Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_2001.735.699ON41141111471e-155
ZYRO0G06666g5.699ON5031281302e-07
TDEL0B022205.699ON4891271293e-07
KAFR0D022505.699ON5561231151e-05
NCAS0G002605.699ON510133990.001
TPHA0D045805.699ON470104980.002
SAKL0E14850g5.699ON47095860.052
Ecym_40215.699ON45988810.21
Kwal_55.197165.699ON46727800.23
KNAG0L021005.699ON44428712.8
KLTH0E01122g5.699ON47221694.9
NOTE: 8 genes in the same pillar as Kpol_2001.73 were not hit in these BLAST results
LIST: Skud_9.22 Smik_9.23 YIL146C TBLA0E02090 Suva_9.43 AFR283W KLLA0A00660g CAGL0H06545g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_2001.73
         (411 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON} (1997...   446   e-155
ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {...    55   2e-07
TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {O...    54   3e-07
KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {O...    49   1e-05
NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}...    43   0.001
TPHA0D04580 Chr4 (1000005..1001417) [1413 bp, 470 aa] {ON}             42   0.002
SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} simi...    38   0.052
Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON} s...    36   0.21 
Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON...    35   0.23 
KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5....    32   2.8  
KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {...    31   4.9  

>Kpol_2001.73 s2001 (199741..200976) [1236 bp, 411 aa] {ON}
           (199741..200976) [1236 nt, 412 aa]
          Length = 411

 Score =  446 bits (1147), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 260/411 (63%), Positives = 260/411 (63%)

Query: 1   MEKHLLDPHYSVLKLLENNFNNPNDSMXXXXXXXXXXXXXXXXXXXXXXPFITGSAIXXX 60
           MEKHLLDPHYSVLKLLENNFNNPNDSM                      PFITGSAI   
Sbjct: 1   MEKHLLDPHYSVLKLLENNFNNPNDSMNLSESWQILSSSSENSEEDEQEPFITGSAITVT 60

Query: 61  XXXXXXXXXXXXXXXXFIMPKLIVSQNLWDTXXXXXXXRFLIVGNNSLFFYNEILPINYK 120
                           FIMPKLIVSQNLWDT       RFLIVGNNSLFFYNEILPINYK
Sbjct: 61  NPNSSNSNCTSNNGSTFIMPKLIVSQNLWDTNNDNNNNRFLIVGNNSLFFYNEILPINYK 120

Query: 121 KFFKIWCLNKLDSSNLIIIINDHNELFNILQKILLNSNRKSCXXXXXXXXXXXXXXXXTX 180
           KFFKIWCLNKLDSSNLIIIINDHNELFNILQKILLNSNRKSC                T 
Sbjct: 121 KFFKIWCLNKLDSSNLIIIINDHNELFNILQKILLNSNRKSCFNIIIILIIEKFNNLITN 180

Query: 181 XXXXXXXXXXXXXXXXXXXXXXXXXXXXXPSILIIYKNSXXXXXXXXXXXXXXXXXXXXS 240
                                        PSILIIYKNS                    S
Sbjct: 181 RRKIKLIKNSINIINKQFNLKKINFNFFNPSILIIYKNSKLINYNKNFNNFLIFIKNYLS 240

Query: 241 NSKNHTSKDLISANDNIIIPSQXXXXXXXXXXXXXXXXXXXXXXXXXXXXYNQXXXXXXX 300
           NSKNHTSKDLISANDNIIIPSQ                            YNQ       
Sbjct: 241 NSKNHTSKDLISANDNIIIPSQLLNKRKRLIKSNKKKKKSKKSKLNSLNKYNQNDDDDDS 300

Query: 301 XXTGKWLFVYYGISITLGVGVGYCISSLVVSQNSNDIQSIVPSTPNNDIIALESQDLNSH 360
             TGKWLFVYYGISITLGVGVGYCISSLVVSQNSNDIQSIVPSTPNNDIIALESQDLNSH
Sbjct: 301 NSTGKWLFVYYGISITLGVGVGYCISSLVVSQNSNDIQSIVPSTPNNDIIALESQDLNSH 360

Query: 361 NGDDYNWNFLKLSIKNVYSILKRFITTSINLLEYKTLNDSNKIIAMSYVLL 411
           NGDDYNWNFLKLSIKNVYSILKRFITTSINLLEYKTLNDSNKIIAMSYVLL
Sbjct: 361 NGDDYNWNFLKLSIKNVYSILKRFITTSINLLEYKTLNDSNKIIAMSYVLL 411

>ZYRO0G06666g Chr7 complement(532862..534373) [1512 bp, 503 aa] {ON}
           similar to uniprot|P40458 Saccharomyces cerevisiae
           YIL146C ECM37 Non-essential protein of unknown function
          Length = 503

 Score = 54.7 bits (130), Expect = 2e-07,   Method: Compositional matrix adjust.
 Identities = 39/128 (30%), Positives = 68/128 (53%), Gaps = 23/128 (17%)

Query: 305 KWLFVYYGISITLGVGVGYCISSLV----VSQNSNDIQSIVPSTPNNDIIALESQDLNSH 360
           +W  V +G+S+TLGVGVGYCIS LV    +S  +N +  + P + + D+   + Q+L   
Sbjct: 378 RW--VLWGVSLTLGVGVGYCISHLVSSTWISLTTNPLGPVDPESVSKDLFVFDRQELKLG 435

Query: 361 NGD-DYNWNF------LKLSIKNVYSILKRFITTSI---------NLLEYKTLND-SNKI 403
             D D +  F       K ++K     +K+F+   +         N LE+ T ++ +N++
Sbjct: 436 EMDMDSDHPFGHALFLFKQALKQWNLAVKQFLGRHLSCMERIGPANCLEWPTSDEHTNRV 495

Query: 404 IAMSYVLL 411
           +A+ YV+L
Sbjct: 496 LALGYVML 503

>TDEL0B02220 Chr2 complement(400065..401534) [1470 bp, 489 aa] {ON}
           Anc_5.699 YIL146C
          Length = 489

 Score = 54.3 bits (129), Expect = 3e-07,   Method: Compositional matrix adjust.
 Identities = 37/127 (29%), Positives = 67/127 (52%), Gaps = 22/127 (17%)

Query: 305 KWLFVYYGISITLGVGVGYCI----SSLVVSQNSNDIQSIVPSTPNNDIIALESQDLNSH 360
           KW  + +GIS+T+GVGVGYC+    SS ++S ++  I SI    PN++++  +   L   
Sbjct: 365 KW--IVWGISLTVGVGVGYCMSYFASSGLISMSAKSIASINGCRPNDNVVVFDDSSLGMG 422

Query: 361 NGDD-------YNWNFLKLSIKNVYSILKRFI---------TTSINLLEYKTLNDSNKII 404
             D        +    LK ++K     +K+F+         ++S N  E+   ++SN+++
Sbjct: 423 EYDHDLENPFAHALYLLKQTLKQWNWAMKQFLMKHLHLPESSSSTNYKEWGAEDNSNRVL 482

Query: 405 AMSYVLL 411
           A+ Y+LL
Sbjct: 483 ALGYILL 489

>KAFR0D02250 Chr4 complement(455223..456893) [1671 bp, 556 aa] {ON}
           Anc_5.699 YIL146C
          Length = 556

 Score = 48.9 bits (115), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 40/123 (32%), Positives = 62/123 (50%), Gaps = 18/123 (14%)

Query: 305 KWLFVYYGISITLGVGVGYCI--------SSLV--VSQNSNDIQSIVPSTPNNDIIALES 354
           KW+   +GIS+++GVG+GYCI        SSLV   +  S+ I + VP   +N+   L  
Sbjct: 436 KWII--WGISLSIGVGIGYCISYFGSSPWSSLVQYFNPESDSISATVPVPLSNESFVLLH 493

Query: 355 QDLNSHNGDDY---NWNFLKLSIKNVYSILKRFITTSINLLEY---KTLNDSNKIIAMSY 408
              N      Y   + NFLK SI  V  I+K  I   +N   Y      +D++ ++A+ Y
Sbjct: 494 DSDNDSETKKYFFKSINFLKYSINKVKVIIKDTIRKPLNAFSYLNGLNTDDASSLLALGY 553

Query: 409 VLL 411
           +L+
Sbjct: 554 ILI 556

>NCAS0G00260 Chr7 complement(44445..45977) [1533 bp, 510 aa] {ON}
           Anc_5.699 YIL146C
          Length = 510

 Score = 42.7 bits (99), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 66/133 (49%), Gaps = 29/133 (21%)

Query: 305 KWLFVYYGISITLGVGVGYCISSLVVSQNSN-DIQSIVPST---PNNDIIALESQD---- 356
           KW  V + IS+T+G G+GY IS  V + +    ++ I   T   P + +I L+S      
Sbjct: 381 KW--VVWSISLTVGAGMGYIISYCVFNSSKRLPLEKIAHQTRPGPLSSLIHLKSNKNLLY 438

Query: 357 LNSHNGDDYNWNF------------------LKLSIKNVYSILKRFITTSINLLEYKTLN 398
           L     +DY+W++                   K  I+  +++ +  ITT+IN  ++K  +
Sbjct: 439 LERTTPNDYSWSYFQNTWEFCKETVNQLNSTFKKIIRKPFAMFENLITTTINSKDWK-FD 497

Query: 399 DSNKIIAMSYVLL 411
           + ++I+A+ Y+LL
Sbjct: 498 EQDRILALCYLLL 510

>TPHA0D04580 Chr4 (1000005..1001417) [1413 bp, 470 aa] {ON} 
          Length = 470

 Score = 42.4 bits (98), Expect = 0.002,   Method: Compositional matrix adjust.
 Identities = 35/104 (33%), Positives = 55/104 (52%), Gaps = 15/104 (14%)

Query: 323 YCISSLVVSQNSNDIQSIVPSTPNNDIIALES--QDLNS-------HNGDDYN----WNF 369
           YC+S+++ S   + +     S   ND+IA      D +S        NG   N    W+F
Sbjct: 367 YCLSTIIPSTTFSYLLRDFDSNETNDLIAYMDVVTDTDSDFIKDTIDNGQTINLPQTWDF 426

Query: 370 LKLSIKNVYSILKRFITTSINLL--EYKTLNDSNKIIAMSYVLL 411
           L  +++++  I+K  I   I+ L   ++ L+DSN+IIAMSYVLL
Sbjct: 427 LTSTVRHICVIMKYIILKPISFLGSNWQNLDDSNRIIAMSYVLL 470

>SAKL0E14850g Chr5 (1229975..1231387) [1413 bp, 470 aa] {ON} similar
           to uniprot|Q753M9 Ashbya gossypii AFR283W AFR283Wp and
           weakly similar to YIL146C uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 470

 Score = 37.7 bits (86), Expect = 0.052,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 50/95 (52%), Gaps = 10/95 (10%)

Query: 305 KWLFVYYGISITLGVGVGYCISSLVVSQNSNDIQSIVPSTPNNDIIALES----QDLNSH 360
           +W  V +G+S+T+GVG+G CI S ++S  S+ +Q  +P    +D++ +E      D    
Sbjct: 353 RW--VIWGLSLTVGVGIGCCI-SFILSSYSSSVQ--IPHASRDDVVLVEEVPTLPDKAEG 407

Query: 361 NGD-DYNWNFLKLSIKNVYSILKRFITTSINLLEY 394
           NG        L+ ++K    +LK+FI   +  L +
Sbjct: 408 NGPIGQVITLLRKTVKQFNLVLKQFIYEQVGSLSW 442

>Ecym_4021 Chr4 complement(53316..54695) [1380 bp, 459 aa] {ON}
           similar to Ashbya gossypii AFR283W
          Length = 459

 Score = 35.8 bits (81), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 26/88 (29%), Positives = 44/88 (50%), Gaps = 9/88 (10%)

Query: 308 FVYYGISITLGVGVGYCISSLVVSQNSNDIQSIVPSTPNNDII-----ALESQDLNSHNG 362
           +V +  SIT+G+G+G C+S +V    S     +VP     D I     + E  D +SHN 
Sbjct: 344 WVVWTASITIGIGIGCCVSLMV----STRYAFLVPRQLAVDDITSSPLSPEGTDKSSHNL 399

Query: 363 DDYNWNFLKLSIKNVYSILKRFITTSIN 390
             + ++  K S+K + S L+ F +  + 
Sbjct: 400 FLHAYSLCKTSLKKLASSLRPFFSDRLE 427

>Kwal_55.19716 s55 complement(93412..94815) [1404 bp, 467 aa] {ON}
           YIL146C (ECM37) - (putative) involved in cell wall
           biogenesis [contig 159] FULL
          Length = 467

 Score = 35.4 bits (80), Expect = 0.23,   Method: Compositional matrix adjust.
 Identities = 15/27 (55%), Positives = 21/27 (77%), Gaps = 2/27 (7%)

Query: 305 KWLFVYYGISITLGVGVGYCISSLVVS 331
           +W  V + IS+T+GVG+GYCIS L+ S
Sbjct: 348 RW--VIWSISLTVGVGIGYCISCLLSS 372

>KNAG0L02100 Chr12 (374542..375876) [1335 bp, 444 aa] {ON} Anc_5.699
           YIL146C
          Length = 444

 Score = 32.0 bits (71), Expect = 2.8,   Method: Compositional matrix adjust.
 Identities = 14/28 (50%), Positives = 21/28 (75%), Gaps = 3/28 (10%)

Query: 305 KWLFVYYGISITLGVGVG-YCISSLVVS 331
           +WL   +G+SI+LG+G G YC+S +V S
Sbjct: 323 RWLL--WGVSISLGIGAGYYCVSYVVSS 348

>KLTH0E01122g Chr5 complement(110889..112307) [1419 bp, 472 aa] {ON}
           weakly similar to uniprot|P40458 Saccharomyces
           cerevisiae YIL146C ECM37 Non-essential protein of
           unknown function
          Length = 472

 Score = 31.2 bits (69), Expect = 4.9,   Method: Compositional matrix adjust.
 Identities = 12/21 (57%), Positives = 17/21 (80%), Gaps = 2/21 (9%)

Query: 305 KWLFVYYGISITLGVGVGYCI 325
           +W  V + IS+T+GVG+GYCI
Sbjct: 355 RW--VIWSISLTVGVGLGYCI 373

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.319    0.137    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,699,718
Number of extensions: 1109852
Number of successful extensions: 4323
Number of sequences better than 10.0: 18
Number of HSP's gapped: 4436
Number of HSP's successfully gapped: 19
Length of query: 411
Length of database: 53,481,399
Length adjustment: 112
Effective length of query: 299
Effective length of database: 40,638,807
Effective search space: 12151003293
Effective search space used: 12151003293
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.4 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.8 bits)
S2: 67 (30.4 bits)