 64
            +++  + P  ++IR QLT                 TGVYFT ++K LR+ RL++AA+LKS
Sbjct: 13   FQRRLRRPLVVSIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSLRAERLHVAAQLKS 72

Query: 65   SQIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVA 124
            SQIDQ LNYL+YQC +L++RD LQNAL  Y AGN + ENW ++   + KFL SS+LF +A
Sbjct: 73   SQIDQNLNYLYYQCYWLSTRDILQNALTQYLAGNTSTENWSDASTTLDKFLGSSNLFSLA 132

Query: 125  RLYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYL 184
            R+YD +F+ V+N +NNG+G+LIP  +L++LFPLST+ +LPSSL   G+LTDPVLNGS+YL
Sbjct: 133  RVYDSSFQDVLNVSNNGSGNLIPENLLTQLFPLSTDVALPSSLERTGMLTDPVLNGSVYL 192

Query: 185  MSMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGK 244
            MSMSLPI  NPSIILS+++VYGYIT+V+SA+GLK+VY + TAL++S+V ++S +Y+D  +
Sbjct: 193  MSMSLPIFANPSIILSTAKVYGYITVVISAEGLKSVYNDTTALDDSSVIIVSTVYDDH-E 251

Query: 245  VDGFHFVFEVENDDFSTLIE-YPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYSPC 303
            + G+H VF   N     + E Y I+NG++L  A+ +GK GSIK T++  N+++A+GYSPC
Sbjct: 252  LAGYHLVFPPYNMYPDVINEHYQIENGSFLEDAIKDGKGGSIKSTRFFNNKKIAVGYSPC 311

Query: 304  SFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQK 363
            + +L+ WVA++TQPEA+FLSPST+L KII GT +AIAV  C++TFPLSHWAV+PIVRLQK
Sbjct: 312  NSTLAQWVAIITQPEAIFLSPSTRLAKIIVGTCIAIAVVTCVVTFPLSHWAVQPIVRLQK 371

Query: 364  ATELISQGRGLKPXXXXXXXXXXXXXXXWRESVES-----HVRASLGIFKSLRN----NG 414
            ATE+I+ GRGL+                  ES  S      VR S  + ++ R+    + 
Sbjct: 372  ATEIITAGRGLRSDNSSTLFSHKRTSTA--ESFSSIFGTGSVRRSGSVARAGRDKYIPDS 429

Query: 415  SNEL---QSNDDMNEINERS------SKNNSTGDNIKXXXXXXXXXFQRYTTSNLVQARV 465
            S E+    S+D ++E+N+ +       K NS                +  T++NL++ARV
Sbjct: 430  SKEVPRGNSSDAIHEVNQENIEDIEMQKVNSPTPYSMMNESQAVKSERYITSTNLIEARV 489

Query: 466  PVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLXXXXXXXXXXXXXKTVF 525
            PVY R   DELSELT+TFN MT+ LD+HY LLEDRVRART+QL             KTVF
Sbjct: 490  PVYKRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKTVF 549

Query: 526  IANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGXXXXXXXXXXXXFSKNVL 585
            IANISHELRTPLNGILGMTAI+M E+D+ K+K +LKLIFRSG            FSKNVL
Sbjct: 550  IANISHELRTPLNGILGMTAIAMAEEDTAKVKSSLKLIFRSGELLLHIMTELLTFSKNVL 609

Query: 586  KRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVM 645
            KRT LE+RDF I +IALQ++SIFGK+A+DQHV L I ++PN +RSMVLWGDSNRI+QIVM
Sbjct: 610  KRTKLEERDFQIVDIALQVESIFGKLAKDQHVNLTISILPNLLRSMVLWGDSNRIVQIVM 669

Query: 646  NLVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNGKKTDMVRK 705
            NLVSNALKFTP+DGKVDV+ +LLGEYDEE+S   +YKEV++   TE    + +  D    
Sbjct: 670  NLVSNALKFTPVDGKVDVKFRLLGEYDEEKSKASEYKEVFVLPPTESRTSSTEAKD---- 725

Query: 706  KIQELSEKDCIEGDT------AXXXXXXXXXXKIDKLIE----DEEKNSFSDNEDTNNDI 755
               E + + C++ DT      +          KI +  E    D E    SD +D N D 
Sbjct: 726  ---EKNAESCVDSDTNVLSLPSTAESTDEKNVKIGQRSESEAIDSEAIESSDEDDENEDT 782

Query: 756  EILSMTTSSTRSYDDAALQRQFKKTPDLDDKEETLGVELSEPKTWVISVEVEDTGPGIEP 815
            +  S+ + +T SYDDA  Q + +K    ++ EE  G  L  PK WVIS+EV DTGPGI+P
Sbjct: 783  K--SIGSGNTSSYDDAIFQTRLRKDSSNEENEE--GRALESPKKWVISMEVHDTGPGIDP 838

Query: 816  KLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPL 875
             L E+VFEPFVQGDQ LSRQYGGTGLGLSICRQLATMMHGTMKL+S VGVGSKF FTVPL
Sbjct: 839  ALHESVFEPFVQGDQTLSRQYGGTGLGLSICRQLATMMHGTMKLDSQVGVGSKFSFTVPL 898

Query: 876  KQTREIHFDD--EKFEDEFNAESKKNRRIKFKIYDSSKSH---------DSNDEDEEGIK 924
             QT+E+ F+D    FEDEFN +SKKNR++KF++  S+K           + N  +  G++
Sbjct: 899  TQTKELLFEDVENPFEDEFNPDSKKNRKVKFRMGKSNKRSKSRSESSGTEGNGGNSPGVE 958

Query: 925  SSRDIDSSNNEHKDENGTSPDNHSK-----VRLDRPFLQSTGTATSSQKIPTLINKEDTN 979
             S              G SP   S+     VR+DRPFLQSTGTA S+  + T      ++
Sbjct: 959  GS-------------GGNSPGTGSEVSVGSVRVDRPFLQSTGTALSTTLVTT------SS 999

Query: 980  IEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFM 1039
            +    +ILVAEDN+VNQEVIKRMLNLE +++++LACDGQDAFDKVK+     ++YD+IFM
Sbjct: 1000 LADRRKILVAEDNNVNQEVIKRMLNLEGLEDVELACDGQDAFDKVKAQDATGKHYDLIFM 1059

Query: 1040 DVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLK 1099
            DVQMP+VDGL +T+MIRK+L Y HPIVALTAFA+D NIKECLDAGM+GFL KPIKRPK+K
Sbjct: 1060 DVQMPRVDGLTATRMIRKELGYSHPIVALTAFADDSNIKECLDAGMNGFLSKPIKRPKIK 1119

Query: 1100 QILQEY 1105
             IL+EY
Sbjct: 1120 AILKEY 1125

>KLLA0A00638g Chr1 complement(60378..63845) [3468 bp, 1155 aa] {ON}
            similar to uniprot|P39928 Saccharomyces cerevisiae
            YIL147C SLN1 Histidine kinase osmosensor that regulates a
            MAP kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1155

 Score = 1122 bits (2903), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 608/1155 (52%), Positives = 776/1155 (67%), Gaps = 60/1155 (5%)

Query: 3    QSWRKAFKPPYRITIRAQLTXXXXXXXXXXXXXXXXTTGVYFTENYKELRSGRLNIAAKL 62
            ++ R+ F PP+ + +R QL                 TTGVYFT NYK +R+ RL +AA+L
Sbjct: 12   KALRERFTPPFNVGLRTQLIILVCSICVLSLTIITVTTGVYFTTNYKSVRAERLQVAAQL 71

Query: 63   KSSQIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFY 122
            KSSQ+DQ LNYL+YQ  +L++RDTLQ+AL+N+ AGN + +NW  +E+ ++KFL SS LF 
Sbjct: 72   KSSQVDQNLNYLYYQIYWLSTRDTLQDALVNFRAGNSSRDNWNSAEDSLEKFLGSSGLFS 131

Query: 123  VARLYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSI 182
             AR+YD +F  V+N+TNNG+GD IP  VL+ELFPLS  + L SSL   GI+TDPV N + 
Sbjct: 132  AARVYDTSFNTVINSTNNGSGDNIPENVLAELFPLSGVEPLSSSLLTTGIVTDPVYNWTN 191

Query: 183  YLMSMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQ 242
            YL+SMSLP+ TNPSIIL+++ + GYIT++ SA+ LK V  +  AL+ S+V+++SA+++  
Sbjct: 192  YLLSMSLPVSTNPSIILNTNEIAGYITVIASAESLKAVVNDTIALDKSSVSILSAVFDSN 251

Query: 243  GKVDGFHFVFEVEN-DDFSTLIEYPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYS 301
              + G+HFVF       FS+ + +PI+NGT+++ A   GK GS+ KT     R +A+GYS
Sbjct: 252  SSLTGYHFVFPPHGTSSFSSKVTFPIKNGTFIADAFENGKVGSVMKTNMVQERNIAVGYS 311

Query: 302  PCSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRL 361
            P +F L NWVA+VTQPE VFLSP+ +L KII+GTV AIAVF+CL+TFP++HWAV+PIVRL
Sbjct: 312  PPTFKLVNWVAVVTQPEQVFLSPTIRLMKIIAGTVCAIAVFMCLLTFPIAHWAVQPIVRL 371

Query: 362  QKATELISQGRGLKPXXXXXXXXXXXXXXXWRESVESHVRASLGIFKSLRNNG--SNELQ 419
            QKATE+I+ GR LK                 R    S+    + +F      G  SN L 
Sbjct: 372  QKATEIITSGRDLKHYSNTGNSDSNTAITHSRTRSTSNQNQVMKLFNKSVTKGTPSNYLN 431

Query: 420  SN--------DDMNEINERSSKN----------NSTGDNIKXXXXXXXXXFQRYTTS-NL 460
             N         D   ++ R+S+           ++T  +            +RY  S NL
Sbjct: 432  HNYNVFPPSRTDSPSVSARNSQTIPRGPGDLTRSATTGSTPFSNDSSSYTSERYIKSTNL 491

Query: 461  VQARVPVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLXXXXXXXXXXXX 520
            V+A VPVY RF QDELSELTDTFN MT+ LD+HY LLE+RVRARTKQL            
Sbjct: 492  VEAYVPVYRRFFQDELSELTDTFNTMTDELDRHYALLEERVRARTKQLEAAKIQAESANE 551

Query: 521  XKTVFIANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGXXXXXXXXXXXXF 580
             KTVFIANISHELRTPLNGILGMTAI+M E D  K++ +LKLIFRSG            F
Sbjct: 552  AKTVFIANISHELRTPLNGILGMTAIAMAETDMQKVQNSLKLIFRSGELLLHILTELLTF 611

Query: 581  SKNVLKRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRI 640
            SKNVLKRT LE+RDF + +IALQIKSIFGK+A+DQHVKL I L PN IR++VLWGDSNRI
Sbjct: 612  SKNVLKRTKLEERDFSVMDIALQIKSIFGKLAKDQHVKLSIALTPNFIRTLVLWGDSNRI 671

Query: 641  IQIVMNLVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIG---NG 697
            IQIVMNLVSNALKFTP+DGKVDVRIKLLGEYD +RS + DY+EV++  G+E       N 
Sbjct: 672  IQIVMNLVSNALKFTPVDGKVDVRIKLLGEYDSKRSESVDYQEVFVVPGSEANDDFEFNL 731

Query: 698  KKTDMVRKKIQELS---EKDCIEGDTAXXXXXXXXXXKIDKLIEDEE----------KNS 744
              T  +R      S        +G T+          +++     E           ++ 
Sbjct: 732  TSTTPMRLPFNSSSGSVNTATKDGSTSPTTKTKEGSIQVESETSTEGNDNDESSIVLESK 791

Query: 745  FSDNEDTNNDIEILSMTTSSTRSYDDAALQRQFKK---TPDLDDKEETLGVELSEPKTWV 801
              +NED    + ILS +TSS+  YDDA    QFKK   + D D +E T   +L  PKTWV
Sbjct: 792  HEENEDEKEKMSILSTSTSSS--YDDAIFHSQFKKVLSSTDSDTEENTFR-DLKVPKTWV 848

Query: 802  ISVEVEDTGPGIEPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLES 861
            IS+EVEDTG GI+P LQE+VFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM GTMKL+S
Sbjct: 849  ISMEVEDTGSGIDPSLQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAKMMKGTMKLDS 908

Query: 862  TVGVGSKFIFTVPLKQTREIHFD--DEKFEDEFNAESKKNRRIKFKIYDSSKSHDSNDED 919
             VGVGSKFIFTVPL+QT+EI FD  +++FEDEFN  S+KNR++KFKI  S KS  +    
Sbjct: 909  KVGVGSKFIFTVPLQQTKEIVFDGAEKQFEDEFNIHSRKNRKVKFKINSSRKSVQTKKS- 967

Query: 920  EEGIKSSRDIDSSNN--EHKDENGTSPDNHSKVRLDRPFLQSTGTATSSQKIPTLINKED 977
                KSS D  S NN  E K  N T  ++   VR+DRPFLQSTGTATS++ I ++ ++  
Sbjct: 968  ----KSSIDGHSDNNVSERKASNSTE-NSVGNVRVDRPFLQSTGTATSTRSISSVASEVT 1022

Query: 978  TNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDII 1037
             +     R+LVAEDN+VNQEVIKRML LE + ++D+ACDGQ+A++KV+ +  N E Y +I
Sbjct: 1023 RH-----RVLVAEDNNVNQEVIKRMLQLEGLTDLDMACDGQEAYEKVEEILKNGESYSMI 1077

Query: 1038 FMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPK 1097
            FMDVQMP+VDGL++TKMIR DL YK PIVALTA+A+D NIK CL++GMDGFL KPIKRP 
Sbjct: 1078 FMDVQMPRVDGLLATKMIRNDLLYKGPIVALTAYADDSNIKVCLESGMDGFLPKPIKRPL 1137

Query: 1098 LKQILQEYID-TEKQ 1111
            LK+I+ +Y    EKQ
Sbjct: 1138 LKKIIAQYCSKKEKQ 1152

>AFR284W Chr6 (947118..950429) [3312 bp, 1103 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YIL147C (SLN1)
          Length = 1103

 Score =  994 bits (2569), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 551/1127 (48%), Positives = 725/1127 (64%), Gaps = 72/1127 (6%)

Query: 9    FKPPYRITIRAQLTXXXXXXXXXXXXXXXXTTGVYFTENYKELRSGRLNIAAKLKSSQID 68
             KPP++  +R QLT                TTGVYFT NY+ LR+ RL++AA+L SSQ+D
Sbjct: 13   LKPPFKAGLRTQLTILVCIIALSSLIILACTTGVYFTSNYRTLRADRLHVAARLMSSQVD 72

Query: 69   QTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVARLYD 128
            Q+L  L+YQC  L+++DT+QNAL +Y AGN++ ENWIE++ ++  FL  S  FY+A LYD
Sbjct: 73   QSLTLLYYQCNMLSTKDTIQNALSDYRAGNRSAENWIEADKILGGFLERSKTFYIAYLYD 132

Query: 129  LNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLMSMS 188
              +++V++  NN T   +  E L  L PL  ++   +   +  + T P  N ++ LMSM+
Sbjct: 133  EMYQEVLSRWNNDTEGSLAEESLVRLRPLEMDKYEYNEALDVQVETLP-YNKTLNLMSMT 191

Query: 189  LPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTA-LENSNVTVISAIYNDQGKVDG 247
            LP+    S I+    V G++TIVMSAD +  V  N+T+ L  S V++++ I ND+G +  
Sbjct: 192  LPV--EASTIIGRGNVVGFLTIVMSADPITAV--NDTSVLGESMVSILTGIPNDKGNLVK 247

Query: 248  FHFVFEV-ENDDFSTLIEYPIQNGTYLSSALVEGKSGSIKKTK--YPFN------RELAI 298
            + FVF   E D   T  EYPI+N ++L  A +      +  T   Y F       +++A+
Sbjct: 248  YRFVFPPGETDRSVTETEYPIKNASFLRDAFLNRSDNYVTSTSSFYHFGALGHDFKKVAV 307

Query: 299  GYSPCSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPI 358
            GYS C F   +WVA+V+Q E+VFLSP+ KL KII GTV+ +AVF+C++TF L+ WAVKPI
Sbjct: 308  GYSACKFRQLDWVAVVSQDESVFLSPAFKLTKIIIGTVLGVAVFMCIVTFILASWAVKPI 367

Query: 359  VRLQKATELISQGRGLKPXXXXXXXXXXXXXXXWRESVESHVRASLGIFKS--------- 409
            VRLQKATE I+ GRGL+                   S  S       +F+          
Sbjct: 368  VRLQKATEFIAAGRGLRTYNHSGRSSSQNTSIDRSNSRGSDHSLPRELFEKKHHVSPFVT 427

Query: 410  ---LRNNGSNELQSNDDMNEINERSSKNNSTGDNIKXXXXXXXXXFQRYTTSNLVQARVP 466
                 N+GS    S+ +    +     +  T  NI              + +N +  RVP
Sbjct: 428  ENHAANSGSCSSMSDHERYLHHIARYHDGETSTNILSDHEKGST-----SATNWIDTRVP 482

Query: 467  VYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLXXXXXXXXXXXXXKTVFI 526
            VY R   DELSELTDTFN MT+ LD+ Y +LEDRVRARTKQL             KTVFI
Sbjct: 483  VYRRLFTDELSELTDTFNTMTDELDRQYVVLEDRVRARTKQLEAAKIQAEAANEAKTVFI 542

Query: 527  ANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGXXXXXXXXXXXXFSKNVLK 586
            ANI HELRTPLNGILGMTAI+M E D +KI+ +LKLIFRSG            FSKNVLK
Sbjct: 543  ANIFHELRTPLNGILGMTAIAMAEQDQEKIQNSLKLIFRSGELLLHILTELLTFSKNVLK 602

Query: 587  RTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVMN 646
            RT LE+R F I +IALQ+KSIFGK+A+DQHVKL I LMPN IR+MVLWGDSNRIIQIVMN
Sbjct: 603  RTKLEERHFSIIDIALQVKSIFGKLAKDQHVKLSIYLMPNAIRTMVLWGDSNRIIQIVMN 662

Query: 647  LVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNGKKTDMVRKK 706
            LVSNALKFTP+DGKVDVRIKL+GEYD  RS   ++ EVYI  GTE+   +      V ++
Sbjct: 663  LVSNALKFTPVDGKVDVRIKLVGEYDSARSEACNFSEVYILPGTEVTNSSVNNIPTVVEE 722

Query: 707  IQELSEKDCIEGDTAXXXXXXXXXXKIDKLIEDEEKNSFSDNEDTNNDIEILSMTTSSTR 766
             ++  E++    DT                 E ++K+S     +T +D + +S+++S   
Sbjct: 723  EEKACEEEPTADDTP----------------ERKKKDS-----ETVDDADAISISSSVAT 761

Query: 767  SYDDAALQRQFKKTP---DLDDKEETLGV-ELSEPKTWVISVEVEDTGPGIEPKLQEAVF 822
            SYDDA L  Q KK P   DL+D +  + + +L +P++WVI +EV+DTGPGIEP L E+VF
Sbjct: 762  SYDDAVLHAQLKKIPTFIDLEDSDNNVTMSKLEKPRSWVIVIEVQDTGPGIEPSLHESVF 821

Query: 823  EPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPLKQTREIH 882
            +PFVQGDQ LSRQYGGTGLGLSICRQLATMM GTMKLES VG GSKF FTVPL+QT  + 
Sbjct: 822  KPFVQGDQTLSRQYGGTGLGLSICRQLATMMKGTMKLESKVGSGSKFTFTVPLQQTGTVK 881

Query: 883  FDDEK--FEDEFNAESKKNRRIKFKIYDSSKSHDS--NDEDEEGIKSSRDIDSSNNEHKD 938
            F+D    FEDEFN  SKKNR++KF++  S KS     N+ +  G  +   I+S      +
Sbjct: 882  FNDGDTLFEDEFNIFSKKNRKVKFQLNRSGKSRKGKMNNSNGAGSIAESAIESFGKSESE 941

Query: 939  ENGTSPDNHSKVRLDRPFLQSTGTATSSQKIPTLINKEDTNIEKSIRILVAEDNHVNQEV 998
             +  S      VR+DRPFLQSTGTATS++ +PTL     ++ E S+RILVAEDN+VNQEV
Sbjct: 942  ASFGS------VRVDRPFLQSTGTATSTRSVPTL-----SSAESSLRILVAEDNNVNQEV 990

Query: 999  IKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKD 1058
            IKRML+LE   NIDLACDG+DA+ KV +L +  E+YD+IFMDVQMP++DGL++TK++R+ 
Sbjct: 991  IKRMLHLEGAHNIDLACDGEDAYQKVSALVEQGEHYDLIFMDVQMPRMDGLLTTKLLRQK 1050

Query: 1059 LNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
            L+Y++PIVALTAFA+D NIKECL++GM+ FL KPIKRP LK+IL E+
Sbjct: 1051 LHYEYPIVALTAFADDSNIKECLESGMNSFLAKPIKRPMLKKILLEH 1097

>Kpol_1043.68 s1043 (141962..145090) [3129 bp, 1042 aa] {ON}
            (141962..145090) [3129 nt, 1043 aa]
          Length = 1042

 Score =  988 bits (2555), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 537/1109 (48%), Positives = 712/1109 (64%), Gaps = 92/1109 (8%)

Query: 9    FKPPYRITIRAQLTXXXXXXXXXXXXXXXXTTGVYFTENYKELRSGRLNIAAKLKSSQID 68
            +K PY++ +R QLT                +TGVYFT+NY++LR  +L IAA+LKSSQID
Sbjct: 10   WKAPYKVKLRTQLTTLVCFVAIISLLILAISTGVYFTKNYRDLRLQQLYIAARLKSSQID 69

Query: 69   QTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVARLYD 128
            QT+N L+YQC +LT RD +++AL +Y AGN++ ENW  + +V+  FL SS +F    LYD
Sbjct: 70   QTINLLYYQCVWLTRRDEIESALTDYTAGNRSAENWASTSDVLSTFLESSVVFLTTTLYD 129

Query: 129  LNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLMSMS 188
              F  ++N TNN T D IP++VLS L PLS   SLPS L   G+LTDPVLN S YLMSMS
Sbjct: 130  SQFNLILNETNNETNDYIPDDVLSHLLPLSGTDSLPSYLGTTGLLTDPVLNDSTYLMSMS 189

Query: 189  LPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGKVDGF 248
            LPI+ NPS+ LS SRV+GY+T+VMSA+ ++ V  + TALE S V VIS+   +      +
Sbjct: 190  LPIIANPSVTLSDSRVFGYLTVVMSAETIRAVVNDTTALEKSIVAVISSTNTNGTSGQEY 249

Query: 249  HFVFEVE--NDDFSTLIEYPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYSPCSFS 306
            HFVF     +DD      YP++N T+LS A    + GSI K+K  +++ +AIGY PCSF 
Sbjct: 250  HFVFPPHGASDDIVN-TAYPVENSTFLSDAFSSPEGGSINKSKSLYSKAVAIGYWPCSFG 308

Query: 307  LSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQKATE 366
            L+NWV  V+QPE VF+S S KL KII+GTV+AI VFVC+ITFPLS W+V+PIVRLQKATE
Sbjct: 309  LANWVGTVSQPEHVFMSSSIKLTKIIAGTVIAITVFVCVITFPLSRWSVQPIVRLQKATE 368

Query: 367  LISQGRGLKPXXXXXXXXXXXXXXXWRESVES-HVRASLGIFKSL-------RNNGSNEL 418
            +IS+  G +                 R S +  H  +S  +++ +       + N S E 
Sbjct: 369  VISKRDGNEVHRSNSSSSSRSTFSSNRRSKDGRHNSSSYNLYEDVEKYTEIGKANKSTES 428

Query: 419  QSNDDMNEINERSSKNNSTGDNIKXXXXXXXXXFQRYTTSNLVQARVPVYGRFLQDELSE 478
             S ++   I + SS N+S                      NL   +VP   RF++DELSE
Sbjct: 429  LSKEN---ITDYSSSNSSA----------------IVMRKNLADFQVPASRRFVKDELSE 469

Query: 479  LTDTFNAMTNALDQHYTLLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHELRTPLN 538
            LT+T+  MT+ALD+H  LLE RV+ RTKQL             KTVFIAN++HELRTPLN
Sbjct: 470  LTETYKLMTDALDEHSQLLEYRVKERTKQLEAAKIEAESANEAKTVFIANVTHELRTPLN 529

Query: 539  GILGMTAISMEEDDSDKIKENLKLIFRSGXXXXXXXXXXXXFSKNVLKRTNLEKRDFCIT 598
            GILGMTAI+MEE D ++I+ +LKLI+RSG            FSKNVLK+T LEK  FC+ 
Sbjct: 530  GILGMTAIAMEETDMERIQSSLKLIYRSGELLLHILTELLTFSKNVLKQTKLEKTHFCVI 589

Query: 599  EIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVMNLVSNALKFTPID 658
            ++ALQI+SIFGK+++DQHVKL I ++PN++RSMVLWGD NRI+Q++MNLVSNALKFTP+D
Sbjct: 590  DLALQIESIFGKISKDQHVKLSIFILPNKLRSMVLWGDQNRILQVIMNLVSNALKFTPVD 649

Query: 659  GKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNGKKTDMVRKKIQELSEKDCIEG 718
            GK+ V IKLLGEYD++RS  ++YK+VY+K   E+   NG   D ++  +  +S KD +  
Sbjct: 650  GKITVNIKLLGEYDKDRSAAENYKDVYMK---EIRNSNG---DKIKPLMTLISSKDTM-- 701

Query: 719  DTAXXXXXXXXXXKIDKLIEDEEKNSFSDNEDTNNDIEILSMTTSSTRSYDDAALQRQFK 778
                                     S +DN      I   S+ + + RS ++     +FK
Sbjct: 702  -------------------------SVADN------ISNKSVASDTERSTNNTIYSNKFK 730

Query: 779  KTPDLDDKEETLGVELSEPKTWVISVEVEDTGPGIEPKLQEAVFEPFVQGDQALSRQYGG 838
               +  D ++ +GV L + + WVISVEVEDTGPGIEP LQ++VFEPFVQGDQ LSRQYGG
Sbjct: 731  NGSNFQDTDDAIGVPLDKKRKWVISVEVEDTGPGIEPSLQKSVFEPFVQGDQTLSRQYGG 790

Query: 839  TGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPLKQTREIHFDDEK--FEDEFNAES 896
            TGLGLSICRQLA +MHGTMKLES VGVGSKFIFTVPL QTREI F+  +  FEDEFN  S
Sbjct: 791  TGLGLSICRQLANLMHGTMKLESEVGVGSKFIFTVPLLQTREIEFNGNELVFEDEFNINS 850

Query: 897  KKNRRIKFKIYDSSKSHDSNDEDEEGIKSSRDIDSSNNEHKDENGTSPDNHSKVRLDRPF 956
            KKNR +KF+         +++ D+  I+ +  +     E +    T P   ++       
Sbjct: 851  KKNREVKFQ-------EITDEVDQVNIEGNSGV-----EVEPGKCTEPKKSTESE----- 893

Query: 957  LQSTGTATSSQKIPTLINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACD 1016
             Q+   + SSQ++   I K D    K+ ++L+ EDN VNQ V+ RML LE I+N  +ACD
Sbjct: 894  SQAVVPSKSSQEMGNSI-KYDV---KNFKLLIVEDNKVNQLVVIRMLKLEGIENFTIACD 949

Query: 1017 GQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDN 1076
            GQ+A +K+K +    EYY ++ MD+QMPKVDG+ +TK+IR++L Y  PIVALTAFA+D N
Sbjct: 950  GQEAVEKIKEIQSRGEYYGLVLMDIQMPKVDGITATKIIRQELKYDKPIVALTAFADDSN 1009

Query: 1077 IKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
            I+ C  +GMDGFL KPIKR +LK IL E+
Sbjct: 1010 IQACYKSGMDGFLAKPIKREQLKGILTEF 1038

>Ecym_4020 Chr4 complement(49684..53061) [3378 bp, 1125 aa] {ON}
            similar to Ashbya gossypii AFR284W
          Length = 1125

 Score =  988 bits (2554), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 561/1120 (50%), Positives = 741/1120 (66%), Gaps = 52/1120 (4%)

Query: 2    RQSWRKAFKPPYRITIRAQLTXXXXXXXXXXXXXXXXTTGVYFTENYKELRSGRLNIAAK 61
            R+  +  F+PPY+  +  QLT                TTGVYFT NYK LR+ RL +AA+
Sbjct: 16   RRIRKHMFRPPYKAGLSTQLTILVCIIALCSLIILAVTTGVYFTTNYKSLRADRLTVAAQ 75

Query: 62   LKSSQIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLF 121
            L S+QI+QTLN ++YQC +L+SRD++QNAL++Y+ GN +  N   ++ V+ KFL SS+  
Sbjct: 76   LTSAQINQTLNIIYYQCYWLSSRDSIQNALVSYKVGNTSSLNLDNAKEVLVKFLDSSNSI 135

Query: 122  YVARLYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGS 181
            +   LYD  F +V++ + N TG++I +++L +L PLS+N  LPSS+ +DG+L++PV NGS
Sbjct: 136  FRTHLYDSAFNEVLSVSTNSTGNIIGDDLLRDLLPLSSNSPLPSSIIDDGMLSNPVFNGS 195

Query: 182  IYLMSMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYND 241
             + MSMSLP+    SI+   S   GYIT+VMSAD + +V     AL  S V+V++ +Y++
Sbjct: 196  SFFMSMSLPVSAKASILYPKSDTVGYITMVMSADQVSSVCAGKPALNGSTVSVLAGVYDE 255

Query: 242  QGKVDGFHFVFEVENDDFSTLIE--YPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIG 299
               ++ +  +F         L+E  +PI N ++L +A V   SGS+ KT   +   +A+G
Sbjct: 256  NNILNSYQVLFPPSIVQVPRLLEIVFPIANNSFLYNAFVNRSSGSVSKTNAFYEPNVAVG 315

Query: 300  YSPCSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIV 359
            Y+ CSF L NWVA+V Q EAVFLSPSTKL KII GTV+ IA F+C++TF +++WAVKPIV
Sbjct: 316  YAACSFKLVNWVAVVAQQEAVFLSPSTKLTKIIIGTVIGIAFFICIVTFIVANWAVKPIV 375

Query: 360  RLQKATELISQGRGLKPXXXXXXXXXXXXXXXWRESVES---HVRASLGIFKSLRNNGSN 416
            RLQKATELI+ GRGL+                   S  S    +R   G+ K+   +   
Sbjct: 376  RLQKATELIAAGRGLRSYRHSSRSSSRTTSINRSNSKGSPSPTLREGDGLRKT-PPSPYT 434

Query: 417  ELQSNDDMNE--INERSSKNNSTGDNIKXXXXXXXXXFQRYTTS-NLVQARVPVYGRFLQ 473
             + S+ + N   I    S + +    I+            +TTS N ++ RVPVY R   
Sbjct: 435  PMHSHVEPNPSGIGREYSVDIARAIGIEVPSSHPSERVDAFTTSANWIETRVPVYRRLFS 494

Query: 474  DELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLXXXXXXXXXXXXXKTVFIANISHEL 533
            DELSELTDTFN+MT+ LD+HY LLEDRVRARTKQL             KT+FIANISHEL
Sbjct: 495  DELSELTDTFNSMTDELDRHYALLEDRVRARTKQLEAAKIQAESANEAKTMFIANISHEL 554

Query: 534  RTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGXXXXXXXXXXXXFSKNVLKRTNLEKR 593
            RTPLNGILGMTAI+M E+D +K++ +LKLIFRSG            FSKN+LKR  LE+R
Sbjct: 555  RTPLNGILGMTAIAMAENDMEKVQNSLKLIFRSGELLLHILTELLTFSKNILKRNKLEQR 614

Query: 594  DFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVMNLVSNALK 653
            +F + ++ALQ+KSIFGK+A+DQ+VK  I LMPN IR MVLWGDSNRIIQIVMNLVSNALK
Sbjct: 615  NFSMVDVALQVKSIFGKLAKDQNVKFSIFLMPNLIRKMVLWGDSNRIIQIVMNLVSNALK 674

Query: 654  FTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNGKKTDMVRKKIQELSEK 713
            FTP+DGKV +RIKLLGEYDEE S   +  EV+IK GTE+      +T  V   I E    
Sbjct: 675  FTPVDGKVSLRIKLLGEYDEEESEKCNNAEVFIKQGTEI----SDETKNVFDTITEEKYV 730

Query: 714  DCIEGDTAXXXXXXXXXXKIDKLIEDEEKNSFSDNEDTNNDIEILSMTTSSTRSYDDAAL 773
             C  G++             D  IE  ++ +   ++  N     +S+ +S T SYDDA  
Sbjct: 731  SC-SGEST------------DDTIETGQEGAQKPDKADN-----ISVVSSGTSSYDDAIF 772

Query: 774  QRQFKKTPDLDDKEE----TLGVELSEPKTWVISVEVEDTGPGIEPKLQEAVFEPFVQGD 829
              +FKK P + D +E    ++G +  + K WVIS+EVEDTGPGI+P LQE+VF+PFVQGD
Sbjct: 773  HSRFKKIPAVLDVDEGDLSSIG-KSEKKKVWVISIEVEDTGPGIDPSLQESVFKPFVQGD 831

Query: 830  QALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPLKQTREI--HFDDEK 887
            Q LSRQYGGTGLGLSICRQL+TMM GTMKL S VGVGSKFIFTVPL+QT  +    D++ 
Sbjct: 832  QTLSRQYGGTGLGLSICRQLSTMMKGTMKLHSEVGVGSKFIFTVPLRQTGTVEDLDDEDL 891

Query: 888  FEDEFNAESKKNRRIKFKIYDSSKSHDSNDEDEE--GIKSSRDIDSSNNEHKDENGTSPD 945
            FEDEFNA+SK NRR+KFK+    KS  S+    E  G+      DS  N           
Sbjct: 892  FEDEFNAQSKINRRVKFKLNKGGKSRQSSLSVPEISGVP-----DSPLNSMGRSESEL-- 944

Query: 946  NHSKVRLDRPFLQSTGTATSSQKIPTLINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNL 1005
            + S VR+DRPFLQSTGTATS++ IPT+      ++E + ++LVAEDN+VNQEVIKRML L
Sbjct: 945  SVSSVRVDRPFLQSTGTATSTRSIPTV-----GSLESNFKVLVAEDNNVNQEVIKRMLQL 999

Query: 1006 EKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPI 1065
            E I +I+LACDG++A +KV +L +  ++Y+I+FMDVQMPK+DGL++T+ IRK+LNY +PI
Sbjct: 1000 EGIYDIELACDGEEALEKVANLTNQYDHYNIVFMDVQMPKMDGLIATRNIRKELNYTYPI 1059

Query: 1066 VALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
            VALTAFA+D NIK CL++GMDGFL KPIKR KL++IL EY
Sbjct: 1060 VALTAFADDSNIKVCLESGMDGFLSKPIKREKLRKILLEY 1099

>TPHA0E00250 Chr5 complement(34875..38081) [3207 bp, 1068 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1068

 Score =  971 bits (2509), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 541/1125 (48%), Positives = 716/1125 (63%), Gaps = 89/1125 (7%)

Query: 3    QSWRKAFKPPYRITIRAQLTXXXXXXXXXXXXXXXXTTGVYFTENYKELRSGRLNIAAKL 62
            ++ R A  PPY + +RAQL                 +TGVYFT NYK LR+ +L IAA+L
Sbjct: 4    KNLRLATSPPYPMNLRAQLITLCCIVSIISLLILSISTGVYFTNNYKSLRAEQLFIAAQL 63

Query: 63   KSSQIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFY 122
            KSSQ+DQ+LNYL+YQ  +    D L +ALI Y +GNKT ENW+ES + V  FL+SS +F 
Sbjct: 64   KSSQLDQSLNYLYYQSIWFRDNDVLTDALIRYFSGNKTTENWVESISSVSAFLTSSSIFS 123

Query: 123  VARLYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSI 182
             A +YD NF ++ N +NNGTG  IP++++ +L PLS+++ LP+S+   G LTDPVLN S 
Sbjct: 124  RATIYDTNFMEIYNVSNNGTGAHIPDDIIRQLTPLSSDERLPASIGTIGFLTDPVLNTSN 183

Query: 183  YLMSMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIY-ND 241
            YLMS+SLPI  NPSIILS SRVYGY+TI+  A  +  V+ + TALENSNV +ISA Y N 
Sbjct: 184  YLMSLSLPIFGNPSIILSDSRVYGYVTIITGASSIVAVFNDTTALENSNVAIISAKYRNS 243

Query: 242  QGKVDGFHFVFEVENDDFSTL-IEYPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGY 300
                DG+HFVF     D S + I YP+ N ++L  A  E  +GS+  T + ++  +A+GY
Sbjct: 244  TTYADGYHFVFPPYGSDASVIDIFYPLSNNSFLFDAFTEDTTGSVSSTTFFYSSLVAVGY 303

Query: 301  SPCSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVR 360
            S C+FSL+NWVA+V+QPE+VF S + KL KIISGTVV IA  VC +TF +S++ VKPI++
Sbjct: 304  STCTFSLANWVAVVSQPESVFTSSTVKLTKIISGTVVGIAAVVCFVTFIMSYYIVKPIIK 363

Query: 361  LQKATELISQGRGLKPXXXXXXXXXXXXXXXWRESVESHVRASLGIFKSLRNNGSNELQS 420
            L++ATELIS+GRGL+P                R +++      L       N     L +
Sbjct: 364  LKQATELISRGRGLRPYYENLSDRTSQDNTSTRTTID------LSDLDGYTNEKEKSLPT 417

Query: 421  NDDMNEINERS-SKNNSTGDNI-----KXXXXXXXXXFQRYTTSNLV------QARVPVY 468
              +    +ERS S +N    +I     K             T++N +        RVPV+
Sbjct: 418  CTE----DERSKSLSNIASKSIFTTLRKILGFSSRSGMLSPTSTNFIVNNDTKTVRVPVH 473

Query: 469  GRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLXXXXXXXXXXXXXKTVFIAN 528
              ++ DEL+EL +TFN M ++LD+H  LLE+RV+ARTK+L             KTVFIAN
Sbjct: 474  STYITDELTELKETFNIMADSLDEHSNLLEERVKARTKELEAAKIVAEATNEAKTVFIAN 533

Query: 529  ISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGXXXXXXXXXXXXFSKNVLKRT 588
            ISHELRTPLNGILGMTAI++EEDD++K++ +LKLI+RSG            FSKNVL++T
Sbjct: 534  ISHELRTPLNGILGMTAIALEEDDNEKLQGSLKLIYRSGELLLHILTELLTFSKNVLQKT 593

Query: 589  NLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVMNLV 648
             LEK  FCI +IALQIKSIFGK+A+DQ V   I++ PN IR+MV +GDSNRIIQ++MNLV
Sbjct: 594  KLEKIHFCIHDIALQIKSIFGKIAKDQGVNFSILISPNLIRTMVFFGDSNRIIQVIMNLV 653

Query: 649  SNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNGKKTDMVRKKIQ 708
            SNALKFTPIDG VDVRIKLLGEYDEE+S  ++Y +VYIK GT     N    D +    +
Sbjct: 654  SNALKFTPIDGNVDVRIKLLGEYDEEKSSLNNYDKVYIKEGTSFTGDN----DAI--PTE 707

Query: 709  ELSEKDCIEGDTAXXXXXXXXXXKIDKLIEDEEKNSFSDNEDTNNDIEILSMTTSSTRS- 767
             +S+K    G ++               I D     +    D N++I+    +  ST S 
Sbjct: 708  PISDKISFAGGSSS--------------IHD-----YCSKTDENDNIKTEIKSDDSTISD 748

Query: 768  YDDAALQRQF--KKTPDLDDKEETLGVELSEPKTWVISVEVEDTGPGIEPKLQEAVFEPF 825
            Y +  +   +   K P     +E LGV + +PK WVISV+VEDTGPGI P LQ++VFEPF
Sbjct: 749  YSEENIMGSYYENKNPG----QELLGVPIPKPKKWVISVDVEDTGPGISPTLQKSVFEPF 804

Query: 826  VQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTVPLKQTREIHFD- 884
            VQGDQ LSRQYGGTGLGLSICRQLA++MHGTM+L+ST G+GSKF FTVPL Q R+I F  
Sbjct: 805  VQGDQTLSRQYGGTGLGLSICRQLASIMHGTMELDSTTGLGSKFTFTVPLLQERKIIFSE 864

Query: 885  -DEKFEDEFNAESKKNRRIKFKIYDSSKSHDSNDEDEEGIKSSRDIDSSNNEHKDENGTS 943
             ++ FEDEFN  SKKNR++ FK           D+      +SR I S   E  D+  T+
Sbjct: 865  TEKAFEDEFNFNSKKNRKVNFK----------TDK-----VTSRGIPSKAAEKNDDANTN 909

Query: 944  PDNHSKVRLDRPFLQSTGTATSSQKI--PTLINKEDTNIEKS-IRILVAEDNHVNQEVIK 1000
                          Q+T  A +  K   PT I   + NI++   ++L+ EDN VNQEVIK
Sbjct: 910  G-------------QTTLNAEAKSKTLKPTHITISEDNIDQHDFKVLIVEDNMVNQEVIK 956

Query: 1001 RMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKDLN 1060
            R+L LEKI  I+ A DGQ+A D VK     ++ +DIIFMD+QMP VDG  +T++IR +LN
Sbjct: 957  RLLKLEKIKTIEYAVDGQEAIDIVKKKISEKDKFDIIFMDIQMPNVDGHTATRVIRNELN 1016

Query: 1061 YKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
            Y +PIVALTAFA+D N KEC ++GM+ FL KPIKR +LK+I++E+
Sbjct: 1017 YPYPIVALTAFADDSNKKECENSGMNAFLAKPIKRFELKEIIKEF 1061

>TBLA0E02100 Chr5 (513016..516438) [3423 bp, 1140 aa] {ON} Anc_5.700
            YIL147C
          Length = 1140

 Score =  826 bits (2134), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 502/1143 (43%), Positives = 684/1143 (59%), Gaps = 63/1143 (5%)

Query: 6    RKAFKPPYRITIRAQLTXXXXXXXXXXXXXXXXTTGVYFTENYKELRSGRLNIAAKLKSS 65
            ++  KPPYR ++RAQLT                 TGVYFT +YK+L   RL IA++LKSS
Sbjct: 14   KQTVKPPYRFSLRAQLTILVCIVAIISLTTLAIITGVYFTTHYKDLNVNRLYIASQLKSS 73

Query: 66   QIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVAR 125
            QIDQTLNYL+YQC ++ SR+T+Q  + +   G       IES++V+ KF+ +SDLFY   
Sbjct: 74   QIDQTLNYLYYQCYWVASRNTIQTMVFSNHTGMHNASGIIESQSVLDKFVGTSDLFYYTM 133

Query: 126  LYDLNFKQVVNATNNGTGDLIPNEVLSELFPLS-TNQSLPSSLNNDGILTDPVLNGSIYL 184
            +YD N K ++N+TNN +G  +   +LS L PLS TN ++P  +NN GILTDP+LN + YL
Sbjct: 134  IYDKNLKSIMNSTNNESGSNVEPSILSRLLPLSSTNTTIPPLINNTGILTDPILNSTKYL 193

Query: 185  MSMSLPI---LTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYND 241
            MSMSLPI    +  + I + S +YGY+T+VMSA+ LK+V+ +   L +S   ++SAIY +
Sbjct: 194  MSMSLPISGPYSTATKIGNQSNIYGYLTVVMSAESLKSVFNDTAGLSDSTTALLSAIYTN 253

Query: 242  QGKVDGFHFVFEVENDDFSTLIE-YPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGY 300
                  FHFVF   + D S + E   I+NGT+   A  + KSGS KK K    +  AIGY
Sbjct: 254  DTLPRYFHFVFPPFDLDDSIIDERQTIKNGTFQYRAFDKNKSGSKKKVKLVNKKNYAIGY 313

Query: 301  SPCSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVR 360
            +P +F L  WVA+V  P+  F S S KL KII GTVV IAVFV LI+ PLS+WAV+PIVR
Sbjct: 314  APTNFPLCKWVAVVALPDHQFYSESRKLTKIICGTVVGIAVFVFLISLPLSYWAVQPIVR 373

Query: 361  LQKATELISQGRGLKPXXXXXXXXXXXXXXXWRESVESHVRASLGIFKSLRNNGSNELQS 420
            LQ+A+ELI++ RGL+                  +S + H   S  I        S     
Sbjct: 374  LQRASELITKRRGLRNLNDDSFDDSNDDHTY--DSNDDHTYESKLI-------SSTPTLK 424

Query: 421  NDDMNEINERSSKNNSTGDN------IKXXXXXXXXXFQRY----------TTSNLVQAR 464
            N D N  +E+S +     ++                 F R           + S   + +
Sbjct: 425  NSDSNIHDEKSGRTRGDANSGTLNSNNTITNNTNNKDFNRLRRNVSVSTHVSLSEFDEIQ 484

Query: 465  VPVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLXXXXXXXXXXXXXKTV 524
            VPVY +   DEL+ELTDTFN M+NALD+HY LLE RV  RTKQL             KTV
Sbjct: 485  VPVYRKLFDDELTELTDTFNVMSNALDEHYALLEKRVHQRTKQLEAAKVQAEAANEAKTV 544

Query: 525  FIANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGXXXXXXXXXXXXFSKNV 584
            FIANISHELRTPLNGILGMT+ S+EE+D  KIK+ LKLIFRSG            FSKNV
Sbjct: 545  FIANISHELRTPLNGILGMTSTSLEENDIKKIKDGLKLIFRSGELLLNILTELLTFSKNV 604

Query: 585  LKRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNR-IRSMVLWGDSNRIIQI 643
            L +T LE R+F I EI  QIK+IF K+ + Q VKL I L+P + ++S++ +GDSNRI+Q+
Sbjct: 605  LNKTKLEYREFNIIEITSQIKTIFNKLIQLQEVKLFIRLLPKKFLKSLLFYGDSNRILQV 664

Query: 644  VMNLVSNALKFTP-IDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNGKKTDM 702
            +MNL+SNA+KFTP ++GKV+V + LLGEYDEE S  ++Y +V IK  T++   +G   ++
Sbjct: 665  LMNLISNAIKFTPTVNGKVEVNMYLLGEYDEEESKTENYSKVCIKPSTQIVTESG---EL 721

Query: 703  VRKKIQELSEKDCIEGDTAXXXXXXXXXXKIDKLIE---------------DEEKNSFSD 747
            ++ KI+    K     +TA            ++ +                D  +NS   
Sbjct: 722  IKSKIRCKITKSTTNMNTATTNNSARIESNTNQYLSPYSHTNTRTHTHPGADSRRNS--- 778

Query: 748  NEDTNNDIEILSMTTSSTRSYDDAALQRQFKKTPDLDDKEETLGVELSEPKTWVISVEVE 807
            N  T N+   +S+ + S++ YD+    R  K+  D D  +     ++   K WVI  EV 
Sbjct: 779  NVSTVNN-SSISLDSESSKMYDNLMFNRLIKREGDGDINDIKALEQIEGNKKWVIRFEVI 837

Query: 808  DTGPGIEPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGS 867
            D GPGI+  L ++VF+PFVQGDQ LSRQYGGTGLGLSIC+QL  MM GT++LES +G GS
Sbjct: 838  DNGPGIDQNLHDSVFKPFVQGDQTLSRQYGGTGLGLSICKQLCEMMKGTLELESELGKGS 897

Query: 868  KFIFTVPLKQTREIHFDDEKFEDEFNAESKKNRRIKFKIYDSSKSHDSNDEDEEGIKSSR 927
            KFI+T+PL Q      D++  E++ N  +  +  I   I D+  S  S+ +    + S +
Sbjct: 898  KFIYTIPLLQVGGTKKDNDDNEEDHNDNTNSSVDIDI-IEDTPVSITSSSQTHSDLNSLQ 956

Query: 928  DIDSSNNEHKDENGTSPDNHSKV-RLDRPFLQSTGTATSSQKIPTL----INKEDTNIEK 982
              +S+N    D++ +  +N S V  LD+  LQ   T   +QK+       I+  +  I  
Sbjct: 957  S-NSTNEVGLDDSFSEAENDSTVASLDKSVLQK--TRMDAQKVEANEIDDIDHCNKGIPS 1013

Query: 983  SIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQ 1042
             +++LVAEDN VNQEVIKRML LE I +I+LA DG +AF+KVK    + + YDIIFMD+Q
Sbjct: 1014 KLKVLVAEDNLVNQEVIKRMLKLENISDIELAFDGIEAFEKVKKNLLSYKKYDIIFMDIQ 1073

Query: 1043 MPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQIL 1102
            MPK+DGL ST  IR++L Y+  IVALTAFA++ NIKEC DAGMDGF+ KPIKR  L  +L
Sbjct: 1074 MPKMDGLESTTKIRQELKYEGKIVALTAFADESNIKECRDAGMDGFIEKPIKRVALHTLL 1133

Query: 1103 QEY 1105
            +E+
Sbjct: 1134 EEF 1136

>NDAI0F00310 Chr6 complement(66930..70709) [3780 bp, 1259 aa] {ON}
            Anc_5.700 YIL147C
          Length = 1259

 Score =  774 bits (1998), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 418/731 (57%), Positives = 496/731 (67%), Gaps = 83/731 (11%)

Query: 456  TTSNLVQARVPVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLXXXXXXX 515
            T++NL++ARVP Y R   DELS+LTDTFN MT+ALDQHY LLEDRVRARTKQL       
Sbjct: 522  TSANLIEARVPDYRRLFSDELSDLTDTFNTMTDALDQHYALLEDRVRARTKQLEAAKIEA 581

Query: 516  XXXXXXKTVFIANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGXXXXXXXX 575
                  KTVFIANISHELRTPLNGILGMTAISMEE D  KI+ +LKLIFRSG        
Sbjct: 582  ERANEAKTVFIANISHELRTPLNGILGMTAISMEETDISKIRSSLKLIFRSGELLLHILT 641

Query: 576  XXXXFSKNVLKRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWG 635
                FSKNVLKRT LEKRDFCIT++ALQIKSIFGKVA+DQ VKL I L PN IR+MVL+G
Sbjct: 642  ELLTFSKNVLKRTTLEKRDFCITDVALQIKSIFGKVAKDQRVKLSITLTPNTIRTMVLYG 701

Query: 636  DSNRIIQIVMNLVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTEL--- 692
            DSNRIIQIVMNLVSNALKFTP+DGKV+V++KL+GEYDE  S  +++KEVY+K GTEL   
Sbjct: 702  DSNRIIQIVMNLVSNALKFTPVDGKVNVKVKLIGEYDEALSAKNNFKEVYVKQGTELLGC 761

Query: 693  --PIGNGKKTDMVRKKIQELSEKDCIEGDTAXXXXXXXXXXKIDKLIEDEEKNSFSDNED 750
              PI    ++    K     S       DT             D L  D+EK +  D E+
Sbjct: 762  SNPIEKTNESIPSPKSENNNSSSTTSGKDTTNSETSFEDEKSADDL--DDEKIATKDAEN 819

Query: 751  TNND------------IEILSMTTSSTRSYDDAALQRQFKKTPDL--DDKEETLGVELSE 796
             N D             + +S+ ++ST SYDDA    QFKK+P L  DD+    GV + +
Sbjct: 820  ENTDDTENLDEQTDSVCDNISLVSTSTSSYDDAIFNSQFKKSPGLYDDDENNDAGVLIED 879

Query: 797  PKTWVISVEVEDTGPGIEPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGT 856
            PKTWVI + VEDTGPGI+  LQE+VF+PFVQGDQ LSRQYGGTGLGLSICRQLA MMHGT
Sbjct: 880  PKTWVIQISVEDTGPGIDKTLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGT 939

Query: 857  MKLESTVGVGSKFIFTVPLKQTREIHFDD--EKFEDEFNAESKKNRRIKFKIYDSSKSHD 914
            MKL+S VGVGS F FTVPLKQTREI+FDD    FEDEFN ES+KNR++KFK+  S +S  
Sbjct: 940  MKLKSEVGVGSTFTFTVPLKQTREINFDDMEHPFEDEFNPESRKNRKVKFKLARSIRSKK 999

Query: 915  SN---------------DEDEEGIKS---------------SRDIDSSNNE--HKDEN-- 940
            S                 E+EE IK+                 + ++SNN   H  E+  
Sbjct: 1000 SRASTVTFGTVTDLNHVPENEEEIKNGSQASVGSSGSSSSDGEESNNSNNSTTHHSEDRT 1059

Query: 941  -----------------------GTSPDNHS--KVRLDRPFLQSTGTATSSQKIPTLI-N 974
                                        NH    V LDRPFLQSTGTATSS+ +P L  +
Sbjct: 1060 NTSENTNNNNIHEKEHKHKHEHTHNHSHNHGDYPVSLDRPFLQSTGTATSSRNVPVLSES 1119

Query: 975  KEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYY 1034
             +D +  ++I+ILVAEDNHVNQEVIKRMLNLE ++ IDLACDGQ+AFDKVK+L++  + Y
Sbjct: 1120 NKDEDPAQNIKILVAEDNHVNQEVIKRMLNLEGVNKIDLACDGQEAFDKVKTLSEQNDSY 1179

Query: 1035 DIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIK 1094
            +IIFMDVQMPKVDGL+STKMIRKDL+Y HPIVALTAFA+D NIKECL++GM+GFL KPIK
Sbjct: 1180 NIIFMDVQMPKVDGLLSTKMIRKDLHYDHPIVALTAFADDSNIKECLESGMNGFLSKPIK 1239

Query: 1095 RPKLKQILQEY 1105
            RPKL+ I++EY
Sbjct: 1240 RPKLRTIIKEY 1250

 Score =  479 bits (1234), Expect = e-149,   Method: Compositional matrix adjust.
 Identities = 232/368 (63%), Positives = 285/368 (77%), Gaps = 1/368 (0%)

Query: 9   FKPPYRITIRAQLTXXXXXXXXXXXXXXXXTTGVYFTENYKELRSGRLNIAAKLKSSQID 68
            KPP+RI IRAQLT                TTGVYFT NYK LRS RL IAA+LKSSQID
Sbjct: 9   LKPPFRIGIRAQLTALVSIVACVSLMILAITTGVYFTANYKNLRSDRLYIAAQLKSSQID 68

Query: 69  QTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVARLYD 128
           QTLNYL+YQC Y++SRDTLQ AL NY AGNK+ ENW +S +++QKFLSSS+LF VA++YD
Sbjct: 69  QTLNYLYYQCYYVSSRDTLQYALTNYVAGNKSNENWADSASILQKFLSSSNLFSVAKVYD 128

Query: 129 LNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLMSMS 188
            +F  V+N TNNGTGD IP+ +L++L PLSTN  L SSL   GILTDPVLN S YLMSMS
Sbjct: 129 ASFTTVLNVTNNGTGDQIPDSILAKLLPLSTNIPLSSSLETTGILTDPVLNSSTYLMSMS 188

Query: 189 LPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGKVDGF 248
           LPI  NPS+IL+ SRVYGY+T+VMSA+GL+ V+ + TALE SNV ++SA+YN+   +  +
Sbjct: 189 LPIFANPSVILAESRVYGYLTVVMSAEGLRTVFNDTTALEKSNVAIVSAVYNNVSALTAY 248

Query: 249 HFVFE-VENDDFSTLIEYPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYSPCSFSL 307
            FVF  +    +     Y + NG++LSSAL EGK GS+K TK+ +++ +AIGYSPC+FS 
Sbjct: 249 RFVFAPMGAPSYIINSTYRLTNGSFLSSALREGKGGSLKSTKFFYSKNVAIGYSPCTFSF 308

Query: 308 SNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQKATEL 367
            NWVA+V+Q E+VFLSPSTKL KII+GTVVAI VFV ++TFPL+HWAVKPIVRLQKATEL
Sbjct: 309 VNWVAVVSQAESVFLSPSTKLAKIIAGTVVAIGVFVFIMTFPLAHWAVKPIVRLQKATEL 368

Query: 368 ISQGRGLK 375
           IS+GRGLK
Sbjct: 369 ISEGRGLK 376

>YIL147C Chr9 complement(69791..73453) [3663 bp, 1220 aa] {ON}
            SLN1Histidine kinase osmosensor that regulates a MAP
            kinase cascade; transmembrane protein with an
            intracellular kinase domain that signals to Ypd1p and
            Ssk1p, thereby forming a phosphorelay system similar to
            bacterial two-component regulators
          Length = 1220

 Score =  756 bits (1951), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 414/713 (58%), Positives = 486/713 (68%), Gaps = 67/713 (9%)

Query: 456  TTSNLVQARVPVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLXXXXXXX 515
            T++NL +AR+P Y R   DELS+LT+TFN MT+ALDQHY LLE+RVRARTKQL       
Sbjct: 501  TSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEERVRARTKQLEAAKIEA 560

Query: 516  XXXXXXKTVFIANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGXXXXXXXX 575
                  KTVFIANISHELRTPLNGILGMTAISMEE D +KI+ +LKLIFRSG        
Sbjct: 561  EAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGELLLHILT 620

Query: 576  XXXXFSKNVLKRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWG 635
                FSKNVL+RT LEKRDFCIT++ALQIKSIFGKVA+DQ V+L I L PN IR+MVLWG
Sbjct: 621  ELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWG 680

Query: 636  DSNRIIQIVMNLVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIG 695
            DSNRIIQIVMNLVSNALKFTP+DG VDVR+KLLGEYD+E S    YKEVYIK GTE+   
Sbjct: 681  DSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKELSEKKQYKEVYIKKGTEV-TE 739

Query: 696  NGKKTDMV-------RKKIQELSEKDCIEGDTAXXXXXXXXXXKIDKLIEDEEKNSFSDN 748
            N + TD          +K  +L       G             K + +  +      +D 
Sbjct: 740  NLETTDKYDLPTLSNHRKSVDLESSATSLGSNRDTSTIQEEITKRNTVANESIYKKVNDR 799

Query: 749  EDTNNDIEILSMTTSSTRSYDDAALQRQFKKTPDLDDKE-ETLGVELSEPKTWVISVEVE 807
            E  +ND ++ S+ +++T SYD+A    QF K P  DD+E   LG  +  PKTWVIS+EVE
Sbjct: 800  EKASND-DVSSIVSTTTSSYDNAIFNSQFNKAPGSDDEEGGNLGRPIENPKTWVISIEVE 858

Query: 808  DTGPGIEPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGS 867
            DTGPGI+P LQE+VF PFVQGDQ LSRQYGGTGLGLSICRQLA MMHGTMKLES VGVGS
Sbjct: 859  DTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGS 918

Query: 868  KFIFTVPLKQTREIHFDDEK--FEDEFNAESKKNRRIKFKIYDSSKSHDS---------- 915
            KF FT+PL QT+EI F D +  FEDEFN ES+KNRR+KF +  S KS  S          
Sbjct: 919  KFTFTLPLNQTKEISFADMEFPFEDEFNPESRKNRRVKFSVAKSIKSRQSTSSVATPATN 978

Query: 916  -----NDEDEE----GIKSSRDIDSSN--NEHKDENGT---------------------- 942
                 ND   E    G   ++D+ + N   E K++NG                       
Sbjct: 979  RSSLTNDVLPEVRSKGKHETKDVGNPNMGREEKNDNGGLEQLQEKNIKPSICLTGAEVNE 1038

Query: 943  ----SPDNHSK------VRLDRPFLQSTGTATSSQKIPTLINKEDTNIEKSIRILVAEDN 992
                S  + S+      V LDRPFLQSTGTATSS+ IPT+  K+D   E S++ILV EDN
Sbjct: 1039 QNSLSSKHRSRHEGLGSVNLDRPFLQSTGTATSSRNIPTV--KDDDKNETSVKILVVEDN 1096

Query: 993  HVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVST 1052
            HVNQEVIKRMLNLE I+NI+LACDGQ+AFDKVK L    E Y++IFMDVQMPKVDGL+ST
Sbjct: 1097 HVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLST 1156

Query: 1053 KMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
            KMIR+DL Y  PIVALTAFA+D NIKECL++GM+GFL KPIKRPKLK IL E+
Sbjct: 1157 KMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1209

 Score =  463 bits (1192), Expect = e-143,   Method: Compositional matrix adjust.
 Identities = 233/368 (63%), Positives = 285/368 (77%), Gaps = 3/368 (0%)

Query: 11  PPYRITIRAQLTXXXXXXXXXXXXXXXXTTGVYFTENYKELRSGRLNIAAKLKSSQIDQT 70
           PP+RI IR QLT                TTGVYFT NYK LRS RL IAA+LKSSQIDQT
Sbjct: 13  PPFRIGIRTQLTALVSIVALGSLIILAVTTGVYFTSNYKNLRSDRLYIAAQLKSSQIDQT 72

Query: 71  LNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVARLYDLN 130
           LNYL+YQ  YL SRD LQ++L +Y AGNK+ +NW++S +V+QKFLSSS+LFYVA++YD +
Sbjct: 73  LNYLYYQAYYLASRDALQSSLTSYVAGNKSADNWVDSLSVIQKFLSSSNLFYVAKVYDSS 132

Query: 131 FKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLMSMSLP 190
           F  V+NATNNGTGDLIP +VL  LFPLST+  LPSSL   GILTDPVLN + YLMSMSLP
Sbjct: 133 FNAVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETIGILTDPVLNSTDYLMSMSLP 192

Query: 191 ILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGKVDGFHF 250
           I  NPSIIL+ SRVYGYITI+MSA+GLK+V+ + TALE+S + +ISA+YN QGK  G+HF
Sbjct: 193 IFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEHSTIAIISAVYNSQGKASGYHF 252

Query: 251 VFEV--ENDDFSTLIEYPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYSPCSFSLS 308
           VF       D    + + I+N T++SSA   GK GS+K+T     R  A+GYSPCSF+L 
Sbjct: 253 VFPPYGSRSDLPQKV-FSIKNDTFISSAFRNGKGGSLKQTNILSTRNTALGYSPCSFNLV 311

Query: 309 NWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQKATELI 368
           NWVA+V+QPE+VFLSP+TKL KII+GTV+AI VFV L+T PL+HWAV+PIVRLQKATELI
Sbjct: 312 NWVAIVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIVRLQKATELI 371

Query: 369 SQGRGLKP 376
           ++GRGL+P
Sbjct: 372 TEGRGLRP 379

>Suva_9.41 Chr9 complement(64510..68166) [3657 bp, 1219 aa] {ON}
            YIL147C (REAL)
          Length = 1219

 Score =  745 bits (1923), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 407/713 (57%), Positives = 485/713 (68%), Gaps = 66/713 (9%)

Query: 456  TTSNLVQARVPVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLXXXXXXX 515
            T++NL +AR+P Y R   DELS+LT+TFN MT+ALDQHY LLEDRVRARTKQL       
Sbjct: 501  TSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLEAAKIEA 560

Query: 516  XXXXXXKTVFIANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGXXXXXXXX 575
                  KTVFIANISHELRTPLNGILGMTAISMEE D +KI+ +LKLIFRSG        
Sbjct: 561  EAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGELLLHILT 620

Query: 576  XXXXFSKNVLKRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWG 635
                FSKNVL+RT LEKRDFCIT++ALQIKSIFGKVA+DQ V+L I L PN IR+MVLWG
Sbjct: 621  ELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNFIRTMVLWG 680

Query: 636  DSNRIIQIVMNLVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTEL--P 693
            DSNRIIQIVMNLVSNALKFTP+DG V+VR+KLLGEYD+E S    +KEV+++ GTE+   
Sbjct: 681  DSNRIIQIVMNLVSNALKFTPVDGTVEVRMKLLGEYDKELSEKKQFKEVHVRKGTEIIED 740

Query: 694  IGNGKKTDMVR----KKIQELSEKDCIEGDTAXXXXXXXXXXKIDKLIEDEEKNSFSDNE 749
            IGN  K D  +    KK  +                      K +    +       D E
Sbjct: 741  IGNINKHDAKKSENFKKSMDSESTTTSMTSNRDTSTIQEEITKRNTAANENIYKKTRDRE 800

Query: 750  DTNNDIEILSMTTSSTRSYDDAALQRQFKKTPDLDDKEET-LGVELSEPKTWVISVEVED 808
             ++ND +I S+ ++ST SYDDA    QF K    DD E   LG  +  PKTW IS+EVED
Sbjct: 801  KSSND-DISSIVSTSTSSYDDAIFNSQFNKALGSDDDEGGDLGKPIENPKTWAISIEVED 859

Query: 809  TGPGIEPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSK 868
            TGPGI+P LQE+VF PFVQGDQ LSRQYGGTGLGLSICRQLA MMHGTMKLES VGVGSK
Sbjct: 860  TGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESKVGVGSK 919

Query: 869  FIFTVPLKQTREIHFDDEK--FEDEFNAESKKNRRIKFKIYDSSKSHD------------ 914
            F FT+PL QT+EI F +    FEDEFN ES++NRR+KF +  S KS              
Sbjct: 920  FTFTLPLHQTKEISFANMNFPFEDEFNPESRQNRRVKFNVARSIKSRQSASSIATPTANR 979

Query: 915  ------------SNDED--------EEGIKSSRDIDSSNNEHKDEN-------------- 940
                        SN+E+        EEG +   ++D ++ + +++N              
Sbjct: 980  CGLTNEMLRKSRSNEEEEGRKIINIEEGKEGGNELDEAHQQLQEKNVKNSISFSSADSNE 1039

Query: 941  -GTSPDN-HSK------VRLDRPFLQSTGTATSSQKIPTLINKEDTNIEKSIRILVAEDN 992
              ++P   HS+      V LDRPFLQSTGTATS++ IPT+ N + +  + SI+ILV EDN
Sbjct: 1040 QKSAPSTRHSREESVGSVNLDRPFLQSTGTATSNRNIPTVSNSDKS--DSSIKILVVEDN 1097

Query: 993  HVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVST 1052
            HVNQEVIKRMLNLE I+NI+LACDGQDAFDKVK L    E Y++IFMDVQMPKVDGL+ST
Sbjct: 1098 HVNQEVIKRMLNLEGIENIELACDGQDAFDKVKELTSRGESYNMIFMDVQMPKVDGLLST 1157

Query: 1053 KMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
            KMIR+DL Y  PIVALTAFA+D NIKECL++GM+GFL KPIKRPKLK IL E+
Sbjct: 1158 KMIRRDLGYTSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILIEF 1210

 Score =  476 bits (1225), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 239/377 (63%), Positives = 290/377 (76%), Gaps = 1/377 (0%)

Query: 1   MRQSWRKAFKPPYRITIRAQLTXXXXXXXXXXXXXXXXTTGVYFTENYKELRSGRLNIAA 60
            R   R  F PP+RI+IRAQLT                TTGVYFT NYK LRS RL IAA
Sbjct: 3   FRLPSRSVFTPPFRISIRAQLTALVSIVALISLVILAVTTGVYFTSNYKNLRSDRLYIAA 62

Query: 61  KLKSSQIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDL 120
           +LKSSQIDQTLNYL+YQ  YL SRD LQN+L  Y AGNK+ +NW++S ++VQKFLSSS+L
Sbjct: 63  QLKSSQIDQTLNYLYYQAYYLASRDALQNSLTGYVAGNKSSDNWVDSVSIVQKFLSSSNL 122

Query: 121 FYVARLYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNG 180
           F+VA++YD +F  V+NATNNGTGDLIP ++  ELFPLST+ +LPSSL   GILTDP+LN 
Sbjct: 123 FFVAKVYDSSFTTVLNATNNGTGDLIPKDISDELFPLSTDMALPSSLETTGILTDPILNS 182

Query: 181 SIYLMSMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYN 240
           + YLMSMSLPI  NPSIIL+ SRVYGYITI+MSA+GLK+V+ + TALE SNV +ISA+YN
Sbjct: 183 TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISAVYN 242

Query: 241 DQGKVDGFHFVFEVENDDFS-TLIEYPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIG 299
           +Q K   +HFVF       S T   +PI+N T++SSA   GK GS+KKT     + LA+G
Sbjct: 243 NQSKAYAYHFVFPPYGTSSSITKTIFPIKNNTFISSAFKNGKGGSLKKTNSFGIKNLALG 302

Query: 300 YSPCSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIV 359
           YSPCSF L NWVA+V+QPE+VFLSPSTKL KII+GTV+AI VFV L+T PL+HWAV+PIV
Sbjct: 303 YSPCSFQLVNWVAVVSQPESVFLSPSTKLAKIITGTVIAIGVFVILLTLPLAHWAVQPIV 362

Query: 360 RLQKATELISQGRGLKP 376
           RLQKATELI++GRGL+P
Sbjct: 363 RLQKATELITEGRGLRP 379

>Skud_9.21 Chr9 complement(46872..50537) [3666 bp, 1221 aa] {ON}
            YIL147C (REAL)
          Length = 1221

 Score =  744 bits (1920), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 404/714 (56%), Positives = 482/714 (67%), Gaps = 68/714 (9%)

Query: 456  TTSNLVQARVPVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLXXXXXXX 515
            T++NL +AR+P Y R   DELS+LT+TFN MT+ALDQHY LLEDRVRARTKQL       
Sbjct: 501  TSANLTEARLPDYKRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLEAAKIEA 560

Query: 516  XXXXXXKTVFIANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGXXXXXXXX 575
                  KTVFIANISHELRTPLNGILGMTAISMEE D +KI+ NLKLIFRSG        
Sbjct: 561  EAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNNLKLIFRSGELLLHILT 620

Query: 576  XXXXFSKNVLKRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWG 635
                FSKNVL+RT LE+RDFCIT++ALQIKSIFGKVA+DQ V+L I L PN IR+MVLWG
Sbjct: 621  ELLTFSKNVLQRTKLERRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWG 680

Query: 636  DSNRIIQIVMNLVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELP-- 693
            DSNRIIQIVMNLVSNALKFTP+DG VDVR+KLLGEYD++ S    +KEV++K GTE+   
Sbjct: 681  DSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDSSEKRQFKEVHVKKGTEITDV 740

Query: 694  IGNGKKTDMV----RKKIQELSEKDCIEGDTAXXXXXXXXXXKIDKLIEDEEKNSFSDNE 749
            + +  K D+     R+K   L                     K +    +      +D E
Sbjct: 741  VESIDKRDLPTSLGRRKYVNLESTTASITSCRDNSAIQEEITKRNTAANENIYKKANDRE 800

Query: 750  DTNNDIEILSMTTSSTRSYDDAALQRQFKKTPDLD-DKEETLGVELSEPKTWVISVEVED 808
             ++ND ++ S+ +++T SYDDA    QF K  D D D+   +G  +  PKTWVIS+EVED
Sbjct: 801  KSSND-DVSSIVSTTTSSYDDAIFNSQFNKALDSDSDESGNVGRPIENPKTWVISIEVED 859

Query: 809  TGPGIEPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGSK 868
            TGPGIEP LQE+VF+PFVQGDQ LSRQYGGTGLGLSICRQLA MMHGTMKLES VGVGSK
Sbjct: 860  TGPGIEPSLQESVFQPFVQGDQTLSRQYGGTGLGLSICRQLANMMHGTMKLESQVGVGSK 919

Query: 869  FIFTVPLKQTREIHFDDEK--FEDEFNAESKKNRRIKFKIYDSSKSHDS----------- 915
            F FT+PL QT+EI F + +  FEDEFN ESKKNRR+KF +  S KS  S           
Sbjct: 920  FTFTLPLHQTKEISFANIEFPFEDEFNPESKKNRRVKFSVAKSIKSRQSTSSLTTPVTNS 979

Query: 916  ----ND-------EDEEGIKSSRDIDSSNNEHKDENG----------------------- 941
                ND        DEE ++ +++      E ++ENG                       
Sbjct: 980  NTLANDVLIEARSSDEEEVEKTKNF-IKRKEGENENGKAQQQPQEKNTKHSVSFSSAERS 1038

Query: 942  ----------TSPDNHSKVRLDRPFLQSTGTATSSQKIPTLINKEDTNIEKSIRILVAED 991
                      +  +N   V +DRPFLQSTGTATSS+ +PT+   +      SI+ILV ED
Sbjct: 1039 SQKTVSSKRRSQEENLGSVNIDRPFLQSTGTATSSRNVPTVQGGDKDGT--SIKILVVED 1096

Query: 992  NHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVS 1051
            NHVNQEVI+RMLNLE IDNI+LACDGQ+AFDKVK L    E Y++IFMDVQMPKVDGL+S
Sbjct: 1097 NHVNQEVIRRMLNLEGIDNIELACDGQEAFDKVKELTSKGENYNMIFMDVQMPKVDGLLS 1156

Query: 1052 TKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
            TKMIR+DL YK PIVALTAFA+D NIKECL++GM+GFL KPIKRPKL  IL E+
Sbjct: 1157 TKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLNTILSEF 1210

 Score =  474 bits (1221), Expect = e-147,   Method: Compositional matrix adjust.
 Identities = 241/381 (63%), Positives = 290/381 (76%), Gaps = 9/381 (2%)

Query: 1   MRQSWRKAFKPPYRITIRAQLTXXXXXXXXXXXXXXXXTTGVYFTENYKELRSGRLNIAA 60
            R   R  F PP+RI IRAQLT                TTGVYFT NYK LRS RL IAA
Sbjct: 3   FRLPSRSDFIPPFRIGIRAQLTALVSIVALVSLTILAVTTGVYFTSNYKNLRSDRLYIAA 62

Query: 61  KLKSSQIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDL 120
           +LKSSQ+DQTLNYL+YQ  YL SRD LQ++L +Y AGNK+ +NW++S +VVQKFLSSS+L
Sbjct: 63  QLKSSQVDQTLNYLYYQAYYLASRDALQSSLTSYVAGNKSEDNWVDSLSVVQKFLSSSNL 122

Query: 121 FYVARLYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNG 180
           FYVAR+YD +F  V+NATNNGTGDLIP +VL  LFPLST+  LPSSL   GILTDP++N 
Sbjct: 123 FYVARVYDSSFTTVLNATNNGTGDLIPEDVLDNLFPLSTDIPLPSSLETTGILTDPIVNN 182

Query: 181 SIYLMSMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYN 240
           + YLMSMSLPI  NPSIIL+ SRVYGYITIVMSA+GLK+V+ + TALE SNV +ISA YN
Sbjct: 183 TDYLMSMSLPIFANPSIILTDSRVYGYITIVMSAEGLKSVFNDTTALEKSNVAIISATYN 242

Query: 241 DQGKVDGFHFVFEVENDDFSTLIE-----YPIQNGTYLSSALVEGKSGSIKKTKYPFNRE 295
            QG+  G+HFVF      + TL+      +PI+N T++SS    GK GS+KKT     + 
Sbjct: 243 AQGRASGYHFVFP----PYGTLLSITQRIFPIENNTFISSTFRNGKGGSLKKTNNFGTKN 298

Query: 296 LAIGYSPCSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAV 355
           LA+GYSPCSF L NWVA+V+QPE+VFLSP+TKL KII+GTV+AI VFV L+T PL+HWAV
Sbjct: 299 LALGYSPCSFQLVNWVAVVSQPESVFLSPATKLTKIIAGTVIAIGVFVILLTLPLTHWAV 358

Query: 356 KPIVRLQKATELISQGRGLKP 376
           KPIVRLQKATELI++GRGL+P
Sbjct: 359 KPIVRLQKATELITEGRGLRP 379

>Smik_9.22 Chr9 complement(47449..51141) [3693 bp, 1230 aa] {ON}
            YIL147C (REAL)
          Length = 1230

 Score =  736 bits (1899), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 408/716 (56%), Positives = 478/716 (66%), Gaps = 72/716 (10%)

Query: 456  TTSNLVQARVPVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLXXXXXXX 515
            T++NL +AR+P Y R   DELS+LT+TFN MT+ALDQHY LLEDRVRARTKQL       
Sbjct: 501  TSANLTEARLPDYRRLFSDELSDLTETFNTMTDALDQHYALLEDRVRARTKQLEAAKIEA 560

Query: 516  XXXXXXKTVFIANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGXXXXXXXX 575
                  KTVFIANISHELRTPLNGILGMTAISMEE D +KI+ +LKLIFRSG        
Sbjct: 561  EAANEAKTVFIANISHELRTPLNGILGMTAISMEETDVNKIRNSLKLIFRSGELLLHILT 620

Query: 576  XXXXFSKNVLKRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWG 635
                FSKNVL+RT LEKRDFCIT++ALQIKSIFGKVA+DQ V+L I L PN IR+MVLWG
Sbjct: 621  ELLTFSKNVLQRTKLEKRDFCITDVALQIKSIFGKVAKDQRVRLSISLFPNLIRTMVLWG 680

Query: 636  DSNRIIQIVMNLVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIG 695
            DSNRIIQIVMNLVSNALKFTP+DG VDVR+KLLGEYD++ S    +KEV++K GTE+   
Sbjct: 681  DSNRIIQIVMNLVSNALKFTPVDGTVDVRMKLLGEYDKDLSEKKQFKEVHVKRGTEI--- 737

Query: 696  NGKKTDMVRKKIQELSEKDCIEGDTAXXXXXXXXXXKIDKLIEDEEKNSFSDNEDT---N 752
              + ++   K    +S       D                + E+  K + + NE+     
Sbjct: 738  -TEYSEETNKCDIPISSNHRKHVDLESTTTSITSNRDTSIIQEEITKRNTAANENIYKRM 796

Query: 753  NDIEIL------SMTTSSTRSYDDAALQRQFKKTPDLDDKE-ETLGVELSEPKTWVISVE 805
            ND E L      S+ +++T SYDDA    QF K P  D+ E   LG  +  PKTWVIS+E
Sbjct: 797  NDAEKLSSDDVSSIVSTTTSSYDDAIFNSQFNKAPGSDEDEGGNLGKPIENPKTWVISIE 856

Query: 806  VEDTGPGIEPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGV 865
            VEDTGPGI+P LQE+VF PFVQGDQ LSRQYGGTGLGLSICRQLA MM+GTM+LES VGV
Sbjct: 857  VEDTGPGIDPSLQESVFHPFVQGDQTLSRQYGGTGLGLSICRQLANMMNGTMRLESKVGV 916

Query: 866  GSKFIFTVPLKQTREIHFD--DEKFEDEFNAESKKNRRIKFKIYDSSKSHDSNDE----- 918
            GSKF FT+PL QT+EI F   D  FEDEFN ES+KNRR+KF +  S KS  S        
Sbjct: 917  GSKFTFTLPLPQTKEISFANMDFPFEDEFNPESRKNRRVKFNVAKSIKSRQSTSSIATPA 976

Query: 919  -----------DEEGIKSSRDI---DSSNNEHKDENG----------------------- 941
                        E G K+   I   ++SN + +  NG                       
Sbjct: 977  TNRSSLINDVLPEIGSKNENQIKRFENSNMKREGVNGIGRIEQKLQEKNVKPFICFSSAE 1036

Query: 942  -----TSPDNH-------SKVRLDRPFLQSTGTATSSQKIPTLINKEDTNIEKSIRILVA 989
                 T P  H         V LDRPFLQSTGTATSS+ +PT I   D N + SI+ILV 
Sbjct: 1037 SSEKKTVPPKHRSREESLGSVNLDRPFLQSTGTATSSRNVPT-IQDNDKN-DTSIKILVV 1094

Query: 990  EDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGL 1049
            EDNHVNQEVIKRMLNLE I+NI+LACDGQ+AFDKVK L      Y++IFMDVQMPKVDGL
Sbjct: 1095 EDNHVNQEVIKRMLNLEGIENIELACDGQEAFDKVKELTSKGGNYNMIFMDVQMPKVDGL 1154

Query: 1050 VSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
            +STKMIR+DL YK PIVALTAFA+D NIKECL++GM+GFL KPIKRPKLK IL E+
Sbjct: 1155 LSTKMIRRDLGYKSPIVALTAFADDSNIKECLESGMNGFLSKPIKRPKLKTILTEF 1210

 Score =  470 bits (1209), Expect = e-145,   Method: Compositional matrix adjust.
 Identities = 238/378 (62%), Positives = 293/378 (77%), Gaps = 3/378 (0%)

Query: 1   MRQSWRKAFKPPYRITIRAQLTXXXXXXXXXXXXXXXXTTGVYFTENYKELRSGRLNIAA 60
           +R   +  F PP+RI IRAQLT                TTGVYFT NYK LRS RL IAA
Sbjct: 3   LRLPSKSEFTPPFRIGIRAQLTALVSIVALVSLIILAVTTGVYFTSNYKNLRSDRLYIAA 62

Query: 61  KLKSSQIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDL 120
           +LKSSQIDQTLNYL+YQ  YL SRD LQ++L ++ AGNK+ +NW++S +VVQKFLSSS+L
Sbjct: 63  QLKSSQIDQTLNYLYYQAYYLASRDALQSSLTSFVAGNKSADNWVDSLSVVQKFLSSSNL 122

Query: 121 FYVARLYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNG 180
           FYVA++YD +F  V+NATNNGTGDLIP +VL  LFPLST+  LPSSL   GILTDPV+N 
Sbjct: 123 FYVAKVYDSSFTTVLNATNNGTGDLIPEDVLDSLFPLSTDTPLPSSLETTGILTDPVVNN 182

Query: 181 SIYLMSMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYN 240
           + YLMSMSLPI  NPSIIL+ SRVYGYITI+MSA+GLK+V+ + TALE SNV +ISA+YN
Sbjct: 183 TDYLMSMSLPIFANPSIILTDSRVYGYITIIMSAEGLKSVFNDTTALEKSNVAIISALYN 242

Query: 241 DQGKVDGFHFVFEVENDDFSTLIE--YPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAI 298
           +QGK  G+HF+F       STL +  + I+N T++SSA   GK GS+K+T     + LA+
Sbjct: 243 NQGKASGYHFIFPPYGTA-STLTQSVFSIKNNTFISSAFRNGKGGSLKQTNSFGIKNLAL 301

Query: 299 GYSPCSFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPI 358
           GYSPCSF L NWVA+V+QPE+VFLSP+TKL KII+GTV+AI VFV L+T PL+HWAV+PI
Sbjct: 302 GYSPCSFQLVNWVAVVSQPESVFLSPATKLAKIITGTVIAIGVFVILLTLPLAHWAVQPI 361

Query: 359 VRLQKATELISQGRGLKP 376
           VRLQKATELI++GRGL+P
Sbjct: 362 VRLQKATELITEGRGLRP 379

>TBLA0I01680 Chr9 (372270..375914) [3645 bp, 1214 aa] {ON} Anc_5.700
            YIL147C
          Length = 1214

 Score =  723 bits (1866), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/736 (55%), Positives = 486/736 (66%), Gaps = 99/736 (13%)

Query: 458  SNLVQARVPVYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLXXXXXXXXX 517
            S +++ +VPVY R   DELSELTDTFN M++ALDQHY LLE+RVRARTKQL         
Sbjct: 472  STILETKVPVYRRLFLDELSELTDTFNTMSDALDQHYALLEERVRARTKQLEAAKIEAEA 531

Query: 518  XXXXKTVFIANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGXXXXXXXXXX 577
                KTVFIANISHELRTPLNGILGMTAISMEEDD D IK +LKLIFRSG          
Sbjct: 532  ANEAKTVFIANISHELRTPLNGILGMTAISMEEDDIDNIKSSLKLIFRSGELLLHILTEL 591

Query: 578  XXFSKNVLKRTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDS 637
              FSKNVL+RT LE+RDFCIT++ALQIKSIFGKVA+DQHVKL I L+PN IR++VLWGDS
Sbjct: 592  LTFSKNVLQRTKLEERDFCITDVALQIKSIFGKVAKDQHVKLSIYLIPNEIRTLVLWGDS 651

Query: 638  NRIIQIVMNLVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYIKSGTELPIGNG 697
            NRIIQIVMNLVSNALKFTPIDGKV VR+ LLGEYD+E+S   DYKEV++K+GTE P  N 
Sbjct: 652  NRIIQIVMNLVSNALKFTPIDGKVSVRMSLLGEYDKEKSKAADYKEVFVKTGTE-PEENY 710

Query: 698  KKTDMVRKKIQELSEKDCIEGDTAXXXXXXXXXXKIDKLIEDEEKNSFSDNEDTNN---D 754
             K       +Q+L+ +  I   +A          + ++LI  E+ +  S+N  ++N   D
Sbjct: 711  SKI------LQKLNTEKLIATRSA---RSCDNEERHNELI-GEKNDIISNNHQSSNTTFD 760

Query: 755  IEILSMT--------TSSTRSYDDAALQRQFKKTPDLDDK-EETLGVELSEPKTWVISVE 805
            I I + T        ++ST SYD+     QFKK   L D  EE LGVE+ EPKTWVI +E
Sbjct: 761  ISIHNRTRDDTLSLLSTSTSSYDETVFNDQFKKITGLQDHDEERLGVEIKEPKTWVICIE 820

Query: 806  VEDTGPGIEPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGV 865
            VEDTGPGI P LQE+VFEPFVQGDQALSRQYGGTGLGLSICRQLATMM+GTM LES VG 
Sbjct: 821  VEDTGPGIHPALQESVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMNGTMVLESKVGS 880

Query: 866  GSKFIFTVPLKQTREIHFDD-----EKFEDEFNAESKKNRRIKFKIYDSSKSHDSN---- 916
            GSKF FTVPL QTREI   +     E F+DEFN  SKKNR++KF I  S  +  +N    
Sbjct: 881  GSKFTFTVPLTQTREIVIGEDEDINEFFDDEFNIYSKKNRKVKFAIPSSPGTTLANSSLK 940

Query: 917  -------------------DEDEEGIKSSRDIDSSNNEHKDENGTSPDNHSKV-RLDRPF 956
                               +E EE   +S+DI+SS         TS  N++ +  LDRPF
Sbjct: 941  SRKSKGSLNSSFVGEIQNVNEAEEDAYNSKDINSSGELKIRHISTSTSNNNSIPSLDRPF 1000

Query: 957  LQSTGTATSSQKIPTLI------------------------NKEDTNIEKSI-------- 984
            LQSTGTATS+ KIP L                         N   T I++ +        
Sbjct: 1001 LQSTGTATSTMKIPVLKDFSNSATKDNVTNDEGKSDLSKKGNSGGTIIQEGVTQNNSSII 1060

Query: 985  ----------RILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLAD----- 1029
                      RILV EDNHVNQEVIKRML LEK+ NIDLACDG++A+ KVK +       
Sbjct: 1061 IDEEEEDEGIRILVTEDNHVNQEVIKRMLKLEKLSNIDLACDGEEAYTKVKEITSISNPK 1120

Query: 1030 NEEYYDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFL 1089
             + YYD+IFMDVQMP++DGL STK+IR +L Y  PIVALTAFA++ NIKECLD GMDGFL
Sbjct: 1121 KKNYYDLIFMDVQMPRMDGLESTKLIRSELKYTKPIVALTAFADESNIKECLDVGMDGFL 1180

Query: 1090 GKPIKRPKLKQILQEY 1105
             KPIKRPKLK IL E+
Sbjct: 1181 SKPIKRPKLKDILNEF 1196

>KLTH0E01100g Chr5 complement(106377..109910) [3534 bp, 1177 aa]
           {ON} similar to uniprot|P39928 Saccharomyces cerevisiae
           YIL147C SLN1 Histidine kinase osmosensor that regulates
           a MAP kinase cascade; transmembrane protein with an
           intracellular kinase domain that signals to Ypd1p and
           Ssk1p, thereby forming a phosphorelay system similar to
           bacterial two-component regulators
          Length = 1177

 Score =  688 bits (1776), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/700 (52%), Positives = 472/700 (67%), Gaps = 22/700 (3%)

Query: 6   RKAFKPPYRITIRAQLTXXXXXXXXXXXXXXXXTTGVYFTENYKELRSGRLNIAAKLKSS 65
           ++  KPP+ I+IR QLT                 TGVYFT ++K +R+ RL +A++LK+S
Sbjct: 14  KRKLKPPFLISIRTQLTALVCLVALLSLIILAVITGVYFTSSFKSMRAERLYVASQLKAS 73

Query: 66  QIDQTLNYLFYQCRYLTSRDTLQNALINYEAGNKTYENWIESENVVQKFLSSSDLFYVAR 125
           QIDQ L YL+YQC YL++RD LQNAL  Y AGN T ENW ++   + KFL SS+LF +AR
Sbjct: 74  QIDQNLYYLYYQCYYLSTRDVLQNALTQYLAGNTTTENWADAVTTLDKFLGSSNLFSLAR 133

Query: 126 LYDLNFKQVVNATNNGTGDLIPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLM 185
           +YD +F+ V+NA+NN +G+L+P  VL++LFPLSTN SLPSSL   G+LTDPVLN + YLM
Sbjct: 134 VYDSSFQDVLNASNNASGNLVPESVLTQLFPLSTNVSLPSSLEVKGMLTDPVLNDTGYLM 193

Query: 186 SMSLPILTNPSIILSSSRVYGYITIVMSADGLKNVYLNNTALENSNVTVISAIYNDQGKV 245
           SMSLPI  NPSIILS+S+VYGYIT+V+SA+GLK V+ + TALE+S+V ++S +Y D  ++
Sbjct: 194 SMSLPIFANPSIILSTSKVYGYITVVISAEGLKTVFNDTTALEDSSVILVSTVY-DNREL 252

Query: 246 DGFHFVFEVENDDFSTLIE--YPIQNGTYLSSALVEGKSGSIKKTKYPFNRELAIGYSPC 303
            G+H VF       S +I+  Y I N ++L  A  + K GSIK T + +++ +AIGYSPC
Sbjct: 253 AGYHLVFPPYGMP-SDIIDKRYTIGNDSFLMDAFKQSKGGSIKSTHFLYSKAVAIGYSPC 311

Query: 304 SFSLSNWVALVTQPEAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQK 363
           S  L  WVA++TQPE+ FL PST+L +II GT VAIAV  C +TFPLSHWAV+PIVRLQK
Sbjct: 312 SSDLVQWVAIITQPESKFLYPSTRLARIIVGTCVAIAVVTCAVTFPLSHWAVQPIVRLQK 371

Query: 364 ATELISQGRGLKPXXXXXXXXXXXXXXXWRESVESH---VRASLGIFKSLRN-----NGS 415
           ATE+I+ GRGL+                   S   H   +R S  + +S ++     +  
Sbjct: 372 ATEIITAGRGLRSDNGSTLYSHKRSSTAESFSSALHPASIRRSGSVARSSKHKYIPESAK 431

Query: 416 NELQSNDDMNEINERSSKNNSTGDNIKXXXXXXXXXF--------QRYTTS-NLVQARVP 466
             L  ND   EI     +NN      K         F        +RY TS NL++ARVP
Sbjct: 432 GTLNKND-FEEIQPDGIENNEDAALQKVHSPTPGSLFSEQRSARSERYITSTNLIEARVP 490

Query: 467 VYGRFLQDELSELTDTFNAMTNALDQHYTLLEDRVRARTKQLXXXXXXXXXXXXXKTVFI 526
            Y R   DELSELT+TFN MT+ LD+HY LLEDRVRART+QL             KTVFI
Sbjct: 491 TYNRLFSDELSELTETFNTMTDELDRHYALLEDRVRARTRQLEAAKIEAEGANEAKTVFI 550

Query: 527 ANISHELRTPLNGILGMTAISMEEDDSDKIKENLKLIFRSGXXXXXXXXXXXXFSKNVLK 586
           ANISHELRTPLNGILGMTAI+M E+D  K+K +LKLIFRSG            FSKNVLK
Sbjct: 551 ANISHELRTPLNGILGMTAIAMAENDMQKVKSSLKLIFRSGELLLHIMTELLTFSKNVLK 610

Query: 587 RTNLEKRDFCITEIALQIKSIFGKVARDQHVKLLIILMPNRIRSMVLWGDSNRIIQIVMN 646
           RT LE+RDF + EIALQ++SIFGK+A+DQHV L I ++PN +R+MVLWGDSNRI+QIVMN
Sbjct: 611 RTKLEERDFTVHEIALQVESIFGKLAKDQHVNLTISIIPNVLRTMVLWGDSNRIVQIVMN 670

Query: 647 LVSNALKFTPIDGKVDVRIKLLGEYDEERSMNDDYKEVYI 686
           LVSNALKFTP+DG+V+V+  LLGEYDE ++ N  +    +
Sbjct: 671 LVSNALKFTPVDGRVNVKFTLLGEYDESKASNGCFDRAAV 710

 Score =  402 bits (1033), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 202/363 (55%), Positives = 260/363 (71%), Gaps = 22/363 (6%)

Query: 748  NEDTNNDIEILSMTTSSTRSYDDAALQRQFKKTPDLDDKEETLGVELSEPKTWVISVEVE 807
            NE+ N D    S+ + +  SYDDA    + +K    +  E   G  L  P+   I++EV+
Sbjct: 819  NENQNEDAR--SIESENASSYDDAIFHSRLRKG---NSGENEDGRPLEHPRRLAIAMEVQ 873

Query: 808  DTGPGIEPKLQEAVFEPFVQGDQALSRQYGGTGLGLSICRQLATMMHGTMKLESTVGVGS 867
            DTGPGIEP LQE+VFEPFVQGDQ LSRQYGGTGLGLSICRQLA MM+G+M L+S VGVGS
Sbjct: 874  DTGPGIEPALQESVFEPFVQGDQTLSRQYGGTGLGLSICRQLAAMMNGSMSLDSKVGVGS 933

Query: 868  KFIFTVPLKQTREIHF--DDEKFEDEFNAESKKNRRIKFKIYDSSKSHDSNDEDEEGIKS 925
            KF FTVPL QT+E+ F  D+  FEDEFN +SKKNR++KFK+   SK++            
Sbjct: 934  KFTFTVPLTQTKELCFEEDENPFEDEFNPDSKKNRKVKFKV---SKNNKRKKSHSSSSGQ 990

Query: 926  SRDIDSSNNEHKDENGTSPDNHSKVRLDRPFLQSTGTATSSQKIPTLINKEDTNIEKSIR 985
            +  + +      + +  S      VR+DRPFLQSTGTA S++ + T      T++    +
Sbjct: 991  NSSVGTPTVSESEVSVGS------VRVDRPFLQSTGTALSTRSVTT------TSVANKCK 1038

Query: 986  ILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPK 1045
            +LVAEDN+VNQEVIKRMLNLE +D++DLACDGQDAFDKVK+  +  ++YD+IFMDVQMP+
Sbjct: 1039 VLVAEDNNVNQEVIKRMLNLEGLDDVDLACDGQDAFDKVKARNEAGKFYDLIFMDVQMPR 1098

Query: 1046 VDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
            VDGL +T+MIR +L+Y HPIVALTA+A+D NIKEC+DAGM+GFL KPI+RPK+K+IL EY
Sbjct: 1099 VDGLSATRMIRNELSYTHPIVALTAYADDRNIKECIDAGMNGFLAKPIRRPKIKEILSEY 1158

Query: 1106 IDT 1108
              T
Sbjct: 1159 CPT 1161

>TPHA0C00150 Chr3 complement(15029..16561) [1533 bp, 510 aa] {ON}
            Anc_4.385 YJR147W
          Length = 510

 Score = 65.5 bits (158), Expect = 5e-10,   Method: Compositional matrix adjust.
 Identities = 38/131 (29%), Positives = 69/131 (52%), Gaps = 9/131 (6%)

Query: 977  DTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEY-YD 1035
            DT ++K   +L+ ED+ V+ ++  + L       I   C  Q   D + +++  E+Y +D
Sbjct: 343  DTILKKGFNVLLVEDDEVSIQLCSKFL-------IKYGCTVQVVTDGLAAISTLEKYRFD 395

Query: 1036 IIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKR 1095
            ++ MD+ MP +DG  +T +IR + + + PI+A+T      ++   L  GM+  L KP  R
Sbjct: 396  LVLMDIVMPNLDGATATSIIR-NFDNETPIIAMTGSIEHQDLITYLQHGMNDILAKPFTR 454

Query: 1096 PKLKQILQEYI 1106
              L  +L  Y+
Sbjct: 455  RDLYSMLTRYL 465

>YHR206W Chr8 (512732..514600) [1869 bp, 622 aa] {ON}  SKN7Nuclear
            response regulator and transcription factor; physically
            interacts with the Tup1-Cyc8 complex and recruits Tup1p
            to its targets; part of a branched two-component
            signaling system; required for optimal induction of
            heat-shock genes in response to oxidative stress;
            involved in osmoregulation
          Length = 622

 Score = 64.3 bits (155), Expect = 1e-09,   Method: Compositional matrix adjust.
 Identities = 42/158 (26%), Positives = 76/158 (48%), Gaps = 18/158 (11%)

Query: 959  STGTATSSQKIPTLINKED---------TNIEKSIRILVAEDNHVNQEVIKRMLNLEKID 1009
            S  T+T S ++P L ++             + K   +L+ ED+ V+ ++  + L      
Sbjct: 343  SPATSTVSLQLPNLPDQNSLTPNAQNNTVTLRKGFHVLLVEDDAVSIQLCSKFLR----- 397

Query: 1010 NIDLACDGQDAFDKVKSLADNEEY-YDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVAL 1068
                 C  Q   D + +++  E+Y YD++ MD+ MP +DG  +T ++R   + + PI+A+
Sbjct: 398  --KYGCTVQVVSDGLSAISTLEKYRYDLVLMDIVMPNLDGATATSIVRS-FDNETPIIAM 454

Query: 1069 TAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEYI 1106
            T    + ++   L  GM+  L KP  R  L  IL  Y+
Sbjct: 455  TGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRYL 492

>Smik_8.296 Chr8 (487452..489329) [1878 bp, 625 aa] {ON} YHR206W
            (REAL)
          Length = 625

 Score = 63.5 bits (153), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 48/194 (24%), Positives = 93/194 (47%), Gaps = 16/194 (8%)

Query: 914  DSNDEDEEGIKSSRDIDSSNNEHKDENGTSPDNHSKVRLDRPFLQSTGTATSSQKIPTLI 973
            D+ +++  G  ++R   ++ + + + N  SP   S V L  P L    + T + +  T+ 
Sbjct: 316  DNGNQNSAGNANNRMSTAAIHSNNNTNNASPA-ASTVSLQLPNLPDENSLTPNAQGTTVT 374

Query: 974  NKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEY 1033
                  + K   +L+ ED+ V+ ++  + L           C  Q   D + +++  E++
Sbjct: 375  ------LRKGFHVLLVEDDAVSIQLCSKFLR-------KYGCTVQVVTDGLSAISTLEKF 421

Query: 1034 -YDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKP 1092
             YD++ MD+ MP +DG  +T ++R   + + PI+A+T    + ++   L  GM+  L KP
Sbjct: 422  RYDLVLMDIVMPNLDGATATSIVRS-FDNETPIIAMTGNIMNQDLITYLQHGMNDILAKP 480

Query: 1093 IKRPKLKQILQEYI 1106
              R  L  IL  Y+
Sbjct: 481  FTRDDLHSILIRYL 494

>ADL388W Chr4 (30355..31803) [1449 bp, 482 aa] {ON} Syntenic homolog
            of Saccharomyces cerevisiae YHR206W (SKN7) and YJR147W
            (HMS2)
          Length = 482

 Score = 63.2 bits (152), Expect = 2e-09,   Method: Compositional matrix adjust.
 Identities = 44/162 (27%), Positives = 78/162 (48%), Gaps = 19/162 (11%)

Query: 954  RPFLQSTGTATS-----SQKIPTLINKEDTNIEKSIR----ILVAEDNHVNQEVIKRMLN 1004
            +P +   GT        +Q  P+   KE+ N   S+R    +L+ ED+ V  ++  + L 
Sbjct: 282  QPHVSPLGTVAPTSIPLAQATPS---KEEANPPTSLRPGFHVLLVEDDSVCIQLCSKFLR 338

Query: 1005 LEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRKDLNYKHP 1064
                 ++++  DG  A + V+        YD++ MD+ MP +DG  +T +IR   + + P
Sbjct: 339  KYGC-SVEVVTDGLSAIETVEKFQ-----YDLVLMDIVMPNLDGATATSVIR-SFDNQTP 391

Query: 1065 IVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEYI 1106
            I+A+T    D ++   L  GM+  L KP  +  L  +L  Y+
Sbjct: 392  IIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLVRYL 433

>Skud_8.273 Chr8 (481627..483498) [1872 bp, 623 aa] {ON} YHR206W
            (REAL)
          Length = 623

 Score = 62.8 bits (151), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 77/158 (48%), Gaps = 18/158 (11%)

Query: 959  STGTATSSQKIPTLINKED---------TNIEKSIRILVAEDNHVNQEVIKRMLNLEKID 1009
            S  T+T S ++P+L ++             + K   +L+ ED+ V+ ++  + L      
Sbjct: 345  SPATSTVSLQLPSLPDENSLTPNAQANTVTLRKGFHVLLVEDDVVSIQLCSKFLR----- 399

Query: 1010 NIDLACDGQDAFDKVKSLADNEEY-YDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVAL 1068
                 C  Q   D + +++  E++ YD++ MD+ MP +DG  +T ++R   + + PI+A+
Sbjct: 400  --KYGCTVQVVTDGLSAISTLEKFRYDLVLMDIVMPNLDGATATSIVRS-FDNETPIIAM 456

Query: 1069 TAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEYI 1106
            T    + ++   L  GM+  L KP  R  L  IL  Y+
Sbjct: 457  TGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRYL 494

>CAGL0F09097g Chr6 (898706..900598) [1893 bp, 630 aa] {ON} similar to
            uniprot|P38889 Saccharomyces cerevisiae YHR206w SKN7
            transcription factor
          Length = 630

 Score = 62.4 bits (150), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 66/128 (51%), Gaps = 9/128 (7%)

Query: 980  IEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEY-YDIIF 1038
            + K   +L+ ED+ V+ ++  + L           C  Q   D + ++++ E++ YD++ 
Sbjct: 401  LRKGFHVLLVEDDSVSIQLCSKFLR-------KYGCTVQVVTDGLSAISNLEKFRYDLVL 453

Query: 1039 MDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKL 1098
            MD+ MP +DG  +T ++R   + + PI+A+T    D ++   L  GM+  L KP  R  L
Sbjct: 454  MDIVMPNLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRNDL 512

Query: 1099 KQILQEYI 1106
              IL  ++
Sbjct: 513  HSILIRHL 520

>Suva_15.412 Chr15 (719438..721291) [1854 bp, 617 aa] {ON} YHR206W
            (REAL)
          Length = 617

 Score = 61.6 bits (148), Expect = 8e-09,   Method: Compositional matrix adjust.
 Identities = 41/158 (25%), Positives = 76/158 (48%), Gaps = 18/158 (11%)

Query: 959  STGTATSSQKIPTLINKED---------TNIEKSIRILVAEDNHVNQEVIKRMLNLEKID 1009
            S  T+T S ++P L ++             + K   +L+ ED+ V+ ++  + L      
Sbjct: 344  SPTTSTVSLQMPNLPDENSLTPNAQGNAVTLRKGFHVLLVEDDAVSIQLCSKFLR----- 398

Query: 1010 NIDLACDGQDAFDKVKSLADNEEY-YDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVAL 1068
                 C  Q   D + +++  E++ YD++ MD+ MP +DG  +T ++R   + + PI+A+
Sbjct: 399  --KYGCTVQVVTDGLSAISTLEKFRYDLVLMDIVMPNLDGATATSIVRS-FDNETPIIAM 455

Query: 1069 TAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEYI 1106
            T    + ++   L  GM+  L KP  R  L  IL  Y+
Sbjct: 456  TGNIMNQDLITYLQHGMNDILAKPFTRDDLHSILIRYL 493

>TDEL0D00320 Chr4 complement(53243..54886) [1644 bp, 547 aa] {ON}
            Anc_4.385 YJR147W
          Length = 547

 Score = 60.8 bits (146), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 38/144 (26%), Positives = 73/144 (50%), Gaps = 10/144 (6%)

Query: 965  SSQKIPTLINKEDTNIEK-SIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDK 1023
            ++ K P  ++  DT++ K    +L+ ED+ V  ++  + L           C  +   D 
Sbjct: 314  TASKPPGGLDTNDTSVLKEGFHVLLVEDDAVCIQLCSKFLR-------KYGCTVEVVTDG 366

Query: 1024 VKSLADNEEY-YDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLD 1082
            + +++  E++ YD++ MD+ MP +DG  +T ++R   N+  PI+A+T    D ++   L 
Sbjct: 367  LSAISTLEKFRYDLVLMDIVMPNLDGATATSIVRSFDNHT-PIIAMTGNIEDQDLITYLQ 425

Query: 1083 AGMDGFLGKPIKRPKLKQILQEYI 1106
             GM+  L KP  +  L  +L  Y+
Sbjct: 426  HGMNDILAKPFTKDDLHSMLIRYL 449

>KAFR0B06990 Chr2 (1455520..1457157) [1638 bp, 545 aa] {ON} Anc_4.385
            YJR147W
          Length = 545

 Score = 60.5 bits (145), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 65/128 (50%), Gaps = 9/128 (7%)

Query: 980  IEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEY-YDIIF 1038
            + K   +L+ ED+ ++ ++  + L           C  +   D + +++  E++ YD++ 
Sbjct: 349  LRKGFHVLLVEDDAISIQLCSKFLR-------KYGCTVEVVTDGLSAISTLEKFRYDLVL 401

Query: 1039 MDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKL 1098
            MD+ MP +DG  +T +IR   + + PI+A+T    D ++   L  GM+  L KP  R  L
Sbjct: 402  MDIVMPNLDGATATSIIRS-FDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTRDDL 460

Query: 1099 KQILQEYI 1106
              +L  Y+
Sbjct: 461  HSMLIRYL 468

>Kpol_265.2 s265 (9842..11491) [1650 bp, 549 aa] {ON} (9842..11491)
            [1650 nt, 550 aa]
          Length = 549

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 66/128 (51%), Gaps = 9/128 (7%)

Query: 980  IEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEY-YDIIF 1038
            ++K   +L+ ED+ V+ ++  + L           C  Q   D + +++  E++ +D++ 
Sbjct: 378  LKKGFHVLLVEDDDVSIQLCSKFLR-------KYGCTVQVVTDGLAAISILEKFRFDLVL 430

Query: 1039 MDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKL 1098
            MD+ MP +DG  +T +IR + + + PI+A+T      ++   L  GM+  L KP  R  L
Sbjct: 431  MDIVMPNLDGATATSIIR-NFDNRTPIIAMTGSIEHQDLITYLQHGMNDILAKPFTRKDL 489

Query: 1099 KQILQEYI 1106
              IL  Y+
Sbjct: 490  YSILIRYL 497

>YLR006C Chr12 complement(161755..163893) [2139 bp, 712 aa] {ON}
            SSK1Cytoplasmic response regulator; part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism; required for mitophagy;
            dephosphorylated form is degraded by the
            ubiquitin-proteasome system; potential Cdc28p substrate
          Length = 712

 Score = 59.7 bits (143), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 58/237 (24%), Positives = 100/237 (42%), Gaps = 44/237 (18%)

Query: 903  KFKIYDSSKSHDSNDEDEEGIKSSRDIDSSNNEHKDENGTSP-------DNHSKVRLDRP 955
            + ++   S S +S   +E GI  ++ +       +D    SP        ++S    + P
Sbjct: 420  ELEVNTGSPSQESGSLNEAGIGITQPMSEVQRRKEDVTPASPILTSSQTPHYSNSLYNAP 479

Query: 956  FLQSTGTATSSQKIPTLINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLAC 1015
            F      ++    +P L       +   I +L+ EDN +NQ ++   L   KI +  LA 
Sbjct: 480  F----AVSSPPDPLPNLFTTTSEKVFPKINVLIVEDNVINQAILGSFLRKHKI-SYKLAK 534

Query: 1016 DGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIR-----------KDLNYKHP 1064
            +GQ+A +  K     E    +IFMD+Q+P + G+ + K IR           K LN  H 
Sbjct: 535  NGQEAVNIWK-----EGGLHLIFMDLQLPVLSGIEAAKQIRDFEKQNGIGIQKSLNNSHS 589

Query: 1065 ----------------IVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
                            IVALTA  +  + ++ L +G + +L KP+    L + + E+
Sbjct: 590  NLEKGTSKRFSQAPVIIVALTASNSQMDKRKALLSGCNDYLTKPVNLHWLSKKITEW 646

>KNAG0M00180 Chr13 complement(22500..24347) [1848 bp, 615 aa] {ON}
            Anc_4.385 YJR147W
          Length = 615

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 35/128 (27%), Positives = 63/128 (49%), Gaps = 9/128 (7%)

Query: 980  IEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNE-EYYDIIF 1038
            + K   +L+ ED+ ++ ++  + L           C  Q   D + ++   E   YD++ 
Sbjct: 399  LRKGFHVLLVEDDAISIQLCSKFLR-------KYGCTVQVVTDGLSAITTLENSRYDLVL 451

Query: 1039 MDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKL 1098
            MD+ MP +DG  +T +IR   + + PI+A+T   +D ++   L  GM+  L KP  R  L
Sbjct: 452  MDIVMPNLDGATATSIIRS-FDNQTPIIAMTGNIDDGDLITYLQHGMNDILAKPFTRDDL 510

Query: 1099 KQILQEYI 1106
              +L  Y+
Sbjct: 511  HSMLIRYL 518

>SAKL0B12408g Chr2 (1065161..1066558) [1398 bp, 465 aa] {ON} similar
            to uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and
            weakly similar to YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 465

 Score = 59.3 bits (142), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 65/128 (50%), Gaps = 9/128 (7%)

Query: 980  IEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEY-YDIIF 1038
            +     +L+ ED+ V  ++  + L       +   C  +   D + +++  E++ YD++ 
Sbjct: 303  LRPGFHVLLVEDDSVCIQLCSKFL-------LKYGCSVEVVTDGLSAISTLEKFRYDLVL 355

Query: 1039 MDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKL 1098
            MD+ MP +DG  +T ++R   + + PI+A+T    D ++   L+ GM+  L KP  +  L
Sbjct: 356  MDIVMPNLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLEHGMNDILAKPFTKDDL 414

Query: 1099 KQILQEYI 1106
              +L  Y+
Sbjct: 415  HSMLIRYL 422

>Ecym_7474 Chr7 (967242..968732) [1491 bp, 496 aa] {ON} similar to
            Ashbya gossypii ADL388W
          Length = 496

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 34/121 (28%), Positives = 62/121 (51%), Gaps = 7/121 (5%)

Query: 986  ILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPK 1045
            +L+ ED+ V  ++  + L      ++++  DG  A + V+        YD++ MD+ MP 
Sbjct: 331  VLLVEDDSVCIQLCSKFLRKYGC-SVEVVTDGLSAIETVEKFQ-----YDLVLMDIVMPN 384

Query: 1046 VDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
            +DG  +T +IR   + + PI+A+T    D ++   L  GM+  L KP  +  L  +L  Y
Sbjct: 385  LDGATATSVIR-SFDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRY 443

Query: 1106 I 1106
            +
Sbjct: 444  L 444

>KLTH0D17182g Chr4 complement(1424948..1426342) [1395 bp, 464 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 464

 Score = 58.9 bits (141), Expect = 4e-08,   Method: Compositional matrix adjust.
 Identities = 42/174 (24%), Positives = 80/174 (45%), Gaps = 10/174 (5%)

Query: 934  NEHKDENGTSPDNHSKVRLDRPFLQSTGTATSSQKIPTLINKEDTNIEKSIRILVAEDNH 993
            N H  +N  SP   S V        ST  +  +   P +I  +   +     +L+ ED+ 
Sbjct: 256  NTHTIKNTQSPQMSSAVPTLSVRKPSTMDSNPASTTPNMI-LDHPILRPGFHVLLVEDDS 314

Query: 994  VNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEY-YDIIFMDVQMPKVDGLVST 1052
            +  ++  + L       +   C  +   D + +++  E++ YD++ MD+ MP +DG  +T
Sbjct: 315  ICIQLCSKFL-------MKYGCTVEVVTDGLSAISTLEKFRYDLVLMDIVMPNLDGATAT 367

Query: 1053 KMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEYI 1106
             ++R   + + PI+A+T    D ++   L  GM+  L KP  +  L  +L  Y+
Sbjct: 368  SIVRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRYL 420

>NCAS0A06450 Chr1 (1273459..1275288) [1830 bp, 609 aa] {ON} Anc_4.385
          Length = 609

 Score = 58.9 bits (141), Expect = 6e-08,   Method: Compositional matrix adjust.
 Identities = 45/183 (24%), Positives = 86/183 (46%), Gaps = 18/183 (9%)

Query: 940  NGTSPDNHSKVRLDRPFLQSTGTAT---SSQKIPTLINKEDTNIEKSIRILVAEDNHVNQ 996
            NG++P    K  +  P     G A    S+  +P   N     +  SI+ L  E N+  Q
Sbjct: 316  NGSAPTQQQKPPIQSPTGSVIGPALPLLSTPTLPLATNGPQAAMRASIK-LENEPNNEAQ 374

Query: 997  EVIKRMLNLEKIDNIDLA------------CDGQDAFDKVKSLADNEEY-YDIIFMDVQM 1043
             V++   ++  +++  ++            C  +   D + +++  E++ YD++ MD+ M
Sbjct: 375  AVLRPGFHVLLVEDDAVSIRLCSKFLRKYGCTVEVVTDGLSAISTLEKFRYDLVLMDIVM 434

Query: 1044 PKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQ 1103
            P +DG  +T +IR + + + PI+A+T    D ++   L  GM+  L KP  +  L  +L 
Sbjct: 435  PNLDGATATSIIR-NFDNQTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDLHSMLI 493

Query: 1104 EYI 1106
             Y+
Sbjct: 494  RYL 496

>TDEL0E03980 Chr5 (741644..743836) [2193 bp, 730 aa] {ON} Anc_5.230
            YLR006C
          Length = 730

 Score = 58.5 bits (140), Expect = 7e-08,   Method: Compositional matrix adjust.
 Identities = 55/187 (29%), Positives = 89/187 (47%), Gaps = 29/187 (15%)

Query: 942  TSPDNHSKVRLDRPFLQSTGTATSS---QKIPTLINKEDTNIEKSIRILVAEDNHVNQEV 998
             SPD  ++     P L S   +T+S    ++P  +   +  I   I +L+ EDN +NQ +
Sbjct: 456  ASPDLPNRPETVVPTLPSRLPSTTSLQKGQLPWGLITANHEIFPKITVLIVEDNVINQAI 515

Query: 999  IKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIR-- 1056
            ++  L   KI +  +A +GQ+A D+ K     E   D+IFMD+Q+P   G+ + K IR  
Sbjct: 516  LRSFLKKHKI-SYKVAKNGQEAVDRWK-----EGGIDLIFMDLQLPVFSGMDAAKKIRDL 569

Query: 1057 KDLNY----------------KHP--IVALTAFANDDNIKECLDAGMDGFLGKPIKRPKL 1098
            + LN                 K P  IVA TA     + +E L +G + +L KP+    L
Sbjct: 570  EKLNASSETLPDSKEGDKKRSKAPVIIVAFTASNTRADKREALLSGCNDYLTKPVNLHWL 629

Query: 1099 KQILQEY 1105
             + + E+
Sbjct: 630  SKKINEW 636

>TBLA0A10700 Chr1 (2646036..2647799) [1764 bp, 587 aa] {ON} Anc_4.385
            YJR147W
          Length = 587

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 63/127 (49%), Gaps = 7/127 (5%)

Query: 980  IEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFM 1039
            + K   +L+ ED+ V  ++  + L       + +  DG  A     S+ +N  + D++ M
Sbjct: 412  LRKGFHVLLVEDDEVCIQLCSKFLRKYGC-TVRVVTDGLTAI----SVLENHRF-DLVLM 465

Query: 1040 DVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLK 1099
            D+ MP +DG  +T ++R   NY  PI+A+T    D ++   L  GM+  L KP  +  L 
Sbjct: 466  DIVMPNLDGATATSIVRNFDNYT-PIIAMTGNIEDQDLITYLQHGMNDILAKPFTKRDLH 524

Query: 1100 QILQEYI 1106
             +L  Y+
Sbjct: 525  SMLVRYL 531

>NDAI0D03430 Chr4 (809977..811770) [1794 bp, 597 aa] {ON} Anc_4.385
          Length = 597

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 34/127 (26%), Positives = 64/127 (50%), Gaps = 7/127 (5%)

Query: 980  IEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFM 1039
            + K   +L+ ED+ V+ ++  + L       +++  DG  A   +++       YD++ M
Sbjct: 420  LRKGYHVLLVEDDAVSIQLCSKFLRKSGC-TVEVVTDGLAAISILEAFR-----YDLVLM 473

Query: 1040 DVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLK 1099
            D+ MP +DG  +T +IR + + + PI+A+T    D ++   L  GM   L KP  R  L 
Sbjct: 474  DIVMPNLDGATATSIIR-NFDKETPIIAMTGNIEDQDLITYLQHGMTDILAKPFTRDDLL 532

Query: 1100 QILQEYI 1106
             +L  ++
Sbjct: 533  SMLIRHL 539

>Ecym_5077 Chr5 (166792..169179) [2388 bp, 795 aa] {ON} similar to
            Ashbya gossypii ADR343C
          Length = 795

 Score = 57.8 bits (138), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 45/164 (27%), Positives = 79/164 (48%), Gaps = 34/164 (20%)

Query: 970  PTLINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLAD 1029
            P+ I +    +   I +L+ EDN +NQ ++   L   +I + ++A +G +A +K +    
Sbjct: 535  PSPIKRTRDKVFPKINVLIVEDNIINQAILVSFLKRHRI-SYEIAKNGAEAVEKWR---- 589

Query: 1030 NEEYYDIIFMDVQMPKVDGLVSTKMIRK-----------------------DLN---YKH 1063
             +    +I MD+Q+P + GL +TK IR                        DL+   ++ 
Sbjct: 590  -QGGIHLILMDLQLPLLSGLEATKQIRDMEKLNGINKFHKSDLKPGRDTSLDLDRSKFRS 648

Query: 1064 P--IVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
            P  IVALTAF++  + +E L AG + +L KP+    L   + E+
Sbjct: 649  PVIIVALTAFSSHADRREALVAGCNDYLTKPVNLDWLSSKITEW 692

>Kwal_47.16770 s47 (103208..104593) [1386 bp, 461 aa] {ON} YHR206W
            (SKN7) - transcription factor involved in oxidative
            stress response [contig 376] FULL
          Length = 461

 Score = 57.4 bits (137), Expect = 1e-07,   Method: Compositional matrix adjust.
 Identities = 31/128 (24%), Positives = 65/128 (50%), Gaps = 9/128 (7%)

Query: 980  IEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEY-YDIIF 1038
            +     +L+ ED+ +  ++  + L       +  AC  +   D + +++  E++ +D++ 
Sbjct: 298  LRPGFHVLLVEDDSICIQLCSKFL-------MKYACTVEVVTDGLSAISTLEKFRFDLVL 350

Query: 1039 MDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKL 1098
            MD+ MP +DG  +T ++R   + + PI+A+T    D ++   L  GM+  L KP  +  L
Sbjct: 351  MDIVMPNLDGATATSIVRS-FDNQTPIIAMTGNIEDQDLVTYLQHGMNDILAKPFTKDDL 409

Query: 1099 KQILQEYI 1106
              +L  Y+
Sbjct: 410  HSMLIRYL 417

>KNAG0B05140 Chr2 (985361..987307) [1947 bp, 648 aa] {ON} Anc_5.230
            YLR006C
          Length = 648

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 41/134 (30%), Positives = 72/134 (53%), Gaps = 13/134 (9%)

Query: 979  NIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIF 1038
            N+   I +L+ EDN +NQ ++   L   KI +  +A +G++A D  K     E    +IF
Sbjct: 512  NVFPKINVLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKEAVDIWK-----EGGLHLIF 565

Query: 1039 MDVQMPKVDGLVSTKMIR-----KDLNYKHP--IVALTAFANDDNIKECLDAGMDGFLGK 1091
            MD+Q+P + G+ + K IR     +  +   P  IVALTA  + ++ ++ L +G + +L K
Sbjct: 566  MDLQLPVLSGIDAAKQIRDCEKKRTASQNAPVIIVALTASNSIEDKRKALISGCNDYLTK 625

Query: 1092 PIKRPKLKQILQEY 1105
            P+    L + + E+
Sbjct: 626  PVNLHWLSKKITEW 639

>ZYRO0G00484g Chr7 complement(35793..37736) [1944 bp, 647 aa] {ON}
            similar to uniprot|P38889 Saccharomyces cerevisiae
            YHR206W
          Length = 647

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 32/128 (25%), Positives = 63/128 (49%), Gaps = 9/128 (7%)

Query: 980  IEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEY-YDIIF 1038
            + +   +L+ ED+ V  ++  + L           C  +   D + +++  E++ YD++ 
Sbjct: 372  LREGFHVLLVEDDAVCIQLCSKFLR-------KYGCTVEVVTDGLAAISTLEKFRYDLVL 424

Query: 1039 MDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKL 1098
            MD+ MP +DG  +T ++R   +   PI+A+T    D ++   L  GM+  L KP  +  L
Sbjct: 425  MDIVMPNLDGATATSIVRS-FDIHTPIIAMTGNIEDQDLITYLQHGMNDILAKPFTKDDL 483

Query: 1099 KQILQEYI 1106
              +L  Y+
Sbjct: 484  HSMLIRYL 491

>KLLA0A10219g Chr1 (896931..898358) [1428 bp, 475 aa] {ON} similar to
            uniprot|Q75BF2 Ashbya gossypii ADL388W ADL388Wp and some
            similarites with YHR206W uniprot|P38889 Saccharomyces
            cerevisiae
          Length = 475

 Score = 56.2 bits (134), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 39/169 (23%), Positives = 79/169 (46%), Gaps = 13/169 (7%)

Query: 938  DENGTSPDNHSKVRLDRPFLQSTGTATSSQKIPTLINKEDTNIEKSIRILVAEDNHVNQE 997
            D  G++P+       + P L    T    + I  L   +   +     +L+ ED+ V  +
Sbjct: 289  DSTGSTPN------ANIPGLSVNTTLQKQEPIELLPMDQHPVLRPGFHVLLVEDDSVCIQ 342

Query: 998  VIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRK 1057
            +  + L      ++++  DG  A   ++     ++ +D++ MD+ MP +DG  +T ++R 
Sbjct: 343  LCSKFLRKYGC-SVEVVTDGLSAISTLE-----KQRFDLVLMDIVMPNLDGATATSIVRS 396

Query: 1058 DLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEYI 1106
              + + PI+A+T   +D ++   L  GM+  L KP  +  L  +L  Y+
Sbjct: 397  -FDNETPIIAMTGNIDDQDLVTYLQHGMNDILAKPFTKDDLHSMLIRYL 444

>Suva_10.84 Chr10 complement(167272..169359) [2088 bp, 695 aa] {ON}
            YLR006C (REAL)
          Length = 695

 Score = 56.6 bits (135), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 46/172 (26%), Positives = 77/172 (44%), Gaps = 33/172 (19%)

Query: 961  GTATSSQKIPTLINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDA 1020
              ++    +P L       +   I +L+ EDN +NQ ++   L   KI +  LA +GQ+A
Sbjct: 463  AVSSPPDPLPNLFTTTSEKVFPKINVLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEA 521

Query: 1021 FDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIR-----------KDLNYKHP----- 1064
             +  K     E    +IFMD+Q+P + G+ + K IR           K LN  +P     
Sbjct: 522  VNIWK-----EGGLHLIFMDLQLPVLSGIEAAKQIRDFEKQNGIGIQKSLNNSYPNHEKL 576

Query: 1065 -----------IVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
                       IVALTA  +  + ++ L +G + +L KP+    L + + E+
Sbjct: 577  PCKKFSQAPVIIVALTASNSQMDKRKALVSGCNDYLTKPVNLHWLSKKITEW 628

>KAFR0J00700 Chr10 (127858..129720) [1863 bp, 620 aa] {ON} Anc_5.230
            YLR006C
          Length = 620

 Score = 55.8 bits (133), Expect = 5e-07,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 69/128 (53%), Gaps = 13/128 (10%)

Query: 984  IRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQM 1043
            I +L+ EDN +NQ ++   L   KI +  +A +G++A +  K+         +IFMD+Q+
Sbjct: 475  INVLIVEDNVINQAILGGFLRKHKI-SYKVAKNGKEAVEMWKNGG-----LHLIFMDLQL 528

Query: 1044 PKVDGLVSTKMIRKDLNYKHP------IVALTAFANDDNIKECLDAGMDGFLGKPIKRPK 1097
            P + G+ + K IR D   + P      IVALTA  + ++ +  L +G + +L KP+    
Sbjct: 529  PVLSGIDAAKQIR-DFEKERPSCAPVIIVALTASNSAEDKRNALVSGCNDYLTKPVNLHW 587

Query: 1098 LKQILQEY 1105
            L + + E+
Sbjct: 588  LSKKITEW 595

>KLTH0B02684g Chr2 (207260..209047) [1788 bp, 595 aa] {ON} some
            similarities with uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 595

 Score = 54.7 bits (130), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 45/144 (31%), Positives = 68/144 (47%), Gaps = 28/144 (19%)

Query: 984  IRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQM 1043
            I +LV EDN +NQ ++   L   KI +  +A +G +A D+ K     E    +I MD++M
Sbjct: 406  ISVLVVEDNMINQAILSSFLRKHKI-HYKVAKNGVEAVDRWK-----EGGMHLILMDLEM 459

Query: 1044 PKVDGLVSTKMIR--------------------KDLNYKHP--IVALTAFANDDNIKECL 1081
            P + G+ + K IR                    K L  K P  IVALTA  +  +  E L
Sbjct: 460  PLLSGIDAAKEIRKLEKQNGIGTGDPLGKHAELKGLTCKAPVIIVALTASNSQTDKTEAL 519

Query: 1082 DAGMDGFLGKPIKRPKLKQILQEY 1105
             AG + +L KP+    L + + E+
Sbjct: 520  LAGCNDYLTKPVNLDWLTRKITEW 543

>Skud_12.72 Chr12 complement(153012..155120) [2109 bp, 702 aa] {ON}
            YLR006C (REAL)
          Length = 702

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 46/164 (28%), Positives = 74/164 (45%), Gaps = 33/164 (20%)

Query: 969  IPTLINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLA 1028
            +P L       +   I +L+ EDN +NQ ++   L   KI +  LA +GQ+A +  K   
Sbjct: 478  LPNLFTTTSEKVFPKINVLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWK--- 533

Query: 1029 DNEEYYDIIFMDVQMPKVDGLVSTKMIR-----------KDLNYKHP------------- 1064
              E    +IFMD+Q+P + G+ + K IR           K LN  H              
Sbjct: 534  --EGGLHLIFMDLQLPVLSGIEAAKQIRDFEKQNGIGIQKGLNNSHSNFDKGTSKKFSQA 591

Query: 1065 ---IVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
               IVALTA  +  + ++ L +G + +L KP+    L + + E+
Sbjct: 592  PVIIVALTASNSQMDKRKALLSGCNDYLTKPVNLHWLSKKITEW 635

>ZYRO0A11154g Chr1 (893793..896123) [2331 bp, 776 aa] {ON} similar to
            uniprot|Q07084 Saccharomyces cerevisiae YLR006C SSK1
            Cytoplasmic response regulator part of a two- component
            signal transducer that mediates osmosensing via a
            phosphorelay mechanism dephosphorylated form is degraded
            by the ubiquitin-proteasome system potential Cdc28p
            substrate
          Length = 776

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 49/189 (25%), Positives = 80/189 (42%), Gaps = 33/189 (17%)

Query: 951  RLDRPFLQSTGTATSSQKIPTLINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDN 1010
            RL R F    G+ +  +  P   +     +   I +L+ EDN +NQ ++   L   KI  
Sbjct: 533  RLSRSFAPKNGS-SREKPFPGEWSATSDKVFPKINVLIVEDNVINQTILSSFLRKHKI-F 590

Query: 1011 IDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRK------------- 1057
              +A +GQ+A D  +     E    +IFMD+Q+P + G+ + K IR+             
Sbjct: 591  YKVAKNGQEAIDVWR-----EGGIHLIFMDLQLPVLSGIDAAKKIRELEREHGIGIQKSR 645

Query: 1058 -------------DLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQE 1104
                          +N    IVA TA  +  + KE L +G + +L KP+    L   + E
Sbjct: 646  KTPHIESNKINKDQINAPVIIVAFTASKSQSDKKEALISGCNDYLTKPVNLHWLSNKINE 705

Query: 1105 YIDTEKQIN 1113
            +   +  IN
Sbjct: 706  WGCMQALIN 714

>NCAS0D02900 Chr4 complement(551013..553301) [2289 bp, 762 aa] {ON}
            Anc_5.230 YLR006C
          Length = 762

 Score = 54.3 bits (129), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 47/165 (28%), Positives = 78/165 (47%), Gaps = 36/165 (21%)

Query: 960  TGTATSSQKIPTLINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQD 1019
            +G  T+S+K+   IN           +L+ EDN +NQ ++   L   KI +  +A +G++
Sbjct: 532  SGITTTSEKVFPKIN-----------VLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKE 579

Query: 1020 AFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIR-----------------KDLNYK 1062
            A D  K     E    +IFMD+Q+P + G+ + + IR                 K    K
Sbjct: 580  AVDIWK-----EGGLHLIFMDLQLPVLSGIEAARQIRAFEKENGIGIQEHSNSLKKNKTK 634

Query: 1063 HP--IVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
             P  IVALTA  + D+ +  L +G + +L KP+    L + + E+
Sbjct: 635  APVIIVALTASNSQDDKRNALISGCNDYLTKPVNLHWLSKKITEW 679

>Kwal_33.15288 s33 complement(1045147..1046910) [1764 bp, 587 aa] {ON}
            YLR006C (SSK1) - Two-component signal transducer that
            with Sln1p regulates osmosensing MAP kinase
            cascade(suppressor of sensor kinase) [contig 94] FULL
          Length = 587

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 58/193 (30%), Positives = 88/193 (45%), Gaps = 36/193 (18%)

Query: 937  KDENGTSPDNHSKV-RLDRPFLQSTGTATSSQKIPTLINKEDTNIEKSIRILVAEDNHVN 995
            ++E G  P     V R D PFL+S     +++ I       D    K I +LV EDN +N
Sbjct: 377  EEEVGLVPSRDPVVQREDSPFLRSAMETFTTESI-----TRDKVFPK-ISVLVVEDNMIN 430

Query: 996  QEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMI 1055
            Q ++   L   KI +  +A +G +A D+ K     E    +I MD++MP + G+ + K I
Sbjct: 431  QTILSSFLRKHKI-SYKVAKNGIEAVDRWK-----EGGMHLILMDLEMPLLSGIDAAKEI 484

Query: 1056 RK--DLN-------------------YKHP--IVALTAFANDDNIKECLDAGMDGFLGKP 1092
            R+   LN                    K P  IVALTA  +  +  E L AG + +L KP
Sbjct: 485  RRLEKLNGIGSGKPSTGEHAPAKRSTSKAPVIIVALTASNSQSDKTEALLAGCNDYLTKP 544

Query: 1093 IKRPKLKQILQEY 1105
            +    L + + E+
Sbjct: 545  VNLDWLTRKITEW 557

>CAGL0D02882g Chr4 complement(300025..302028) [2004 bp, 667 aa] {ON}
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006c SSK1 two-component signal transducer
          Length = 667

 Score = 53.5 bits (127), Expect = 2e-06,   Method: Compositional matrix adjust.
 Identities = 42/149 (28%), Positives = 70/149 (46%), Gaps = 33/149 (22%)

Query: 984  IRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQM 1043
            I +L+ EDN +NQ ++   L   KI +  +A +G++A DK K     E    +IFMD+Q+
Sbjct: 463  INVLIVEDNVINQAILGSFLRKNKI-SYKIAKNGKEAVDKWK-----EGNLHLIFMDLQL 516

Query: 1044 PKVDGLVSTKMIRK---------------------------DLNYKHPIVALTAFANDDN 1076
            P + G+ + K IR+                             N    IVALTA  + ++
Sbjct: 517  PVLSGIEAAKKIRELEKERGIANQSERVSTPGSLSSINMNGSTNSPVIIVALTASNSQED 576

Query: 1077 IKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
             +E L +G + +L KP+    L + + E+
Sbjct: 577  KREALISGCNDYLTKPVNLLWLSKKITEW 605

>Smik_12.68 Chr12 complement(148821..150959) [2139 bp, 712 aa] {ON}
            YLR006C (REAL)
          Length = 712

 Score = 53.5 bits (127), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 56/221 (25%), Positives = 92/221 (41%), Gaps = 44/221 (19%)

Query: 919  DEEGIKSSRDIDSSNNEHKDENGTSP-------DNHSKVRLDRPFLQSTGTATSSQKIPT 971
            DE GI   + I        +   +SP        ++S    + PF      ++    +P 
Sbjct: 435  DESGIGVIQPISEEQRRKDNATPSSPILTNSQTPHYSNSLYNAPFT----VSSPPDPLPN 490

Query: 972  LINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNE 1031
            L       +   I +L+ EDN +NQ ++   L   KI +  LA +GQ+A +  K     E
Sbjct: 491  LFTTTSEKVFPKINVLIVEDNVINQAILGSFLRKHKI-SYKLAKNGQEAVNIWK-----E 544

Query: 1032 EYYDIIFMDVQMPKVDGLVSTKMIR-----------KDLNYKH--------------P-- 1064
                +IFMD+Q+P + G+ + K IR           K  N  H              P  
Sbjct: 545  GGLHLIFMDLQLPVLSGIEAAKQIRDFEKQNGIGIQKTPNNSHYNFEKSASKRFSQAPVI 604

Query: 1065 IVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
            IVALTA  +  + ++ L +G + +L KP+    L + + E+
Sbjct: 605  IVALTASNSQMDKRKALLSGCNDYLTKPVNLHWLSKKITEW 645

>ADR343C Chr4 complement(1311984..1314233) [2250 bp, 749 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YLR006C
            (SSK1)
          Length = 749

 Score = 52.4 bits (124), Expect = 5e-06,   Method: Compositional matrix adjust.
 Identities = 41/148 (27%), Positives = 71/148 (47%), Gaps = 34/148 (22%)

Query: 974  NKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEY 1033
            N+    +   I +L+ EDN +NQ ++   L   KI + ++A +G +A +K +     +  
Sbjct: 499  NQTRDRVFPKINVLIVEDNIINQAILSSFLRKHKI-SYEIAKNGVEAVEKWR-----KGG 552

Query: 1034 YDIIFMDVQMPKVDGLVSTKMIR-----------------------KDLN---YKHP--I 1065
              +I MD+Q+P + G+ + K IR                        +LN   ++ P  I
Sbjct: 553  IHLILMDLQLPLLSGIDAAKQIRNLERASGICAFQKHCEARSQETYSELNRAKFRAPVII 612

Query: 1066 VALTAFANDDNIKECLDAGMDGFLGKPI 1093
            VALTAF++  +  E L AG + +L KP+
Sbjct: 613  VALTAFSSHADRNEALVAGCNDYLTKPV 640

>Kpol_1004.4 s1004 complement(9754..11898) [2145 bp, 714 aa] {ON}
            complement(9754..11898) [2145 nt, 715 aa]
          Length = 714

 Score = 50.8 bits (120), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 42/152 (27%), Positives = 70/152 (46%), Gaps = 36/152 (23%)

Query: 984  IRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQM 1043
            I +L+ EDN +NQ ++   L   KI +  +A +G++A DK K     E    +IFMD+Q+
Sbjct: 511  INVLIVEDNVINQTILASFLRKHKI-SYKVAKNGREAVDKWK-----EGGLHLIFMDLQL 564

Query: 1044 PKVDGLVSTKMIRKDLNYK----------------------------HP--IVALTAFAN 1073
            P + G+ + K IR+   +K                             P  IVA TA  +
Sbjct: 565  PVLSGIDAAKEIREYEKHKGIGIQKASSTTSTTNLEDTKKIDKNSTGAPVIIVAFTASNS 624

Query: 1074 DDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
              + +E L +G + +L KP+    L + + E+
Sbjct: 625  LTDKREALISGCNDYLTKPVNLHWLSKKITEW 656

>NDAI0I02000 Chr9 complement(464492..467164) [2673 bp, 890 aa] {ON}
            Anc_5.230 YLR006C
          Length = 890

 Score = 50.4 bits (119), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 46/169 (27%), Positives = 80/169 (47%), Gaps = 40/169 (23%)

Query: 960  TGTATSSQKIPTLINKEDTNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQD 1019
            +G  T+S+K+   IN           +L+ EDN +NQ ++   L   KI +  +A +G++
Sbjct: 657  SGITTTSEKVFPKIN-----------VLIVEDNVINQAILGSFLRKHKI-SYKVAKNGKE 704

Query: 1020 AFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIR----------KDLNYKHP----- 1064
            A D  K     E    +IFMD+Q+P + G+ + + IR          ++ N K       
Sbjct: 705  AVDIWK-----EGGLHLIFMDLQLPVLSGIEAARQIRDFEKEKGIGIQENNLKQKIIPAS 759

Query: 1065 --------IVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
                    IVALTA  + D+ ++ L +G + +L KP+    L + + E+
Sbjct: 760  NINQAPVIIVALTASNSLDDKRKALLSGCNDYLTKPVNLHWLSKKITEW 808

>TPHA0N00850 Chr14 complement(189011..191023) [2013 bp, 670 aa] {ON}
            Anc_5.230 YLR006C
          Length = 670

 Score = 50.1 bits (118), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 64/269 (23%), Positives = 110/269 (40%), Gaps = 52/269 (19%)

Query: 878  TREIHFDDEKFEDEFNAESKKNRRIKFKIYDSSKSHDS--NDEDEEGIKSSRDIDSSN-- 933
            TR +    E F+D  + E      IK    D S + DS  N    + ++S +DI S+N  
Sbjct: 357  TRGVLLLPENFQDIEDTEF-----IKAHTRDKSGTSDSTINKATNDMVQSEQDIISNNIE 411

Query: 934  ---------NEHKDENGTSPDNHSKVRLDRPFLQSTGTATSSQKIPTLINKEDTNIEKSI 984
                     N+   +       +S      P   S   +T     P         +  +I
Sbjct: 412  NVYETNENINQQPGDQTLKNRTNSSSNFKDPSFNSLSYSTDKMISPIEFKFNSEKVFPNI 471

Query: 985  RILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMP 1044
             +L+ EDN +NQ ++   L   KI +  +A +G++A +K K     E    +IFMD+Q+P
Sbjct: 472  TVLIVEDNVINQTILASFLRKHKI-SYRIAKNGREAVEKWK-----EGGIHLIFMDLQLP 525

Query: 1045 KVDGLVSTKMIR-----KDLNYKHP-----------------------IVALTAFANDDN 1076
             + G+ + K IR     K +  ++P                       +VA TA  +  +
Sbjct: 526  VMSGIDAAKEIRECEKLKGIGIRNPMASSSSLSIVESVEKPVLGAPVIMVAFTASNSLTD 585

Query: 1077 IKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
             +E L +G + +L KP+    L + + E+
Sbjct: 586  KREALVSGCNDYLTKPVNLHWLSKKITEW 614

>TBLA0D03170 Chr4 complement(771345..773642) [2298 bp, 765 aa] {ON}
            Anc_5.230 YLR006C
          Length = 765

 Score = 46.6 bits (109), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 46/157 (29%), Positives = 69/157 (43%), Gaps = 36/157 (22%)

Query: 979  NIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIF 1038
            NI   I IL+ EDN +NQ ++   L   KI    +A +G++A DK K     E    +IF
Sbjct: 560  NIFPRINILIVEDNVINQTILGSFLRKNKIF-YKVAKNGREAVDKWK-----EGGIHLIF 613

Query: 1039 MDVQMPKVDGLVSTKMIRK------------------------DLNYKHP------IVAL 1068
            MD+Q+P + G  + K IR+                         LN K        IVA 
Sbjct: 614  MDLQLPVLSGTDAAKEIRQYEKKIGIGIQKKQSSSSDLSLSESFLNTKSSACAPVIIVAF 673

Query: 1069 TAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
            TA  +  + +  L AG + +L KP+    L + + E+
Sbjct: 674  TASNSLADKRAALIAGCNDYLTKPVNLHWLSKKITEW 710

>SAKL0G12100g Chr7 (1029250..1031466) [2217 bp, 738 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 738

 Score = 45.1 bits (105), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 26/78 (33%), Positives = 45/78 (57%), Gaps = 6/78 (7%)

Query: 979  NIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIF 1038
            N+   I +L+ EDN +NQ ++   L   KI +  +A +G++A DK K     +    +I 
Sbjct: 457  NVFPKINVLIVEDNVINQAILGSFLRKHKI-SYKVAKNGREAVDKWK-----QGGIHLIL 510

Query: 1039 MDVQMPKVDGLVSTKMIR 1056
            +D+Q+P + G+ +TK IR
Sbjct: 511  LDLQLPILSGIEATKEIR 528

>KLLA0E09505g Chr5 (840647..842554) [1908 bp, 635 aa] {ON} weakly
            similar to uniprot|Q07084 Saccharomyces cerevisiae
            YLR006C SSK1 Cytoplasmic response regulator part of a
            two-component signal transducer that mediates osmosensing
            via a phosphorelay mechanism dephosphorylated form is
            degraded by the ubiquitin-proteasome system potential
            Cdc28p substrate
          Length = 635

 Score = 44.3 bits (103), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 27/74 (36%), Positives = 42/74 (56%), Gaps = 6/74 (8%)

Query: 984  IRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQM 1043
            I +L+ EDN +NQ ++   L    I +  +A DG +A +K K     E    +I MD+Q+
Sbjct: 394  INVLIVEDNAINQAILALFLRKNGI-SYKVAKDGVEAIEKWK-----EGDSHLILMDLQL 447

Query: 1044 PKVDGLVSTKMIRK 1057
            P + GL +TK IR+
Sbjct: 448  PLLSGLEATKKIRE 461

>TBLA0B01550 Chr2 (340204..341388) [1185 bp, 394 aa] {ON} Anc_7.222
           YIL042C
          Length = 394

 Score = 38.9 bits (89), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 24/86 (27%), Positives = 38/86 (44%), Gaps = 25/86 (29%)

Query: 802 ISVEVEDTGPGIEPKLQEAVFEPFV------------QGDQALS--------RQYGGTGL 841
           +S+ V D G GI P+      EPF+            +GD A           +  G G 
Sbjct: 301 LSIRVRDHGGGIPPER-----EPFILDYAYTSEVNKHEGDPATQVNQVNADVPRVAGLGF 355

Query: 842 GLSICRQLATMMHGTMKLESTVGVGS 867
           GL +CR  A +  G++ ++S  G+G+
Sbjct: 356 GLPLCRMYAELFGGSLSIQSLWGLGT 381

>KLLA0E04533g Chr5 (408415..409680) [1266 bp, 421 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 421

 Score = 38.5 bits (88), Expect = 0.089,   Method: Compositional matrix adjust.
 Identities = 19/81 (23%), Positives = 39/81 (48%), Gaps = 15/81 (18%)

Query: 802 ISVEVEDTGPGIEPKLQEAVFEPFV------QGDQALS---------RQYGGTGLGLSIC 846
           + + + D G GI+P++++ VF+         + D  +S         +   G G GL +C
Sbjct: 325 LEIRIRDFGGGIDPQVEDRVFDYSFSTTVKEEKDSGMSDYVLPGQEVQNVAGMGFGLPMC 384

Query: 847 RQLATMMHGTMKLESTVGVGS 867
           +    + +GT+ ++S  G G+
Sbjct: 385 KAYLELFNGTLDIQSLWGWGT 405

>SAKL0F08184g Chr6 (623521..624759) [1239 bp, 412 aa] {ON} similar
           to uniprot|P40530 Saccharomyces cerevisiae YIL042C
           Hypothetical ORF
          Length = 412

 Score = 37.4 bits (85), Expect = 0.18,   Method: Compositional matrix adjust.
 Identities = 20/81 (24%), Positives = 37/81 (45%), Gaps = 15/81 (18%)

Query: 802 ISVEVEDTGPGIEPKLQEAVFEPFVQGDQALSRQYG---------------GTGLGLSIC 846
           + + + D G GI P++++ +FE      QA ++  G               G G GL +C
Sbjct: 317 LEIRIRDFGGGIPPEVEDRMFEYSYSTVQANTKDTGMSAYVIPGEEVNNVSGMGFGLPMC 376

Query: 847 RQLATMMHGTMKLESTVGVGS 867
           +    M  G++ ++S  G G+
Sbjct: 377 KAYLEMFDGSLDIQSLYGWGT 397

>NCAS0C03770 Chr3 complement(761101..765897) [4797 bp, 1598 aa] {ON}
            Anc_8.34
          Length = 1598

 Score = 37.7 bits (86), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 34/131 (25%), Positives = 68/131 (51%), Gaps = 13/131 (9%)

Query: 978  TNIEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDII 1037
            T I   + IL+ E   +++  +K+  +LE +    L      A D++ S AD +  +D+I
Sbjct: 1455 TGIGYHMDILLCEPIPIHRYRMKK--DLESLGCTVLTAG---AADELISRADGQIKFDLI 1509

Query: 1038 FMDVQMPKVDGLVSTKMIRK--DLNYKHPIVALTAFANDDNIKECLDAGM-DGFLGKPIK 1094
               +++PKV      K++++    N   PIVA+T +      +E + +G+ D  + KPI 
Sbjct: 1510 MTPLRLPKVGSSDIIKLLKRANGANSTTPIVAVTNY-----YQEAMASGVFDDVMEKPIS 1564

Query: 1095 RPKLKQILQEY 1105
              +L++++ +Y
Sbjct: 1565 IKELRKLIAKY 1575

>CAGL0K12562g Chr11 (1235695..1240743) [5049 bp, 1682 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033c RIM15
            protein kinase involved in expression of meiotic genes
          Length = 1682

 Score = 36.2 bits (82), Expect = 0.68,   Method: Compositional matrix adjust.
 Identities = 24/89 (26%), Positives = 50/89 (56%), Gaps = 8/89 (8%)

Query: 1020 AFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRK--DLNYKHPIVALTAFANDDNI 1077
            A D++ S A++   +D+I   +++PK+  +   K+I+    +N + PI+A+T F +    
Sbjct: 1573 AGDELVSRANSGVKFDLIVTALKLPKLGAIDIVKLIKHTNGINSRTPIIAITNFYH---- 1628

Query: 1078 KECLDAGM-DGFLGKPIKRPKLKQILQEY 1105
             E + A + D  L KPI   +++ ++ +Y
Sbjct: 1629 -EAISAKVFDDVLEKPIMLDEIRHLVAKY 1656

>NDAI0G03110 Chr7 complement(725984..731107) [5124 bp, 1707 aa] {ON}
            Anc_8.34
          Length = 1707

 Score = 35.8 bits (81), Expect = 0.72,   Method: Compositional matrix adjust.
 Identities = 28/113 (24%), Positives = 57/113 (50%), Gaps = 14/113 (12%)

Query: 999  IKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIR-- 1056
            I R   ++ ++++          D++ S AD E  +D+I   +++P V    ST++IR  
Sbjct: 1580 IHRYRIIKDLESLGCTVIAASGADELVSRADAEITFDLIITTLKLPNVS---STELIRLL 1636

Query: 1057 ---KDLNYKHPIVALTAFANDDNIKECLDAGM-DGFLGKPIKRPKLKQILQEY 1105
                  N   PIVALT++      +E +++ + D  L KP++   ++ ++ +Y
Sbjct: 1637 KFTNGTNSATPIVALTSY-----YEEAMNSNVFDYVLEKPLQMKDIRNLISKY 1684

>Kwal_26.8751 s26 complement(928853..931399) [2547 bp, 848 aa] {ON}
           YPL150W - Hypothetical ORF [contig 67] FULL
          Length = 848

 Score = 35.8 bits (81), Expect = 0.77,   Method: Compositional matrix adjust.
 Identities = 19/57 (33%), Positives = 30/57 (52%)

Query: 911 KSHDSNDEDEEGIKSSRDIDSSNNEHKDENGTSPDNHSKVRLDRPFLQSTGTATSSQ 967
           +  ++N  D + I   R   SS NEH   NGT+P    K+++  P L+   + TSS+
Sbjct: 477 RKRNTNSFDSKKISPGRSPFSSTNEHDQPNGTTPAAQEKLKIQEPMLKKFKSNTSSE 533

>KLTH0F03674g Chr6 (321662..325258) [3597 bp, 1198 aa] {ON} similar
           to uniprot|P39538 Saccharomyces cerevisiae YJL197W UBP12
           Ubiquitin-specific protease present in the nucleus and
           cytoplasm that cleaves ubiquitin from ubiquitinated
           proteins
          Length = 1198

 Score = 35.8 bits (81), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 20/50 (40%), Positives = 28/50 (56%), Gaps = 2/50 (4%)

Query: 908 DSSKSHDSNDEDEEGIKSSRDIDSSNNEHKDENGTSPDNHSKVRLD--RP 955
           D SK H+SNDE  +  ++  D+D   NE+  EN   PDN  +  +D  RP
Sbjct: 798 DDSKGHESNDEGTKKEETPSDMDVDLNENDSENFPKPDNEPEAEVDFQRP 847

>TBLA0G03450 Chr7 (913497..919415) [5919 bp, 1972 aa] {ON} Anc_8.34
            YFL033C
          Length = 1972

 Score = 35.0 bits (79), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 24/95 (25%), Positives = 49/95 (51%), Gaps = 6/95 (6%)

Query: 1020 AFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRK--DLNYKHPIVALTAFANDDNI 1077
            A D++ S A+    +D+I   +++PK+D +   K+I++   +N   PI+A T +  +   
Sbjct: 1870 AGDELVSRANGVIKFDLIITALKLPKIDAVDIVKLIKQTNGINSLTPIIAATNYTQEAET 1929

Query: 1078 KECLDAGMDGFLGKPIKRPKLKQILQEYIDTEKQI 1112
                +  M+    KPI+   L++++  Y   + QI
Sbjct: 1930 CHVFNDIME----KPIQLDILRRVVSRYALQKSQI 1960

>Skud_2.325 Chr2 (586584..587978) [1395 bp, 464 aa] {ON} YBR199W
            (REAL)
          Length = 464

 Score = 33.5 bits (75), Expect = 3.2,   Method: Compositional matrix adjust.
 Identities = 17/36 (47%), Positives = 25/36 (69%), Gaps = 1/36 (2%)

Query: 1018 QDAFDKVKSLADNEEYYD-IIFMDVQMPKVDGLVST 1052
            +D FD V+ LA+NE+ YD I+  ++  PKVD LV +
Sbjct: 88   KDTFDPVEVLAENEQLYDEILAQEITEPKVDNLVRS 123

>Skud_6.38 Chr6 complement(72416..77692) [5277 bp, 1758 aa] {ON}
            YFL033C (REAL)
          Length = 1758

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 26/110 (23%), Positives = 56/110 (50%), Gaps = 8/110 (7%)

Query: 999  IKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRK- 1057
            I R    + ++N+        A D++ S A +   +D+I   +++PK+  +   +++R+ 
Sbjct: 1633 IHRYRVAKDLENLGCTVVSVGAGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLRQT 1692

Query: 1058 -DLNYKHPIVALTAFANDDNIKECLDAGM-DGFLGKPIKRPKLKQILQEY 1105
               N   PIVA+T +      +E + + + D  L KP+   +LK+++ +Y
Sbjct: 1693 NGANSTTPIVAITNY-----FQEAITSKVFDDVLEKPVNLDELKKLVAKY 1737

>TBLA0E04980 Chr5 (1275927..1278302) [2376 bp, 791 aa] {ON} Anc_4.385
            YJR147W
          Length = 791

 Score = 33.5 bits (75), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 18/69 (26%), Positives = 34/69 (49%), Gaps = 1/69 (1%)

Query: 1034 YDIIFMDVQMPKVDGLVSTKMIRKDLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPI 1093
            YD++ +D  +  ++  +   M+   + Y  PI+ +T+  ND  +   L  G++  L KP 
Sbjct: 536  YDLVIIDAHVKFLNVPILESML-SSIQYHPPIILMTSSLNDQQLIFYLQHGINSILEKPF 594

Query: 1094 KRPKLKQIL 1102
               KL + L
Sbjct: 595  HSHKLLKFL 603

>YFL033C Chr6 complement(69115..74427) [5313 bp, 1770 aa] {ON}
            RIM15Glucose-repressible protein kinase involved in
            signal transduction during cell proliferation in response
            to nutrients, specifically the establishment of
            stationary phase; identified as a regulator of IME2;
            substrate of Pho80p-Pho85p kinase
          Length = 1770

 Score = 33.9 bits (76), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 25/109 (22%), Positives = 53/109 (48%), Gaps = 6/109 (5%)

Query: 999  IKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRK- 1057
            I R    + ++N+        A D++ S A +   +D+I   +++PK+  +   +++++ 
Sbjct: 1645 IHRYRVTKDLENLGCTVVSVGAGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLKQT 1704

Query: 1058 -DLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
               N   PIVA+T +  +           D  L KP+K  +LK+++ +Y
Sbjct: 1705 NGANSTTPIVAITNYFQEAATSRVF----DDVLEKPVKLDELKKLVAKY 1749

>ACR218W Chr3 (731433..736142) [4710 bp, 1569 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YFL033C (RIM15)
          Length = 1569

 Score = 33.5 bits (75), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 23/89 (25%), Positives = 47/89 (52%), Gaps = 13/89 (14%)

Query: 1022 DKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRK--DLNYKHPIVALTAFANDDNIKE 1079
            D++   A +   +D+I   +++PK+  +  T+++R+   +N   PIVA+T   +      
Sbjct: 1471 DEIVRRATSGVRFDLIITTLKLPKIGAVDITRLLRQTTSINCTTPIVAVTVNYH------ 1524

Query: 1080 CLDAG---MDGFLGKPIKRPKLKQILQEY 1105
              DAG    D  L +PI   +L++++ +Y
Sbjct: 1525 --DAGTHIFDDVLERPIGTEQLRKLVSKY 1551

>SAKL0B01210g Chr2 complement(109892..114658) [4767 bp, 1588 aa] {ON}
            similar to uniprot|Q75BQ3 Ashbya gossypii ACR218W
            ACR218Wp and some similarites with YFL033C uniprot|P43565
            Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1588

 Score = 33.5 bits (75), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/109 (22%), Positives = 53/109 (48%), Gaps = 6/109 (5%)

Query: 999  IKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRK- 1057
            I R   ++ ++++  +  G  A D++   A     +D+I   +++PK+  +   K++R  
Sbjct: 1450 IHRYRLVKDLESLGCSVVGVGAGDELVRRATAGVKFDLIITALKLPKLGAVDIAKLLRHT 1509

Query: 1058 -DLNYKHPIVALTAFANDDNIKECLDAGMDGFLGKPIKRPKLKQILQEY 1105
               N   PIVA+TA+  +    +      D  L KP+   +++ ++ +Y
Sbjct: 1510 NSANCNTPIVAVTAYYGEAESTQVF----DDVLEKPVGIEQIRCLIAKY 1554

>KNAG0D01750 Chr4 complement(294787..296016) [1230 bp, 409 aa] {ON}
           Anc_7.222 YIL042C possible pseudogene; NNN added to
           avoid internal stop codon
          Length = 409

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 22/98 (22%), Positives = 40/98 (40%), Gaps = 17/98 (17%)

Query: 792 VELSEPKTWVISVEVEDTGPGIEPKLQEAVFE----------------PFVQGDQALSRQ 835
           V L  P    +++ V D G GI P ++  +F+                  +   +A+ + 
Sbjct: 303 VTLLRPHETELTLRVSDRGGGIPPGVESHIFDYSYTTTTEAADTDTATAQMHAGEAV-KS 361

Query: 836 YGGTGLGLSICRQLATMMHGTMKLESTVGVGSKFIFTV 873
             G G GL +CR    +  G + ++S  G G+    T+
Sbjct: 362 VAGMGFGLPLCRTYLELFDGKIDVQSLWGHGTDVYLTM 399

>KLTH0G18612g Chr7 (1604066..1608640) [4575 bp, 1524 aa] {ON} similar
            to uniprot|P43565 Saccharomyces cerevisiae YFL033C RIM15
            Glucose-repressible protein kinase involved in signal
            transduction during cell proliferation in response to
            nutrients specifically the establishment of stationary
            phase originally identified as a regulator of IME2
          Length = 1524

 Score = 33.1 bits (74), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 21/86 (24%), Positives = 46/86 (53%), Gaps = 6/86 (6%)

Query: 1022 DKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIR--KDLNYKHPIVALTAFANDDNIKE 1079
            D++   A ++  +D+IF  +++PK+  +   K++R    +N    I+A+TA+  +   + 
Sbjct: 1422 DEMVRRATSDVKFDLIFTALKLPKLGAIDIVKLLRNTNSVNSTTSIIAVTAYFQEAQ-QA 1480

Query: 1080 CLDAGMDGFLGKPIKRPKLKQILQEY 1105
            C     D  L +P+   +L+ +L +Y
Sbjct: 1481 C---AFDEVLERPVSVQQLRSLLLKY 1503

>ADR293C Chr4 complement(1207021..1210425) [3405 bp, 1134 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR079C
           (IRE1)
          Length = 1134

 Score = 32.7 bits (73), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 20/55 (36%), Positives = 32/55 (58%), Gaps = 7/55 (12%)

Query: 135 VNATNNGTGDL---IPNEVLSELFPLSTNQSLPSSLNNDGILTDPVLNGSIYLMS 186
           ++A N   G L   IP++ LS L  +S     P+SLNN+ ++ +P  +G+IY  S
Sbjct: 157 LHALNRDNGQLLWSIPSDKLSPLLTVSE----PTSLNNETLIVEPYGDGNIYYFS 207

>Smik_6.46 Chr6 complement(84451..89733) [5283 bp, 1760 aa] {ON}
            YFL033C (REAL)
          Length = 1760

 Score = 32.7 bits (73), Expect = 7.5,   Method: Compositional matrix adjust.
 Identities = 25/110 (22%), Positives = 56/110 (50%), Gaps = 8/110 (7%)

Query: 999  IKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRK- 1057
            I R    + ++N+        A D++ S A +   +D+I   +++PK+  +   +++++ 
Sbjct: 1635 IHRYRVTKDLENLGCTVVSVGAGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLKQT 1694

Query: 1058 -DLNYKHPIVALTAFANDDNIKECLDAGM-DGFLGKPIKRPKLKQILQEY 1105
               N   PIVA+T +      +E + + + D  L KP+   +LK+++ +Y
Sbjct: 1695 NGANSTTPIVAITNY-----FQEAITSKVFDDVLEKPVNLDELKKLVAKY 1739

>Suva_6.26 Chr6 complement(42811..48072) [5262 bp, 1753 aa] {ON}
            YFL033C (REAL)
          Length = 1753

 Score = 32.7 bits (73), Expect = 8.0,   Method: Compositional matrix adjust.
 Identities = 24/110 (21%), Positives = 56/110 (50%), Gaps = 8/110 (7%)

Query: 999  IKRMLNLEKIDNIDLACDGQDAFDKVKSLADNEEYYDIIFMDVQMPKVDGLVSTKMIRK- 1057
            I R    + ++N+        A D++ S A +   +D+I   +++PK+  +   +++++ 
Sbjct: 1628 IHRYRVAKDLENLGCTVVSVGAGDELVSRATSGVSFDLIMTALKLPKLGAIDIVQLLKQT 1687

Query: 1058 -DLNYKHPIVALTAFANDDNIKECLDA-GMDGFLGKPIKRPKLKQILQEY 1105
              +N   PIV++T +      +E + +   D  L KP+   +LK+++ +Y
Sbjct: 1688 NGVNSTTPIVSITNY-----FQEAIASKAFDDVLEKPVNLDELKRLVAKY 1732

>YMR025W Chr13 (323300..324187) [888 bp, 295 aa] {ON}  CSI1Subunit of
            the Cop9 signalosome, which is required for
            deneddylation, or removal of the ubiquitin-like protein
            Rub1p from Cdc53p (cullin); involved in adaptation to
            pheromone signaling
          Length = 295

 Score = 32.0 bits (71), Expect = 8.2,   Method: Compositional matrix adjust.
 Identities = 16/38 (42%), Positives = 25/38 (65%)

Query: 980  IEKSIRILVAEDNHVNQEVIKRMLNLEKIDNIDLACDG 1017
            IEK IRI + E++ +NQE ++R +NL K+   D+   G
Sbjct: 58   IEKVIRIPMQENDKINQERLERRINLTKVTQKDICILG 95

>NDAI0C03560 Chr3 complement(816972..818975) [2004 bp, 667 aa] {ON}
           Anc_5.47 YHR188C
          Length = 667

 Score = 32.3 bits (72), Expect = 9.5,   Method: Compositional matrix adjust.
 Identities = 47/185 (25%), Positives = 80/185 (43%), Gaps = 31/185 (16%)

Query: 216 GLKNVYLNNTALENSNVTVISAIYNDQ--GKVDGFHFVFEVENDDFSTLIEYPIQNGTYL 273
           GL+ V+ N T +       I+AIY +     +  +    ++E+ D S L    + +  Y 
Sbjct: 461 GLRTVFQNPTPMP------ITAIYFESLPWYMRLYLSSLKLESIDSSNLQLEDVIDSVYY 514

Query: 274 SSALVEGKSGSIKKT-KYPFNRELAIG------------YSPCS---FSLSNWVALVTQP 317
           +SA+   +   ++ T   P N  LAI             Y P +   F + + V  V +P
Sbjct: 515 NSAIDHKRPSHLEYTITIPANTTLAISCQFDKALLHFADYPPDANHGFEIESAVITVIKP 574

Query: 318 -------EAVFLSPSTKLEKIISGTVVAIAVFVCLITFPLSHWAVKPIVRLQKATELISQ 370
                  E + LS ST    +    ++  +  + LI   L +  VK +VR+++A +LI Q
Sbjct: 575 FKYQIRTETLLLSLSTPDFSMPYNVIIITSTVIGLIYGTLYNLLVKKVVRVEQADKLIEQ 634

Query: 371 GRGLK 375
             GLK
Sbjct: 635 QAGLK 639

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.133    0.370 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 116,567,618
Number of extensions: 5415578
Number of successful extensions: 29867
Number of sequences better than 10.0: 411
Number of HSP's gapped: 30659
Number of HSP's successfully gapped: 445
Length of query: 1113
Length of database: 53,481,399
Length adjustment: 120
Effective length of query: 993
Effective length of database: 39,721,479
Effective search space: 39443428647
Effective search space used: 39443428647
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 71 (32.0 bits)