Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_2001.727.345ON1091094133e-53
NCAS0H021005.443ON126943642.1
KAFR0D015908.788ON28346606.2
TBLA0D00130singletonON31642597.3
NOTE: 16 genes in the same pillar as Kpol_2001.72 were not hit in these BLAST results
LIST: Zrou_YGOB_Anc_7.345 KAFR0L01475 Skud_12.267 CAGL0A03883g Smik_12.262 YLR204W Suva_10.298 KLTH0H01364g Kwal_56.24628 ACL153C Ecym_4728 TPHA0D04575 KLLA0D12452g KNAG0B02635 NDAI0E04490 SAKL0F11264g

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_2001.72
         (109 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_2001.72 s2001 complement(197460..197789) [330 bp, 109 aa] {...   163   3e-53
NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {...    29   2.1  
KAFR0D01590 Chr4 complement(315588..316439) [852 bp, 283 aa] {ON...    28   6.2  
TBLA0D00130 Chr4 complement(25176..26126) [951 bp, 316 aa] {ON}        27   7.3  

>Kpol_2001.72 s2001 complement(197460..197789) [330 bp, 109 aa] {ON}
           complement(197460..197789) [330 nt, 110 aa]
          Length = 109

 Score =  163 bits (413), Expect = 3e-53,   Method: Compositional matrix adjust.
 Identities = 82/109 (75%), Positives = 82/109 (75%)

Query: 1   MMFRSVLGVSAKQGFFNVGKLVSTTKLSPISIITPSFRQCLSTYSQFDSTNNIPNPAIIN 60
           MMFRSVLGVSAKQGFFNVGKLVSTTKLSPISIITPSFRQCLSTYSQFDSTNNIPNPAIIN
Sbjct: 1   MMFRSVLGVSAKQGFFNVGKLVSTTKLSPISIITPSFRQCLSTYSQFDSTNNIPNPAIIN 60

Query: 61  WLPLSEPNNNVSLELDSVXXXXXXXXXXXXXXXXXXXXXXXXXXXSQGK 109
           WLPLSEPNNNVSLELDSV                           SQGK
Sbjct: 61  WLPLSEPNNNVSLELDSVMRKRKKKMKKHKLRKRRKREKAEKRKLSQGK 109

>NCAS0H02100 Chr8 complement(406897..410706) [3810 bp, 1269 aa] {ON}
            Anc_5.443 YOR124C
          Length = 1269

 Score = 29.3 bits (64), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 13/43 (30%), Positives = 25/43 (58%)

Query: 1    MMFRSVLGVSAKQGFFNVGKLVSTTKLSPISIITPSFRQCLST 43
            ++ R+ +G+S K  +  +GKL+S+  L    II P   + +S+
Sbjct: 1106 LLSRNSVGLSKKDSYIELGKLLSSDSLESQGIILPEKDEMVSS 1148

>KAFR0D01590 Chr4 complement(315588..316439) [852 bp, 283 aa] {ON}
           Anc_8.788 YOR311C
          Length = 283

 Score = 27.7 bits (60), Expect = 6.2,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 21/46 (45%)

Query: 30  ISIITPSFRQCLSTYSQFDSTNNIPNPAIINWLPLSEPNNNVSLEL 75
           ++  T  F  CL+ Y  F    ++  P  I W P +   N VSL +
Sbjct: 198 LAAFTVGFTVCLTFYGYFVPAFDVNKPGEIEWTPETSRLNLVSLSV 243

>TBLA0D00130 Chr4 complement(25176..26126) [951 bp, 316 aa] {ON} 
          Length = 316

 Score = 27.3 bits (59), Expect = 7.3,   Method: Compositional matrix adjust.
 Identities = 15/42 (35%), Positives = 23/42 (54%), Gaps = 4/42 (9%)

Query: 15  FFNVGKLVSTTKLSPISIITPSF--RQCLSTYSQ--FDSTNN 52
           FF +G +     ++P+ I+  SF  R+C + Y    FDST N
Sbjct: 99  FFELGSINFIQSMNPLKIVKCSFKLRECETIYQDLPFDSTKN 140

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.130    0.375 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 9,129,383
Number of extensions: 342791
Number of successful extensions: 1028
Number of sequences better than 10.0: 12
Number of HSP's gapped: 1028
Number of HSP's successfully gapped: 12
Length of query: 109
Length of database: 53,481,399
Length adjustment: 79
Effective length of query: 30
Effective length of database: 44,422,785
Effective search space: 1332683550
Effective search space used: 1332683550
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 59 (27.3 bits)