Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_2001.717.343ON72672635430.0
NCAS0A141107.343ON75376124850.0
TDEL0C020407.343ON70570924750.0
CAGL0I03410g7.343ON72470724540.0
KNAG0C037407.343ON72770924310.0
NDAI0A019407.343ON76561524220.0
Suva_4.827.343ON75573923920.0
Skud_4.937.343ON75573823810.0
SAKL0F10912g7.343ON69370223790.0
Smik_4.747.343ON84561823760.0
YDL164C (CDC9)7.343ON75572823590.0
ZYRO0F11572g7.343ON73170723490.0
KAFR0B008307.343ON71063523260.0
Kwal_56.246167.343ON71571922970.0
KLTH0H01408g7.343ON72371922710.0
TPHA0D045707.343ON73671922670.0
KLLA0D12496g7.343ON70065321840.0
ACL155W7.343ON69769721640.0
TBLA0E020507.343ON72064120870.0
TDEL0G045106.18ON9692362602e-22
NCAS0D026506.18ON9502442584e-22
YOR005C (DNL4)6.18ON9444252504e-21
ZYRO0C07854g6.18ON9443822495e-21
TBLA0G010406.18ON9722432479e-21
Smik_15.1746.18ON9452572451e-20
CAGL0E02695g6.18ON9462442442e-20
TPHA0M002606.18ON9664232442e-20
ACR008W6.18ON9814082406e-20
Kwal_56.224146.18ON9632712381e-19
KNAG0F028706.18ON9542722318e-19
NDAI0I022606.18ON9672692301e-18
KLTH0C11286g6.18ON9514212272e-18
KLLA0D01089g6.18ON9073942254e-18
Kpol_1032.76.18ON9652112211e-17
Suva_15.1806.18ON9482602201e-17
Skud_15.1666.18ON9472612192e-17
KAFR0A050506.18ON9484332093e-16
Smik_8.2884.369ON30962699.3
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_2001.71
         (726 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON} (1951...  1369   0.0  
NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON} Anc_7...   961   0.0  
TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {O...   957   0.0  
CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {...   949   0.0  
KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.3...   941   0.0  
NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {O...   937   0.0  
Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}...   926   0.0  
Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}...   921   0.0  
SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {...   920   0.0  
Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}...   919   0.0  
YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}  ...   913   0.0  
ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} simila...   909   0.0  
KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.3...   900   0.0  
Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL1...   889   0.0  
KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {...   879   0.0  
TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.3...   877   0.0  
KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]...   845   0.0  
ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homo...   838   0.0  
TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.3...   808   0.0  
TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.1...   104   2e-22
NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.1...   103   4e-22
YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON} ...   100   4e-21
ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} simila...   100   5e-21
TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {O...   100   9e-21
Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {...    99   1e-20
CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {...    99   2e-20
TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON...    99   2e-20
ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic ho...    97   6e-20
Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {...    96   1e-19
KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.1...    94   8e-19
NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {O...    93   1e-18
KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} simila...    92   2e-18
KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {O...    91   4e-18
Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON...    90   1e-17
Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {...    89   1e-17
Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {...    89   2e-17
KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6...    85   3e-16
Smik_8.288 Chr8 complement(472376..473305) [930 bp, 309 aa] {ON}...    31   9.3  

>Kpol_2001.71 s2001 (195103..197283) [2181 bp, 726 aa] {ON}
           (195103..197283) [2181 nt, 727 aa]
          Length = 726

 Score = 1369 bits (3543), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 674/726 (92%), Positives = 674/726 (92%)

Query: 1   MLKSLYATHWRYIIMSGSSAVNGGGAKKQATLARFFSSMPKRXXXXXXXXXXXXXXXXXX 60
           MLKSLYATHWRYIIMSGSSAVNGGGAKKQATLARFFSSMPKR                  
Sbjct: 1   MLKSLYATHWRYIIMSGSSAVNGGGAKKQATLARFFSSMPKRKIDDDSSTDSTTINKDDD 60

Query: 61  XXXXXXXXLNSDETPTTSAGSVTSKDEPSLTSSPQKPIVTPAKVPSNTKPVKFFSTVPYA 120
                   LNSDETPTTSAGSVTSKDEPSLTSSPQKPIVTPAKVPSNTKPVKFFSTVPYA
Sbjct: 61  SDTSKKIKLNSDETPTTSAGSVTSKDEPSLTSSPQKPIVTPAKVPSNTKPVKFFSTVPYA 120

Query: 121 DLCEVFQEVESTSSRLSIIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDYEPXXXXXX 180
           DLCEVFQEVESTSSRLSIIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDYEP      
Sbjct: 121 DLCEVFQEVESTSSRLSIIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDYEPGLELGL 180

Query: 181 XXXXXMKTISESCGKSMQQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLK 240
                MKTISESCGKSMQQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLK
Sbjct: 181 GEGLLMKTISESCGKSMQQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLK 240

Query: 241 DIAQSQGKDSQQRKMRLIKRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLL 300
           DIAQSQGKDSQQRKMRLIKRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLL
Sbjct: 241 DIAQSQGKDSQQRKMRLIKRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLL 300

Query: 301 NEYETSKDPSMELIETAEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKP 360
           NEYETSKDPSMELIETAEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKP
Sbjct: 301 NEYETSKDPSMELIETAEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKP 360

Query: 361 MLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELH 420
           MLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELH
Sbjct: 361 MLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELH 420

Query: 421 IEDFLVKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLF 480
           IEDFLVKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLF
Sbjct: 421 IEDFLVKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLF 480

Query: 481 AFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDS 540
           AFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDS
Sbjct: 481 AFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDS 540

Query: 541 CEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMXXXXXXXXXXXXXXX 600
           CEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVM               
Sbjct: 541 CEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMGAYYGKGKRTGTYGG 600

Query: 601 FLLGCYNQDSGEYETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFE 660
           FLLGCYNQDSGEYETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFE
Sbjct: 601 FLLGCYNQDSGEYETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFE 660

Query: 661 PKVLFEVLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYEN 720
           PKVLFEVLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYEN
Sbjct: 661 PKVLFEVLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYEN 720

Query: 721 QSHIQS 726
           QSHIQS
Sbjct: 721 QSHIQS 726

>NCAS0A14110 Chr1 (2774465..2776726) [2262 bp, 753 aa] {ON}
           Anc_7.343 YDL164C
          Length = 753

 Score =  961 bits (2485), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 487/761 (63%), Positives = 575/761 (75%), Gaps = 44/761 (5%)

Query: 1   MLKSLYATHWRYIIMSGSSAVNGGGAKKQ--ATLARFFSSMPKRXXXXXXXXXXXXXXXX 58
           ML+S+ A    +II     +   G  KKQ  ATLA+FFSSM K                 
Sbjct: 1   MLRSILAGKKPFIIPKSIMSSPAGFPKKQKQATLAKFFSSM-KNEKPADKKDPEDSTTTT 59

Query: 59  XXXXXXXXXXLNSDET-------PTTSAGSVTSKDEPSLTSSPQKPIVT----------- 100
                      NS +T       P ++  S +S+    + S+P  P ++           
Sbjct: 60  TEKPSLSPYTANSKKTFEEILNRPASNLAS-SSQGVSDIASTPSIPNISTDESTGPDLKK 118

Query: 101 ---------PAKVPS-------NTKPVKFFSTVPYADLCEVFQEVESTSSRLSIIKICSD 144
                    P+K P+       +TKP  +FS++PY ++C +FQE+ESTSSRL+IIK+CSD
Sbjct: 119 QKLEESNLEPSKEPTIENVTQDSTKP--YFSSIPYREVCNLFQEIESTSSRLAIIKLCSD 176

Query: 145 FLIKVMKQDPQNLVPITYLFINKLGPDYEPXXXXXXXXXXXMKTISESCGKSMQQLKNQY 204
           F IK+MK++PQNL+P+TYLFINKLGPDYEP           MKTISESCGKS+ Q++N+Y
Sbjct: 177 FFIKIMKENPQNLIPVTYLFINKLGPDYEPGLELGLGEGLLMKTISESCGKSLAQVRNKY 236

Query: 205 REIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQSQGKDSQQRKMRLIKRMLTA 264
           RE+GDLGQIA DARNVQPTMFKPKPLTVGEVF+NL+ IA+S+GKDSQ RK++LIKRMLTA
Sbjct: 237 RELGDLGQIAMDARNVQPTMFKPKPLTVGEVFENLRLIAKSEGKDSQTRKIKLIKRMLTA 296

Query: 265 CKGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLNEYETSKDPSMELIETAEEKIRDA 324
           C+G EAKFLIRSLESKLRIGLAEKTVLISLSKALL++E + +KD  MEL+ETAE+KIRDA
Sbjct: 297 CEGTEAKFLIRSLESKLRIGLAEKTVLISLSKALLVHECKDNKDFDMELLETAEQKIRDA 356

Query: 325 FCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCE 384
           FCQVPNYEI+I SCL  GIMEL+ +C LRPGIPLKPMLAKPTKAINE+LD FQGE FT E
Sbjct: 357 FCQVPNYEIVINSCLKYGIMELETHCSLRPGIPLKPMLAKPTKAINEILDRFQGEIFTSE 416

Query: 385 YKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFLVKDESNTDKEVSLILDCEV 444
           YKYDGER QVHLLS+G MRIYSRNGENMTERYPE+HI DF+      +    +LILDCE 
Sbjct: 417 YKYDGERAQVHLLSDGTMRIYSRNGENMTERYPEIHIRDFIADPLVTS----TLILDCEA 472

Query: 445 VAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDILYYNGEGLITKTLRERRKIL 504
           VAWDNEQNKILPFQVLSTRKRK V+LKDVKV+VCLFAFDIL +N E LI K+LRERR+IL
Sbjct: 473 VAWDNEQNKILPFQVLSTRKRKDVDLKDVKVKVCLFAFDILCHNDEKLINKSLRERRQIL 532

Query: 505 HEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRN 564
            EVTK V GEFQYAT + ++ LDE+QKFLDQ++ DSCEGLMVK+LDG ES YEPSKRSRN
Sbjct: 533 QEVTKSVTGEFQYATEMTSSNLDELQKFLDQSVHDSCEGLMVKMLDGIESHYEPSKRSRN 592

Query: 565 WLKLKKDYLAGVGDSLDLCVMXXXXXXXXXXXXXXXFLLGCYNQDSGEYETCCKIGTGFS 624
           WLKLKKDYL G+GDSLDLCV+               FLLGCYNQD+GE+ETCCKIGTGFS
Sbjct: 593 WLKLKKDYLEGIGDSLDLCVIGAYYGRGKRTGMYGGFLLGCYNQDTGEFETCCKIGTGFS 652

Query: 625 DEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLFEVLTADLSLSPIYKAGSAT 684
           DEML +LY       ++ PK+ + +DSSAEPD+WFEP +LFEVLTADLSLSPIYKAGS+T
Sbjct: 653 DEMLQQLYTRLTPTVLDGPKATFVYDSSAEPDVWFEPTLLFEVLTADLSLSPIYKAGSST 712

Query: 685 YDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHIQ 725
           YDKGISLRFPRF+R R+DK VEDATSS+QIIE+YENQ+H Q
Sbjct: 713 YDKGISLRFPRFIRTREDKGVEDATSSEQIIELYENQAHTQ 753

>TDEL0C02040 Chr3 complement(352579..354696) [2118 bp, 705 aa] {ON}
           Anc_7.343 YDL164C
          Length = 705

 Score =  957 bits (2475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 479/709 (67%), Positives = 552/709 (77%), Gaps = 23/709 (3%)

Query: 21  VNGG--GAKKQATLARFFSSMPKRXXXXXXXXXXXXXXXXXXXXXXXXXXLNSDETPTTS 78
           +N G    KKQATLARFFS++ K                            N DE  T  
Sbjct: 14  INKGMSSGKKQATLARFFSAVQKDDTKEKVNGDVKIIESRD----------NQDEPVTKK 63

Query: 79  AGSVTSKDEPSLTSSPQKPIVTPAKVPSNTKPVK---FFSTVPYADLCEVFQEVESTSSR 135
             S +     + + SP    V  A V S  KPV    ++S VPY+D+C VFQE+E TSSR
Sbjct: 64  FKSSSPVKLQTSSLSP----VKSAGVESGDKPVSPDLYYSKVPYSDVCNVFQEIEGTSSR 119

Query: 136 LSIIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDYEPXXXXXXXXXXXMKTISESCGK 195
           LSIIKICS+F  ++MK +PQNL+P TYLFIN+LGPDYEP           MKTISE+CGK
Sbjct: 120 LSIIKICSEFFSRIMKDNPQNLIPTTYLFINRLGPDYEPGLELGLGEGLLMKTISEACGK 179

Query: 196 SMQQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQSQGKDSQQRKM 255
           S+ Q+KN+YRE+GDLGQIA +ARNVQPTMFKPKPLTVGEVF+NL+ IA SQGKDSQ RK+
Sbjct: 180 SLVQVKNRYREMGDLGQIALEARNVQPTMFKPKPLTVGEVFENLRAIAHSQGKDSQTRKI 239

Query: 256 RLIKRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLNEYETSKDPSMELIE 315
           +LIKRMLTAC+GVEAKFLIRSLESKLRIGLAEKTVLISLSKALL NE ET K+PSMEL+E
Sbjct: 240 KLIKRMLTACEGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLTNEGETGKEPSMELVE 299

Query: 316 TAEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDA 375
            AE KIRDAFCQVPNYEI+I +CL+ GIMELD +C+LRPGIPLKPMLAKPTK+I EVLD 
Sbjct: 300 QAEAKIRDAFCQVPNYEIVINACLDYGIMELDKHCRLRPGIPLKPMLAKPTKSITEVLDR 359

Query: 376 FQGEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFLVKDESNTDKE 435
           FQG+ FT EYKYDGER QVHLL +G MRIYSRNGENMTERYPE+ I DF V D  +T   
Sbjct: 360 FQGQTFTSEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEISIRDF-VADLEHTK-- 416

Query: 436 VSLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDILYYNGEGLITK 495
            +LILDCE VAWD  Q KILPFQVLSTRKRK VE KDVKVRVCLFAFDI+ +NGE  I K
Sbjct: 417 -TLILDCEAVAWDKVQQKILPFQVLSTRKRKDVEAKDVKVRVCLFAFDIICHNGERQINK 475

Query: 496 TLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESR 555
           +LRERR++L +VTK V GEFQYA  L T+ ++E+QKFLDQ++KDSCEGLMVK+LDG ES 
Sbjct: 476 SLRERRELLAQVTKPVAGEFQYAVELTTSSVEELQKFLDQSVKDSCEGLMVKMLDGPESH 535

Query: 556 YEPSKRSRNWLKLKKDYLAGVGDSLDLCVMXXXXXXXXXXXXXXXFLLGCYNQDSGEYET 615
           YEPSKRSRNWLKLKKDYL GVGDSLDLCV+               FLLGCYNQDSGE+ET
Sbjct: 536 YEPSKRSRNWLKLKKDYLDGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDSGEFET 595

Query: 616 CCKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLFEVLTADLSLS 675
           CCKIGTGFSDEML +LYE F +  ++ PK+ Y FDSSAEPD+WFEP  LFEVLTADLSLS
Sbjct: 596 CCKIGTGFSDEMLQQLYERFSKTTLDGPKATYVFDSSAEPDVWFEPTTLFEVLTADLSLS 655

Query: 676 PIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHI 724
           P+YKAG++TYDKG+SLRFPRF+R+RDDKSVEDATSS QI+E+Y++QSH+
Sbjct: 656 PVYKAGASTYDKGVSLRFPRFVRLRDDKSVEDATSSAQIVELYQDQSHV 704

>CAGL0I03410g Chr9 complement(289606..291780) [2175 bp, 724 aa] {ON}
           highly similar to uniprot|P04819 Saccharomyces
           cerevisiae YDL164c CDC9 DNA ligase
          Length = 724

 Score =  949 bits (2454), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 474/707 (67%), Positives = 554/707 (78%), Gaps = 21/707 (2%)

Query: 27  KKQATLARFFSSMPKRXXXXXXXXXXXXXXXXXXXXXXXXXXLNSDETPTT-----SAGS 81
           K+QATLARFFSS+ K                           ++++++P       S GS
Sbjct: 28  KRQATLARFFSSVKK---DADGDKKGEQADVKTAAVDLNSHEVDANKSPLKKMKLESTGS 84

Query: 82  VTSKDEPSLTSSPQK--PIV-TPAKVPSNTKPVKFFSTVPYADLCEVFQEVESTSSRLSI 138
           +T+    +      +  PI  TP +V S     KFF  VPY+DLC +F+E+E TSSRL+I
Sbjct: 85  LTATKNGNQGKEEHEGTPIASTPRQVDS-----KFFCKVPYSDLCNLFEEIEGTSSRLAI 139

Query: 139 IKICSDFLIKVMKQDPQNLVPITYLFINKLGPDYEPXXXXXXXXXXXMKTISESCGKSMQ 198
           IK+CSDF IK+MK+DPQNL+P+TYLFINKLGPDYEP           MKTISESCGKSMQ
Sbjct: 140 IKLCSDFFIKIMKEDPQNLIPVTYLFINKLGPDYEPGLELGLGENLLMKTISESCGKSMQ 199

Query: 199 QLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQSQGKDSQQRKMRLI 258
           Q+KNQYREIGDLGQIA +ARNVQPTMFKPKPL VGEVF+NLK IA+SQGKDSQ +KM+LI
Sbjct: 200 QIKNQYREIGDLGQIALEARNVQPTMFKPKPLVVGEVFENLKTIAKSQGKDSQTKKMKLI 259

Query: 259 KRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLN-EYETSKDPSMELIETA 317
           KRMLTAC+G EAKFLIRSLESKLRIGLAEKTVLI+LSKALL++ E  ++K+PSM+++E A
Sbjct: 260 KRMLTACQGTEAKFLIRSLESKLRIGLAEKTVLIALSKALLIHDEKYSNKEPSMDVVEQA 319

Query: 318 EEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAFQ 377
           E+KIRDAFCQVPNYE++I +CL+ GIM+LD +C ++PGIPLKPMLAKPTKAINEVLD FQ
Sbjct: 320 EQKIRDAFCQVPNYELVINACLDYGIMKLDEHCTIQPGIPLKPMLAKPTKAINEVLDRFQ 379

Query: 378 GEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFLVKDESNTDKEVS 437
           G+ FT EYKYDGER QVHLL +G MRIYSRNGENMTERYPE+ I+DFL    S T    S
Sbjct: 380 GQTFTSEYKYDGERAQVHLLKDGTMRIYSRNGENMTERYPEIQIKDFLADPASTT----S 435

Query: 438 LILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDILYYNGEGLITKTL 497
           LILDCE VAWD EQNKILPFQVL+TRKRK V + +VKVRVCLFAFDIL +N   LI + L
Sbjct: 436 LILDCEAVAWDKEQNKILPFQVLTTRKRKDVNINEVKVRVCLFAFDILLHNDMRLINEPL 495

Query: 498 RERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYE 557
            +RR++LHEVTK V GEFQYAT + T+ LDE+QKFLD+++K+SCEGLMVK++DG ES YE
Sbjct: 496 SKRREVLHEVTKPVEGEFQYATQMTTSNLDELQKFLDESVKNSCEGLMVKMMDGVESYYE 555

Query: 558 PSKRSRNWLKLKKDYLAGVGDSLDLCVMXXXXXXXXXXXXXXXFLLGCYNQDSGEYETCC 617
           PSKRSRNWLKLKKDYL GVGDSLDLCV+               FLLGCYN DS ++ETCC
Sbjct: 556 PSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYFGRGKRTGTYGGFLLGCYNADSEDFETCC 615

Query: 618 KIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLFEVLTADLSLSPI 677
           KIGTGFS+EML  LYE      I+ PK  Y FDSSAEPD+WFEP +LFEVLTADLSLSPI
Sbjct: 616 KIGTGFSEEMLQTLYEKLSPTVIDGPKGTYVFDSSAEPDVWFEPTMLFEVLTADLSLSPI 675

Query: 678 YKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHI 724
           YKAGS+ YDKGISLRFPRFLRIRDDKSVEDATSS+QIIEMY+NQSH+
Sbjct: 676 YKAGSSVYDKGISLRFPRFLRIRDDKSVEDATSSEQIIEMYQNQSHV 722

>KNAG0C03740 Chr3 (737968..740151) [2184 bp, 727 aa] {ON} Anc_7.343
           YDL164C
          Length = 727

 Score =  941 bits (2431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 462/709 (65%), Positives = 547/709 (77%), Gaps = 14/709 (1%)

Query: 27  KKQATLARFFSSM-------PKRXXXXXXXXXXXXXXXXXXXXXXXXXXLNSDETPTTSA 79
           K+Q TL  FF+S+       P                            ++ D  P  S+
Sbjct: 22  KRQMTLNNFFTSVKKSDTNTPASTTPKKMEKDESPQIPATKTAEEKHENMDVDTDPVISS 81

Query: 80  GSVTSKDEPSLTSSPQKPIVTPA-KVPSNTKPVK-FFSTVPYADLCEVFQEVESTSSRLS 137
             V++K    LTS    P+V+   K+       K F+STVPYADLC +FQE+E  SSRL+
Sbjct: 82  SEVSAKRNSPLTSPSPTPVVSKKIKIQDENNDTKEFYSTVPYADLCNLFQEIEGISSRLA 141

Query: 138 IIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDYEPXXXXXXXXXXXMKTISESCGKSM 197
           IIK+CS FLI VMK DP+NL+P+TYLFINKLGPDY P           +KTI+ESCG+S+
Sbjct: 142 IIKLCSSFLISVMKLDPRNLIPMTYLFINKLGPDYMPGLELGLGENLLIKTIAESCGRSL 201

Query: 198 QQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQSQGKDSQQRKMRL 257
           QQ+K +Y EIGDLGQIA +AR VQPTMFKPKPLTVGEVFQNLK IA SQGKDSQ +K++L
Sbjct: 202 QQIKTKYHEIGDLGQIALEARKVQPTMFKPKPLTVGEVFQNLKSIASSQGKDSQTKKIKL 261

Query: 258 IKRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLNEY-ETSKDPSMELIET 316
           IKRMLT+C+GVEAKFLIRSLESKLRIGLAEKTVLISLSKALL+ EY E+ KD  ME +E 
Sbjct: 262 IKRMLTSCQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLVYEYGESDKDIDMETVEN 321

Query: 317 AEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAF 376
           AE+KIRDAFCQVPNYE++I SCL  GIM LD +C LRP IPLKPMLAKPTK+I+E+ D F
Sbjct: 322 AEQKIRDAFCQVPNYEVVIDSCLKHGIMNLDQHCSLRPAIPLKPMLAKPTKSISEIFDRF 381

Query: 377 QGEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFLVKDESNTDKEV 436
           Q ++FTCEYKYDGER QVHLL +G MRIYSRNGENMTERYPE+HI DF V D S+T    
Sbjct: 382 QDQKFTCEYKYDGERAQVHLLEDGTMRIYSRNGENMTERYPEIHIRDF-VTDLSHTK--- 437

Query: 437 SLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDILYYNGEGLITKT 496
           SLILDCE VAWD EQNKILPFQVLSTRKRK V++ ++KVRVCLFAFDIL +N E LI K+
Sbjct: 438 SLILDCEAVAWDKEQNKILPFQVLSTRKRKDVDINEIKVRVCLFAFDILLHNDEKLINKS 497

Query: 497 LRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRY 556
           L+ERR ILH +TK V GEFQ+AT + T  L+E+Q FLDQ++K+SCEGLMVK+L+GEES Y
Sbjct: 498 LQERRDILHSITKEVTGEFQFATEMTTTNLEELQSFLDQSVKNSCEGLMVKMLEGEESHY 557

Query: 557 EPSKRSRNWLKLKKDYLAGVGDSLDLCVMXXXXXXXXXXXXXXXFLLGCYNQDSGEYETC 616
           EPSKRSRNWLKLKKDYLAGVGDSLDLCV+               FLLGCYNQD+GE+ET 
Sbjct: 558 EPSKRSRNWLKLKKDYLAGVGDSLDLCVLGAYFGRGKRTGNYGGFLLGCYNQDTGEFETA 617

Query: 617 CKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLFEVLTADLSLSP 676
           CKIGTGFSDE+L +L+E  +   I++PK+ Y FD SAEPD+WFEP +LFEVLTADLSLSP
Sbjct: 618 CKIGTGFSDEVLQQLHERLKSTVIDLPKATYVFDPSAEPDVWFEPTLLFEVLTADLSLSP 677

Query: 677 IYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHIQ 725
           +YKAGS+TYDKG+SLRFPRFLR+R+DK VEDATSS+QI+EMYENQ+++Q
Sbjct: 678 VYKAGSSTYDKGVSLRFPRFLRLREDKGVEDATSSEQIVEMYENQANLQ 726

>NDAI0A01940 Chr1 complement(432302..434599) [2298 bp, 765 aa] {ON}
           Anc_7.343 YDL164C
          Length = 765

 Score =  937 bits (2422), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 451/615 (73%), Positives = 515/615 (83%), Gaps = 5/615 (0%)

Query: 113 FFSTVPYADLCEVFQEVESTSSRLSIIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDY 172
           F   +PY ++C++FQE+E+TSSRLSIIK+CSDFLIK+MKQDPQNL+P+TYLFINKLGPDY
Sbjct: 155 FLCAIPYKEVCQLFQEIETTSSRLSIIKLCSDFLIKIMKQDPQNLIPVTYLFINKLGPDY 214

Query: 173 EPXXXXXXXXXXXMKTISESCGKSMQQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTV 232
           EP           MKTISESCGKS+ Q++ QYRE+GDLGQIA +ARNVQPTMFKPKPLTV
Sbjct: 215 EPGLELGLGEGLLMKTISESCGKSLTQIRAQYRELGDLGQIALEARNVQPTMFKPKPLTV 274

Query: 233 GEVFQNLKDIAQSQGKDSQQRKMRLIKRMLTACK-GVEAKFLIRSLESKLRIGLAEKTVL 291
           GEVF NLK IA++ GKDSQ +K++LIKRMLTAC+ GVEAKFLIRSLESKLRIGLAEKTVL
Sbjct: 275 GEVFNNLKMIAKAAGKDSQTKKIKLIKRMLTACEDGVEAKFLIRSLESKLRIGLAEKTVL 334

Query: 292 ISLSKALLLNEYETSKDPSMELIETAEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCK 351
           ISLSKALL+ E++ +KD  MEL+ETAE KIRDAFCQVPNYEI+I SCL  GIM L+ +C 
Sbjct: 335 ISLSKALLVKEFDANKDFDMELLETAEGKIRDAFCQVPNYEIVINSCLQYGIMNLNEHCS 394

Query: 352 LRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGEN 411
           LRPGIPLKPMLAKPTKAINE+LD FQGE FT EYKYDGER QVHLL +G MRIYSRNGEN
Sbjct: 395 LRPGIPLKPMLAKPTKAINEILDRFQGETFTSEYKYDGERAQVHLLEDGTMRIYSRNGEN 454

Query: 412 MTERYPELHIEDFLVKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELK 471
           MTERYPE+HI DF VKD + T    +LILDCE VAWD EQ KILPFQVLSTRKRK V  K
Sbjct: 455 MTERYPEIHIGDF-VKDRNETK---TLILDCEAVAWDKEQQKILPFQVLSTRKRKDVLAK 510

Query: 472 DVKVRVCLFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQK 531
           DVKVRVCLFAFDIL +N   LI  +L+ERR+ILH VT   PGEFQYAT L T+ LDE+QK
Sbjct: 511 DVKVRVCLFAFDILCHNSNKLINYSLKERREILHRVTTPAPGEFQYATELTTSNLDELQK 570

Query: 532 FLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMXXXXXX 591
           FLDQ++ DSCEGLMVK+L+GEES YEPSKRSRNWLKLKKDYL G+GDSLDLCV+      
Sbjct: 571 FLDQSVNDSCEGLMVKMLEGEESHYEPSKRSRNWLKLKKDYLEGIGDSLDLCVLGAYYGR 630

Query: 592 XXXXXXXXXFLLGCYNQDSGEYETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDS 651
                    FLLGCYN ++GE+ETCCKIGTGFSDEML +L+E  +   I+ PK+ Y +DS
Sbjct: 631 GKRTGTYGGFLLGCYNDNTGEFETCCKIGTGFSDEMLQQLHEKLKATVIDGPKATYIYDS 690

Query: 652 SAEPDIWFEPKVLFEVLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSS 711
           SAEPD+WFEP +LFEVLTADLSLSPIYKAGS+ YDKG+SLRFPRF+RIR+DK VEDATSS
Sbjct: 691 SAEPDVWFEPSLLFEVLTADLSLSPIYKAGSSAYDKGVSLRFPRFIRIREDKGVEDATSS 750

Query: 712 DQIIEMYENQSHIQS 726
           +QIIE+YENQSH  S
Sbjct: 751 EQIIELYENQSHRSS 765

>Suva_4.82 Chr4 complement(152544..154811) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  926 bits (2392), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 466/739 (63%), Positives = 548/739 (74%), Gaps = 30/739 (4%)

Query: 13  IIMSGSSAVNGGGAKKQATLARFFSSM----------PKRXXXXXXXXXXXXXXXXXXXX 62
           + MS S   + G   KQATLARFF+SM          P++                    
Sbjct: 22  LFMSSSLPSSAGKKPKQATLARFFTSMKNKPSGGSSSPEKAVKHKIENGTNEISSEGASA 81

Query: 63  XXXXXXLNSDETPTTSAG--------SVTSKDEPSLTSSPQKPIVTPAKVPSNTKPV--- 111
                 L++ +TP   +           ++     + +S +   +TP KV     P+   
Sbjct: 82  IKKLKHLSAVQTPVEQSDMSSSSSPLPSSAPSSSGVDASQKSRELTP-KVEEEQGPIDND 140

Query: 112 KFFSTVPYADLCEVFQEVESTSSRLSIIKICSDFLIKVMKQDPQNLVPITYLFINKLGPD 171
            + S +PY+++CEVF E+E+ SSRL II+ICSDF IK+MKQ  +NL+P TYLFIN+LGPD
Sbjct: 141 HYSSNIPYSEVCEVFNEIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPD 200

Query: 172 YEPXXXXXXXXXXXMKTISESCGKSMQQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLT 231
           YEP           MKTISESCGKSM Q+K +Y+EIGDLG+IA  ARNVQPTMFKPKPLT
Sbjct: 201 YEPGLELGLGENLLMKTISESCGKSMNQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLT 260

Query: 232 VGEVFQNLKDIAQSQGKDSQQRKMRLIKRMLTACKGVEAKFLIRSLESKLRIGLAEKTVL 291
           VGEVF+NL+ IA++QGKDSQ RKM+LIKRMLTAC+GVEAKFLIRSLESKLRIGLAEKTVL
Sbjct: 261 VGEVFKNLRSIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVL 320

Query: 292 ISLSKALLLN----EYETSKDPSMELIETAEEKIRDAFCQVPNYEIIIQSCLNDGIMELD 347
           ISLSKALLL+    E     D  M+++E+A++KIRDAFCQVPNYEI+I SCL  GIM LD
Sbjct: 321 ISLSKALLLHGGNGENSHVNDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLD 380

Query: 348 NNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGEMRIYSR 407
             C L+PGIPLKPMLAKPTKAINEVLD FQGE FT EYKYDGER QVHLL +G MRIYSR
Sbjct: 381 KFCTLKPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLDDGTMRIYSR 440

Query: 408 NGENMTERYPELHIEDFLVKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKG 467
           NGENMTERYPE+ I DF+     + D   +LILDCE VAWD EQ KILPFQVLSTRKRK 
Sbjct: 441 NGENMTERYPEIKITDFI----QDLDATKNLILDCEAVAWDKEQGKILPFQVLSTRKRKD 496

Query: 468 VELKDVKVRVCLFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELD 527
           VEL DVKVRVCLFAFD+L +NGE LI K+LRERR+ L +VTK VPGEFQYAT ++T  LD
Sbjct: 497 VELSDVKVRVCLFAFDVLCHNGERLINKSLRERRECLTKVTKVVPGEFQYATQIVTDNLD 556

Query: 528 EIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMXX 587
           E+QKFLD+++  SCEGLMVK+L+G ES YEPSKRSRNWLKLKKDYL GVGDSLDLCV+  
Sbjct: 557 ELQKFLDESVNQSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGA 616

Query: 588 XXXXXXXXXXXXXFLLGCYNQDSGEYETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFY 647
                        FLLGCYNQD+GE+ETCCKIGTGFSDE L +L+E      I+ PK+ +
Sbjct: 617 YYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDESLQQLHERLTPTIIDGPKATF 676

Query: 648 NFDSSAEPDIWFEPKVLFEVLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVED 707
            FDSSAEPD+WFEP  LFEVLTADLSLSPIYKAGS T+ KG+SLRFPRFLRIR+DK VED
Sbjct: 677 VFDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFAKGVSLRFPRFLRIREDKGVED 736

Query: 708 ATSSDQIIEMYENQSHIQS 726
           ATSS+QI+E+YENQSH+Q+
Sbjct: 737 ATSSEQIVELYENQSHVQN 755

>Skud_4.93 Chr4 complement(160642..162909) [2268 bp, 755 aa] {ON}
           YDL164C (REAL)
          Length = 755

 Score =  921 bits (2381), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 469/738 (63%), Positives = 551/738 (74%), Gaps = 28/738 (3%)

Query: 13  IIMSGSSAVNGGGAKKQATLARFFSSM----------PKRXXXXXXXXXXXXXXXXXXXX 62
           ++M  S   + G   KQATLARFFSSM          P++                    
Sbjct: 22  LLMPPSLPSSAGKKPKQATLARFFSSMKNEPSGSSSSPEKAPKHKLENNIDNNSSEGADA 81

Query: 63  XXXXXXLNSDET---PTTSAGSVTSKDEP-----SLTSSPQKPIVTPA--KVPSNTKPVK 112
                 +++ +T   P+T   S  S          +  S +    TP   K PS+     
Sbjct: 82  TKKLKQVSTVQTLVAPSTMGSSPFSLPSSAPSSSGVDVSQESREFTPQVEKEPSSNDNDH 141

Query: 113 FFSTVPYADLCEVFQEVESTSSRLSIIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDY 172
           + S +PY+++CEVF ++E+ SSRL II+ICSDF IK+M Q  +NL+P TYLFIN+LGPDY
Sbjct: 142 YSSNIPYSEVCEVFNKIEAISSRLEIIRICSDFFIKIMNQSSKNLIPTTYLFINRLGPDY 201

Query: 173 EPXXXXXXXXXXXMKTISESCGKSMQQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTV 232
           E            MKTISESCGKSM Q+K +Y+E+GDLG+IA  ARNVQPTMFKPK LTV
Sbjct: 202 EAGLELGLGENLLMKTISESCGKSMSQIKLKYKEMGDLGEIAMGARNVQPTMFKPKALTV 261

Query: 233 GEVFQNLKDIAQSQGKDSQQRKMRLIKRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLI 292
           GEVF+NL+ IA++QGKDSQ RKM+LIKRMLTAC+GVEAKFLIRSLESKLRIGLAEKTVLI
Sbjct: 262 GEVFKNLRTIAKTQGKDSQLRKMKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 321

Query: 293 SLSKALLLNEYETSKDPS----MELIETAEEKIRDAFCQVPNYEIIIQSCLNDGIMELDN 348
           SLSKALLL++      P     M+++E+A+++IRDAFCQVPNYEI+I SCLN GIM LD 
Sbjct: 322 SLSKALLLHDENKENSPDKEIPMDVLESAQQRIRDAFCQVPNYEIVINSCLNHGIMNLDK 381

Query: 349 NCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGEMRIYSRN 408
            C LRPGIPLKPMLAKPTKAINEVLD FQGE FT EYKYDGER QVHLL++G MRIYSRN
Sbjct: 382 YCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRN 441

Query: 409 GENMTERYPELHIEDFLVKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKGV 468
           GENMTERYPE+ I DF ++D ++T    +LILDCE VAWD EQ KILPFQ+LSTRKRK V
Sbjct: 442 GENMTERYPEIKITDF-IQDLNSTK---NLILDCEAVAWDKEQKKILPFQILSTRKRKDV 497

Query: 469 ELKDVKVRVCLFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDE 528
           EL DVKV+VCLFAFDIL YN E LI K+LRERR+ L +VTK VPGEFQYAT +IT  LDE
Sbjct: 498 ELHDVKVKVCLFAFDILCYNDERLINKSLRERREHLAKVTKVVPGEFQYATQIITNNLDE 557

Query: 529 IQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMXXX 588
           +QKFLD+++ +SCEGLMVK+LDG ES YEPSKRSRNWLKLKKDYL GVGDSLDLCV+   
Sbjct: 558 LQKFLDESVNNSCEGLMVKMLDGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAY 617

Query: 589 XXXXXXXXXXXXFLLGCYNQDSGEYETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFYN 648
                       FLLGCYNQD+GE+ETCCKIGTGFSDEML  L+E      I+ PK+ + 
Sbjct: 618 YGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHERLTPTIIDGPKATFV 677

Query: 649 FDSSAEPDIWFEPKVLFEVLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDA 708
           FD+SAEPD+WFEP  LFEVLTADLSLSPIYKAGSAT+DKG+SLRFPRFLRIR+DK VEDA
Sbjct: 678 FDASAEPDVWFEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDA 737

Query: 709 TSSDQIIEMYENQSHIQS 726
           TSSDQIIE+YENQSH+Q+
Sbjct: 738 TSSDQIIELYENQSHVQN 755

>SAKL0F10912g Chr6 complement(854430..856511) [2082 bp, 693 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 693

 Score =  920 bits (2379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 455/702 (64%), Positives = 537/702 (76%), Gaps = 24/702 (3%)

Query: 27  KKQATLARFFSSMPKRXXXXXXXXXXXXXXXXXXXXXXXXXXLNSDETPTTSAGSVTSKD 86
           KKQ TLARFFSS  K                            N+ E  T  A  V    
Sbjct: 12  KKQVTLARFFSSAKKGGNKEDKLEPQAKRAKVDPA--------NTSELITNEA--VARSV 61

Query: 87  EPSLTSSPQKPIV---TPAKVPSNTKPVKFFSTVPYADLCEVFQEVESTSSRLSIIKICS 143
            P     P  PI+   TP   P +       S +PY+D+C +F E+ESTSSRLSI+KICS
Sbjct: 62  SPPTPVVPVAPIISTSTPVMAPVH------HSKIPYSDVCNIFSEIESTSSRLSIVKICS 115

Query: 144 DFLIKVMKQDPQNLVPITYLFINKLGPDYEPXXXXXXXXXXXMKTISESCGKSMQQLKNQ 203
           +F   V+KQ+P NLVPITYLFIN+LGPDYEP           MKTI+ESCGKS+QQ++ +
Sbjct: 116 NFFYSVLKQNPSNLVPITYLFINRLGPDYEPGLELGLGEGLLMKTIAESCGKSLQQVRAK 175

Query: 204 YREIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQSQGKDSQQRKMRLIKRMLT 263
           YREIGDLG++AQ+AR VQPTMFKPKPLTVGEVF NLK IA+SQGKDSQ RK++LIKRMLT
Sbjct: 176 YREIGDLGEVAQEARAVQPTMFKPKPLTVGEVFNNLKSIAKSQGKDSQTRKIQLIKRMLT 235

Query: 264 ACKGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLNEYETSKDPSMELIETAEEKIRD 323
           AC+GVEAKFLIRSLESKLRIGLAEKTVLISLSKALL  E++  ++PS EL+E AE+++RD
Sbjct: 236 ACQGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLSYEHD-GEEPSSELVENAEQRVRD 294

Query: 324 AFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTC 383
           AFCQVPNYEI+I +CL  GIME++ +C L+PGIPLKPMLAKP+K+I EVLD F GE+FTC
Sbjct: 295 AFCQVPNYEIVINTCLEHGIMEVNKHCVLKPGIPLKPMLAKPSKSITEVLDRFHGEKFTC 354

Query: 384 EYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFLVKDESNTDKEVSLILDCE 443
           EYKYDGER QVHLL +G M IYSRNGENMTERYPELHI D+L   E+      SLILDCE
Sbjct: 355 EYKYDGERAQVHLLPDGSMNIYSRNGENMTERYPELHIRDYLADPETTH----SLILDCE 410

Query: 444 VVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDILYYNGEGLITKTLRERRKI 503
            VAWD EQ KILPFQ+LSTRKRKGVE KDVKVRVCLFAFD+L YNG+ LI  +L ERR+ 
Sbjct: 411 AVAWDTEQGKILPFQILSTRKRKGVEAKDVKVRVCLFAFDMLCYNGQSLINNSLLERREY 470

Query: 504 LHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSR 563
           L  V K V G+FQ+A  L ++ L+++QK+L+Q++KD+CEGLMVK+L+GEES YEPSKRSR
Sbjct: 471 LQRVLKPVTGQFQFANELNSSNLEDVQKYLEQSVKDACEGLMVKVLEGEESHYEPSKRSR 530

Query: 564 NWLKLKKDYLAGVGDSLDLCVMXXXXXXXXXXXXXXXFLLGCYNQDSGEYETCCKIGTGF 623
           NWLKLKKDYL GVGDSLDLCV+               FLLGCYNQD+GE+ETCCKIGTGF
Sbjct: 531 NWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGF 590

Query: 624 SDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLFEVLTADLSLSPIYKAGSA 683
           SDEML  LYE  +   +E PK+FY +DSSAEPD+WFEP +LFEVLTADLSLSPIYKAG++
Sbjct: 591 SDEMLVSLYEKLKPSSLEQPKAFYVYDSSAEPDVWFEPTMLFEVLTADLSLSPIYKAGNS 650

Query: 684 TYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHIQ 725
            Y KGISLRFPRF+RIRDDK VEDATSS+QI+E+YE+Q ++Q
Sbjct: 651 AYGKGISLRFPRFIRIRDDKDVEDATSSEQIVELYESQVNLQ 692

>Smik_4.74 Chr4 complement(141744..144281) [2538 bp, 845 aa] {ON}
           YDL164C (REAL)
          Length = 845

 Score =  919 bits (2376), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 445/618 (72%), Positives = 506/618 (81%), Gaps = 8/618 (1%)

Query: 113 FFSTVPYADLCEVFQEVESTSSRLSIIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDY 172
           + S +PY+D+CEVF ++E+ SSRL II+ICSDF IKVMKQ  +NL+P TYLFIN+LGPDY
Sbjct: 232 YSSNIPYSDVCEVFNQIEAISSRLEIIRICSDFFIKVMKQSSKNLIPTTYLFINRLGPDY 291

Query: 173 EPXXXXXXXXXXXMKTISESCGKSMQQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTV 232
           E            MKTISESCGKSM Q+K +Y+EIGDLG+IA  ARNVQPTMFKPKPLTV
Sbjct: 292 EAGLELGLGENLLMKTISESCGKSMSQIKLKYKEIGDLGEIAMGARNVQPTMFKPKPLTV 351

Query: 233 GEVFQNLKDIAQSQGKDSQQRKMRLIKRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLI 292
           GEVF+NL+ IA++QGKDSQ RK++LIKRMLTAC+GVEAKFLIRSLESKLRIGLAEKTVLI
Sbjct: 352 GEVFKNLRTIAKTQGKDSQLRKIKLIKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLI 411

Query: 293 SLSKALLLN----EYETSKDPSMELIETAEEKIRDAFCQVPNYEIIIQSCLNDGIMELDN 348
           SLSKALLL+    E    KD  M+++E+A++KIRDAFCQVPNYEI+I SCL  GIM LD 
Sbjct: 412 SLSKALLLHDENRENSADKDIPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDK 471

Query: 349 NCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGEMRIYSRN 408
            C LRPGIPLKPMLAKPTKAINEVLD FQGE FT EYKYDGER QVHLL++G MRIYSRN
Sbjct: 472 YCTLRPGIPLKPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRN 531

Query: 409 GENMTERYPELHIEDFLVKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKGV 468
           GENMTERYPE+ I DF+     + D   +LILDCE VAWD +Q KILPFQVLSTRKRK V
Sbjct: 532 GENMTERYPEIKITDFI----QDLDITKNLILDCEAVAWDKDQAKILPFQVLSTRKRKDV 587

Query: 469 ELKDVKVRVCLFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDE 528
           EL DVKVRVCLFAFDIL +N E LI  +LRERR+ L +VTK VPGEFQYAT +IT  LDE
Sbjct: 588 ELNDVKVRVCLFAFDILCHNDERLINMSLRERREYLTKVTKVVPGEFQYATQIITNNLDE 647

Query: 529 IQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMXXX 588
           +QKFLD+++  SCEGLMVK+LDG ES YEPSKRSRNWLKLKKDYL GVGDSLDLCV+   
Sbjct: 648 LQKFLDESVNHSCEGLMVKMLDGSESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAY 707

Query: 589 XXXXXXXXXXXXFLLGCYNQDSGEYETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFYN 648
                       FLLGCYNQD+GE+ETCCKIGTGFSDEML  L+       I+ PK+ Y 
Sbjct: 708 YGRGKRTGTYGGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHARLTPTIIDGPKATYV 767

Query: 649 FDSSAEPDIWFEPKVLFEVLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDA 708
           FDSSAEPD+WFEP  LFEVLTADLSLSPIYKAGS T+DKG+SLRFPRFLRIR+DK VEDA
Sbjct: 768 FDSSAEPDVWFEPTTLFEVLTADLSLSPIYKAGSTTFDKGVSLRFPRFLRIREDKGVEDA 827

Query: 709 TSSDQIIEMYENQSHIQS 726
           TSSDQI+E+YENQSH+Q+
Sbjct: 828 TSSDQIVELYENQSHVQN 845

>YDL164C Chr4 complement(164987..167254) [2268 bp, 755 aa] {ON}
           CDC9DNA ligase found in the nucleus and mitochondria, an
           essential enzyme that joins Okazaki fragments during DNA
           replication; also acts in nucleotide excision repair,
           base excision repair, and recombination
          Length = 755

 Score =  913 bits (2359), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 461/728 (63%), Positives = 539/728 (74%), Gaps = 28/728 (3%)

Query: 23  GGGAKKQATLARFFSSM--------PKRXXXXXXXXXXXXXXXXXXXXXXXXXXLNSDET 74
            G   KQATLARFF+SM        P                              +  T
Sbjct: 32  AGKKPKQATLARFFTSMKNKPTEGTPSPKKSSKHMLEDRMDNVSGEEEYATKKLKQTAVT 91

Query: 75  PTTSAGSVTSKD---------EPSLTSSPQKPIVTPAKVP---SNTKPVKFFSTVPYADL 122
            T +A S    +            +  SPQ+      +V    S+     + S +PY+++
Sbjct: 92  HTVAAPSSMGSNFSSIPSSAPSSGVADSPQQSQRLVGEVEDALSSNNNDHYSSNIPYSEV 151

Query: 123 CEVFQEVESTSSRLSIIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDYEPXXXXXXXX 182
           CEVF ++E+ SSRL II+ICSDF IK+MKQ  +NL+P TYLFIN+LGPDYE         
Sbjct: 152 CEVFNKIEAISSRLEIIRICSDFFIKIMKQSSKNLIPTTYLFINRLGPDYEAGLELGLGE 211

Query: 183 XXXMKTISESCGKSMQQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDI 242
              MKTISE+CGKSM Q+K +Y++IGDLG+IA  ARNVQPTMFKPKPLTVGEVF+NL+ I
Sbjct: 212 NLLMKTISETCGKSMSQIKLKYKDIGDLGEIAMGARNVQPTMFKPKPLTVGEVFKNLRAI 271

Query: 243 AQSQGKDSQQRKMRLIKRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLN- 301
           A++QGKDSQ +KM+LIKRMLTACKG+EAKFLIRSLESKLRIGLAEKTVLISLSKALLL+ 
Sbjct: 272 AKTQGKDSQLKKMKLIKRMLTACKGIEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHD 331

Query: 302 ---EYETSKDPSMELIETAEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPL 358
              E    KD  M+++E+A++KIRDAFCQVPNYEI+I SCL  GIM LD  C LRPGIPL
Sbjct: 332 ENREDSPDKDVPMDVLESAQQKIRDAFCQVPNYEIVINSCLEHGIMNLDKYCTLRPGIPL 391

Query: 359 KPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPE 418
           KPMLAKPTKAINEVLD FQGE FT EYKYDGER QVHLL++G MRIYSRNGENMTERYPE
Sbjct: 392 KPMLAKPTKAINEVLDRFQGETFTSEYKYDGERAQVHLLNDGTMRIYSRNGENMTERYPE 451

Query: 419 LHIEDFLVKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVC 478
           ++I DF+     + D   +LILDCE VAWD +Q KILPFQVLSTRKRK VEL DVKV+VC
Sbjct: 452 INITDFI----QDLDTTKNLILDCEAVAWDKDQGKILPFQVLSTRKRKDVELNDVKVKVC 507

Query: 479 LFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIK 538
           LFAFDIL YN E LI K+L+ERR+ L +VTK VPGEFQYAT + T  LDE+QKFLD+++ 
Sbjct: 508 LFAFDILCYNDERLINKSLKERREYLTKVTKVVPGEFQYATQITTNNLDELQKFLDESVN 567

Query: 539 DSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMXXXXXXXXXXXXX 598
            SCEGLMVK+L+G ES YEPSKRSRNWLKLKKDYL GVGDSLDLCV+             
Sbjct: 568 HSCEGLMVKMLEGPESHYEPSKRSRNWLKLKKDYLEGVGDSLDLCVLGAYYGRGKRTGTY 627

Query: 599 XXFLLGCYNQDSGEYETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIW 658
             FLLGCYNQD+GE+ETCCKIGTGFSDEML  L++      I+ PK+ + FDSSAEPD+W
Sbjct: 628 GGFLLGCYNQDTGEFETCCKIGTGFSDEMLQLLHDRLTPTIIDGPKATFVFDSSAEPDVW 687

Query: 659 FEPKVLFEVLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMY 718
           FEP  LFEVLTADLSLSPIYKAGSAT+DKG+SLRFPRFLRIR+DK VEDATSSDQI+E+Y
Sbjct: 688 FEPTTLFEVLTADLSLSPIYKAGSATFDKGVSLRFPRFLRIREDKGVEDATSSDQIVELY 747

Query: 719 ENQSHIQS 726
           ENQSH+Q+
Sbjct: 748 ENQSHMQN 755

>ZYRO0F11572g Chr6 (949236..951431) [2196 bp, 731 aa] {ON} similar
           to uniprot|P04819 Saccharomyces cerevisiae YDL164C CDC9
           DNA ligase found in the nucleus and mitochondria an
           essential enzyme that joins Okazaki fragments during DNA
           replication also acts in nucleotide excision repair base
           excision repair and recombination
          Length = 731

 Score =  909 bits (2349), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 453/707 (64%), Positives = 537/707 (75%), Gaps = 16/707 (2%)

Query: 28  KQATLARFFSSMPKRXXXXXXXXXXXXXXXXXXXXXXXXXXLNSDETPTT---------S 78
           KQATLA+FFSS+  R                           NS+E  ++         S
Sbjct: 30  KQATLAKFFSSVKDRNSPTKKNATPAFPTTTNVKRESPVRS-NSNEKESSPMFDDSNGRS 88

Query: 79  AGSVTSKDEPSLTSSPQK-PIVTPAKVPSNTKPVKFFSTVPYADLCEVFQEVESTSSRLS 137
           +   ++  E     +P+K  + + +   S       FSTVPYAD+C +FQE+ESTSSRLS
Sbjct: 89  SACSSAGLEMESAPAPKKLKMESDSNSTSKNNQDDHFSTVPYADVCNIFQEIESTSSRLS 148

Query: 138 IIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDYEPXXXXXXXXXXXMKTISESCGKSM 197
           IIKICSDF  +++K+D +NLVP TYLFINKLGPDYEP           MKTISESCGKS+
Sbjct: 149 IIKICSDFFTQIVKEDSRNLVPTTYLFINKLGPDYEPGMELGLGEGLLMKTISESCGKSL 208

Query: 198 QQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQSQGKDSQQRKMRL 257
            Q+KN+YRE+GDLGQIA +ARNVQPTMFKPKPLTVGEVF NL++IA +QGKDSQ +K++L
Sbjct: 209 AQVKNRYREMGDLGQIAMEARNVQPTMFKPKPLTVGEVFVNLRNIANAQGKDSQNKKIKL 268

Query: 258 IKRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLNEYETSKDPSMELIETA 317
           IKRMLTAC+GVEAKFLIRSLESKLRIGLAEKTVLISLS ALL +E     +PS E ++ A
Sbjct: 269 IKRMLTACQGVEAKFLIRSLESKLRIGLAEKTVLISLSNALLRHEQGLDVEPSDEAVDKA 328

Query: 318 EEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAFQ 377
           E+ IRDAFCQVPNYEI+I +CL  GI +L  +C+L PGIPLKPMLAKPTKAI EVLD FQ
Sbjct: 329 EQSIRDAFCQVPNYEIVINTCLEHGISQLHKHCQLTPGIPLKPMLAKPTKAITEVLDRFQ 388

Query: 378 GEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFLVKDESNTDKEVS 437
           G+ F  EYKYDGER Q+HLL +G MRIYSRNGENMTERYPE+ I DFL    S+   E S
Sbjct: 389 GQLFVSEYKYDGERAQLHLLPDGTMRIYSRNGENMTERYPEIDIRDFL----SDPSTE-S 443

Query: 438 LILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDILYYNGEGLITKTL 497
           LILDCE VAWD EQ KILPFQVLSTRKRK V+ KDVKVRVCLFAFD+L +NGE LI K+L
Sbjct: 444 LILDCEAVAWDKEQGKILPFQVLSTRKRKDVDAKDVKVRVCLFAFDLLCHNGEPLINKSL 503

Query: 498 RERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYE 557
           RER+  L +VTK V GEF+YA  LITA ++E+Q FLDQ++KDSCEGLMVK+LDG ES YE
Sbjct: 504 RERQDDLQKVTKPVDGEFRYANKLITANIEELQHFLDQSVKDSCEGLMVKMLDGPESHYE 563

Query: 558 PSKRSRNWLKLKKDYLAGVGDSLDLCVMXXXXXXXXXXXXXXXFLLGCYNQDSGEYETCC 617
           PSKRSRNWLKLKKDYL GVGDSLDLCV+               FLLGCYNQD+GEYETCC
Sbjct: 564 PSKRSRNWLKLKKDYLNGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGCYNQDTGEYETCC 623

Query: 618 KIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLFEVLTADLSLSPI 677
           KIGTGFS+E+L +LY+  +   +E P +FY +DS+ +PD+WFEP +LFEVL ADLSLSP+
Sbjct: 624 KIGTGFSEELLQQLYDRLKPTAMEAPAAFYVYDSAQQPDVWFEPTLLFEVLAADLSLSPV 683

Query: 678 YKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHI 724
           YKAGSA YDKGISLRFPRFLRIRDDKSVE+ATSS+Q++++YE Q+H+
Sbjct: 684 YKAGSAQYDKGISLRFPRFLRIRDDKSVEEATSSEQVVDLYEAQAHL 730

>KAFR0B00830 Chr2 (157155..159287) [2133 bp, 710 aa] {ON} Anc_7.343
           YDL164C
          Length = 710

 Score =  900 bits (2326), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 437/635 (68%), Positives = 516/635 (81%), Gaps = 9/635 (1%)

Query: 95  QKPIVTP---AKVPSNTKPVK--FFSTVPYADLCEVFQEVESTSSRLSIIKICSDFLIKV 149
           +KP ++P   +K  S+   VK  F   +PYAD+C +FQE+E+ SSRL IIK+CS+F  K 
Sbjct: 78  KKPKLSPIESSKTDSSETTVKQEFVCDIPYADVCVLFQEIENISSRLQIIKLCSEFFTKA 137

Query: 150 MKQDPQNLVPITYLFINKLGPDYEPXXXXXXXXXXXMKTISESCGKSMQQLKNQYREIGD 209
           MKQ+  NL+P+TYLFINKLGPDYE            MKTISESCGKS+QQ+K  Y++IGD
Sbjct: 138 MKQNTANLIPLTYLFINKLGPDYEMGLELGLGENLLMKTISESCGKSLQQVKLDYKDIGD 197

Query: 210 LGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQSQGKDSQQRKMRLIKRMLTACKGVE 269
           LG IA +ARNVQPTMFKPKPLTVG VFQNLK IA+S GKDSQ +K+RLIK++LTACKG+E
Sbjct: 198 LGTIAMNARNVQPTMFKPKPLTVGYVFQNLKLIAKSSGKDSQLKKIRLIKKLLTACKGIE 257

Query: 270 AKFLIRSLESKLRIGLAEKTVLISLSKALLLNEYETSKDPSMELIETAEEKIRDAFCQVP 329
           AK+LIRSLESKLRIGLAEK+VLISLSKALL+NEY  + DP MELIE AE+KIRDAFCQ+P
Sbjct: 258 AKYLIRSLESKLRIGLAEKSVLISLSKALLINEYNNTLDPDMELIEKAEQKIRDAFCQIP 317

Query: 330 NYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDG 389
           NYEI+I SCL  GIM LD +C LRPGIPLKPMLAKPTK I EV D FQ   FT EYKYDG
Sbjct: 318 NYEIVINSCLKYGIMNLDEHCSLRPGIPLKPMLAKPTKTIMEVFDRFQNIHFTSEYKYDG 377

Query: 390 ERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFLVKDESNTDKEVSLILDCEVVAWDN 449
           ER QVHL+++G MRIYSRNGENMTERYPE+++ DF +KD + T    SLI+DCE VAWD 
Sbjct: 378 ERAQVHLMNDGSMRIYSRNGENMTERYPEINVTDF-IKDLNLTK---SLIIDCEAVAWDR 433

Query: 450 EQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDILYYNGEGLITKTLRERRKILHEVTK 509
           E+ KILPFQVLSTRKRK V++KD+KVR+CLFAFDIL +N E LI K+LRERR+ILH VT+
Sbjct: 434 EEKKILPFQVLSTRKRKDVDIKDIKVRICLFAFDILCHNDEKLINKSLRERREILHSVTR 493

Query: 510 CVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKLK 569
            V GEF YA  L T  LDE+Q FLDQ++KDSCEGLMVK+LDGE+S YEPSKRSRNWLKLK
Sbjct: 494 EVHGEFTYAKELSTNNLDELQLFLDQSVKDSCEGLMVKVLDGEDSHYEPSKRSRNWLKLK 553

Query: 570 KDYLAGVGDSLDLCVMXXXXXXXXXXXXXXXFLLGCYNQDSGEYETCCKIGTGFSDEMLT 629
           KDYL GVGDSLDLCV+               FLLGCYNQD+GE+ET CKIGTGFSDE+L 
Sbjct: 554 KDYLDGVGDSLDLCVLGAFYGRGKRTGTYGGFLLGCYNQDTGEFETACKIGTGFSDEVLQ 613

Query: 630 KLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLFEVLTADLSLSPIYKAGSATYDKGI 689
            LY+  +   I+ PK+ Y +DSSA+PD+WFEP +LFEVLTADLS+SPIYKAG++TY KGI
Sbjct: 614 SLYDRLKSTTIDGPKATYIYDSSAQPDVWFEPTLLFEVLTADLSMSPIYKAGASTYSKGI 673

Query: 690 SLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHI 724
           SLRFPRF+R+R+DKSVE+ATSS+QIIE+YENQSH+
Sbjct: 674 SLRFPRFIRLREDKSVEEATSSEQIIELYENQSHV 708

>Kwal_56.24616 s56 (1076178..1078325) [2148 bp, 715 aa] {ON} YDL164C
           (CDC9) - DNA ligase [contig 161] FULL
          Length = 715

 Score =  889 bits (2297), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 447/719 (62%), Positives = 538/719 (74%), Gaps = 36/719 (5%)

Query: 26  AKKQATLARFFSSMPKRXXXXXXXXXXXXXXXXXXXXXXXXXXLNS-DETPTTSAGSVTS 84
           AKKQATLA+FFSS  +                           LN+ D  P +S GS  +
Sbjct: 12  AKKQATLAKFFSSKKR-----------SNDEKEGPQESAKKSQLNAIDAKPESSKGSQPN 60

Query: 85  KDE--------PSLTSSPQKP--IVTPAKVP---SNTKPVKFFSTVP------YADLCEV 125
            DE        P L+++  K    + PAK+    S+    K   + P      Y+++C V
Sbjct: 61  VDETNHETLQKPQLSAAEPKTEFAMNPAKLAVEKSHGDVAKIGISAPKDSNVMYSEMCSV 120

Query: 126 FQEVESTSSRLSIIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDYEPXXXXXXXXXXX 185
           F E+E TSSRL I+K+CSDFL  V+ +  ++LVPITYL INKLGPDY+P           
Sbjct: 121 FNEIEGTSSRLQIVKLCSDFLYSVLTKTRKDLVPITYLLINKLGPDYQPGLELGLGEGLL 180

Query: 186 MKTISESCGKSMQQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQS 245
           MKTISESCGKS+QQ+K +YRE+GDLG+IAQ+AR+VQPTMFKPKPLT G VF NL+DIA++
Sbjct: 181 MKTISESCGKSLQQVKARYRELGDLGRIAQEARSVQPTMFKPKPLTTGMVFANLQDIARA 240

Query: 246 QGKDSQQRKMRLIKRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLNEYET 305
           QGKDSQ RK++LIK+MLTAC+GVEAKFLIRSLESKLRIGLAEK+VL++LSKA+L +E+  
Sbjct: 241 QGKDSQLRKVQLIKKMLTACEGVEAKFLIRSLESKLRIGLAEKSVLVALSKAILTHEH-G 299

Query: 306 SKDPSMELIETAEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKP 365
            K+PS +L++ AE+KIRDAFCQVPNYEI+I + L  GIMEL+ +C L PGIPLKPMLAKP
Sbjct: 300 GKEPSSDLVDAAEQKIRDAFCQVPNYEIVINAALEHGIMELEKHCVLTPGIPLKPMLAKP 359

Query: 366 TKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFL 425
           +K+I+EVLD FQG+ FTCEYKYDGER QVHLL +G MRIYSRNGENMTERYPE++I DF+
Sbjct: 360 SKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEINISDFV 419

Query: 426 VKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDIL 485
               ++ D+  +LILDCE VAWD ++N ILPFQVLSTRKRKGV  +DVKVRVCLFAFDIL
Sbjct: 420 ----AHPDETHTLILDCEAVAWDKDKNVILPFQVLSTRKRKGVVAEDVKVRVCLFAFDIL 475

Query: 486 YYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLM 545
            YN E LI K+L ERR  L  + K VPGE Q A+ + T  LDE+Q +LDQ++KD CEGLM
Sbjct: 476 CYNDEPLINKSLAERRTYLERILKPVPGELQLASEVTTMSLDEMQLYLDQSVKDCCEGLM 535

Query: 546 VKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMXXXXXXXXXXXXXXXFLLGC 605
           VK+LDGEES YEPSKRSRNWLKLKKDYL GVGDSLDLCV+               FLLGC
Sbjct: 536 VKVLDGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGC 595

Query: 606 YNQDSGEYETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLF 665
           YNQD+GE+ETCCKIGTGFSDEML  LYE     EI  PK+FY +  SA+PD+W EP +LF
Sbjct: 596 YNQDTGEFETCCKIGTGFSDEMLQNLYEKLSPTEIPEPKAFYVYSESAQPDVWLEPSMLF 655

Query: 666 EVLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHI 724
           EVLTADLSLSP+YKAG ++Y KGISLRFPRF+RIRDDKSVEDATSS+Q+IE YE+QSHI
Sbjct: 656 EVLTADLSLSPVYKAGGSSYGKGISLRFPRFIRIRDDKSVEDATSSEQVIEFYESQSHI 714

>KLTH0H01408g Chr8 complement(129752..131923) [2172 bp, 723 aa] {ON}
           similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination
          Length = 723

 Score =  879 bits (2271), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 443/719 (61%), Positives = 525/719 (73%), Gaps = 30/719 (4%)

Query: 27  KKQATLARFFSSMPKRXXXXXXXXXXXXXXX-------XXXXXXXXXXXLNSD------E 73
           KKQATLA+FFSS  +                                   +SD      E
Sbjct: 13  KKQATLAKFFSSKKRSVEEEKSHEPAKKLHSDPIGAGSGSPSSSPPLATGSSDAGSVKVE 72

Query: 74  TPTTSAGSVTSKDEPSLTSS--PQKPIVTPAKVPSNTKPVKFFSTVP------YADLCEV 125
           T  TS G  T    P+L  S  P K  V   K      P K  ++ P      YA++C V
Sbjct: 73  TSATSTGENTKAGTPTLPDSDEPAKRAVAATK----GDPAKLGASAPKDSKILYAEMCNV 128

Query: 126 FQEVESTSSRLSIIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDYEPXXXXXXXXXXX 185
           F E+E TSSRL I+K+C DFL  V+ +  +++VPITYL INKLGPDY+P           
Sbjct: 129 FNEIEGTSSRLQIVKLCGDFLYSVLLKARKDIVPITYLLINKLGPDYQPGLELGLGEGLL 188

Query: 186 MKTISESCGKSMQQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQS 245
           MKTISESCGKS+QQ+K +YRE+GDLG+IAQ+AR VQPTMFKPKPLT GEVF NL+ IA+S
Sbjct: 189 MKTISESCGKSLQQIKARYRELGDLGRIAQEARAVQPTMFKPKPLTTGEVFSNLQAIARS 248

Query: 246 QGKDSQQRKMRLIKRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLNEYET 305
           QGKDSQ RK++LIKRMLTAC+G+EAKFLIRSLESKLRIGLAEK+VL++LSKALL  E+  
Sbjct: 249 QGKDSQLRKVQLIKRMLTACQGLEAKFLIRSLESKLRIGLAEKSVLVALSKALLTYEH-N 307

Query: 306 SKDPSMELIETAEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKP 365
            K+PS EL++TAE+KIRDAFCQVPNY+I+I++ L  GIMELD +C L PGIPLKPMLAKP
Sbjct: 308 GKEPSSELVDTAEQKIRDAFCQVPNYQIVIETALEHGIMELDKHCVLTPGIPLKPMLAKP 367

Query: 366 TKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFL 425
           +K+I+EVLD FQG+ FTCEYKYDGER QVHLL +G MRIYSRNGENMTERYPE+ I DF 
Sbjct: 368 SKSISEVLDRFQGQRFTCEYKYDGERAQVHLLPDGSMRIYSRNGENMTERYPEIRISDF- 426

Query: 426 VKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDIL 485
           + D + T    +LILDCE VAWD E+N ILPFQVLSTRKRKGV ++DVKVRVCLFAFDIL
Sbjct: 427 IADPARTH---TLILDCEAVAWDKEKNTILPFQVLSTRKRKGVAVEDVKVRVCLFAFDIL 483

Query: 486 YYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLM 545
            YN E LIT+ L ERR  L      VPGE Q A+ + T  LDE+Q +LDQA++D CEGLM
Sbjct: 484 CYNDEPLITRPLAERRACLERALVPVPGELQLASEVTTMSLDELQHYLDQAVRDCCEGLM 543

Query: 546 VKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMXXXXXXXXXXXXXXXFLLGC 605
           VKIL+GEES YEPSKRSRNWLKLKKDYL GVGDSLDLCV+               FLLGC
Sbjct: 544 VKILEGEESHYEPSKRSRNWLKLKKDYLQGVGDSLDLCVLGAYYGRGKRTGTYGGFLLGC 603

Query: 606 YNQDSGEYETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLF 665
           YNQDSGEYETCCKIGTGFS+EML  L++      I  PK+FY    SA PD+WFEP +LF
Sbjct: 604 YNQDSGEYETCCKIGTGFSEEMLQTLFDRLSPTAIPTPKAFYVHSESAPPDVWFEPTLLF 663

Query: 666 EVLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHI 724
           EVLTADLSLSP+YKAG+++Y KGISLRFPRF+R+RDDK+ E+ATSS+Q++E YE+QSH+
Sbjct: 664 EVLTADLSLSPVYKAGTSSYGKGISLRFPRFIRLRDDKTPEEATSSEQVVEFYESQSHV 722

>TPHA0D04570 Chr4 (996539..998749) [2211 bp, 736 aa] {ON} Anc_7.343
           YDL164C
          Length = 736

 Score =  877 bits (2267), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 442/719 (61%), Positives = 532/719 (73%), Gaps = 44/719 (6%)

Query: 26  AKKQATLARFFSSMPKRXXXXXXXXXXXXXXXXXXXXXXXXXXLNSDETPTTSAGSVTSK 85
           +KKQATLARFF+SM K+                             +  P+ S G+    
Sbjct: 44  SKKQATLARFFTSMGKKTPPAVEVATKQESPENHVDKKRKV-----EVHPSQSVGASEKA 98

Query: 86  DEPSLTSSPQKPIVTPAKVPSNTKPVKFFSTVPYADLCEVFQEVESTSSRLSIIKICSDF 145
           + P                P  TK     STV Y+++C +FQ++E TSSRL+IIK+CS+F
Sbjct: 99  ESP----------------PDQTK-----STVLYSEVCNLFQQIEETSSRLAIIKLCSEF 137

Query: 146 LIKVMKQDPQNLVPITYLFINKLGPDYEPXXXXXXXXXXXMKTISESCGKSMQQLKNQYR 205
            I+V+K +P +++ + YLFIN+LGPDYEP           +KTISE+ GKS++Q+K + +
Sbjct: 138 FIRVIKNNPSDIIIVAYLFINRLGPDYEPGLELGLGENLLIKTISEAYGKSIKQIKLELK 197

Query: 206 EIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQSQGKDSQQRKMRLIKRMLTAC 265
           E GDLG IA+DARN+QPTMFKPKPLT+ +VF NLK IA + GKDSQ RK++LIK+ML+A 
Sbjct: 198 ETGDLGTIARDARNIQPTMFKPKPLTISDVFNNLKKIASATGKDSQLRKIKLIKQMLSAS 257

Query: 266 KGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLNEYETSKDPS---------MELIET 316
           KG+EAKFLIRSLESKLRIGLAEKTVLISLSKALLL+E+   K  S         M+LIE 
Sbjct: 258 KGLEAKFLIRSLESKLRIGLAEKTVLISLSKALLLHEHWKEKGESKFDEEDVESMDLIEQ 317

Query: 317 AEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAF 376
           AE K+R+A CQVPNYEI+I  CL DGI+ +D  C LRPGIPLKPMLAKPTKAI EVL+AF
Sbjct: 318 AEAKLREAHCQVPNYEIVINLCLQDGILNIDKTCTLRPGIPLKPMLAKPTKAITEVLNAF 377

Query: 377 QGEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFLVKDESNTDKEV 436
           QG+EF  EYKYDGER QVHLL  GEMRIYSRNGENMTERYPEL ++DFL   ++ T+ + 
Sbjct: 378 QGKEFISEYKYDGERAQVHLLEGGEMRIYSRNGENMTERYPELDVKDFLCVVKAITNDQE 437

Query: 437 S---------LILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDILYY 487
                     +ILDCEVVAWD EQ KILPFQVL+TRKRK V+LKDVKVRVCLFAFD+LY 
Sbjct: 438 GENAIQPVKDIILDCEVVAWDVEQKKILPFQVLTTRKRKNVDLKDVKVRVCLFAFDLLYL 497

Query: 488 NGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVK 547
           N EG+I K+LRER++IL +VT  VPGEFQYATSLIT+++DE+Q FLDQA+K+SCEGLMVK
Sbjct: 498 NNEGMINKSLRERQEILRKVTVLVPGEFQYATSLITSDMDELQTFLDQAVKNSCEGLMVK 557

Query: 548 ILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMXXXXXXXXXXXXXXXFLLGCYN 607
           +LDGEES YEPSKRSRNWLKLKKDYL GVGDSLDL VM               FLLGCYN
Sbjct: 558 MLDGEESHYEPSKRSRNWLKLKKDYLDGVGDSLDLVVMGAYFGKGKRTGSYGGFLLGCYN 617

Query: 608 QDSGEYETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLFEV 667
           +D+ E+ETCCKIGTGFSDEML  L+ L +  EI+ P   Y +DSSAEPD+WF+ KVLFEV
Sbjct: 618 EDTQEFETCCKIGTGFSDEMLGNLHTLLQPTEIDNPPMTYIYDSSAEPDVWFQAKVLFEV 677

Query: 668 LTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHIQS 726
           LTADLSLSP+YKAG++ YDKGISLRFPRFLRIR+DK V D T+S+ IIE YE+QSHIQ+
Sbjct: 678 LTADLSLSPVYKAGNSRYDKGISLRFPRFLRIREDKDVTDGTTSEDIIEFYESQSHIQN 736

>KLLA0D12496g Chr4 complement(1059684..1061786) [2103 bp, 700 aa]
           {ON} similar to uniprot|P04819 Saccharomyces cerevisiae
           YDL164C CDC9 DNA ligase found in the nucleus and
           mitochondria an essential enzyme that joins Okazaki
           fragments during DNA replication also acts in nucleotide
           excision repair base excision repair and recombination,
          Length = 700

 Score =  845 bits (2184), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 421/653 (64%), Positives = 501/653 (76%), Gaps = 10/653 (1%)

Query: 75  PTTSAGSVTSKDEPSLT--SSPQKPIVTPAKVPSNTKPVKFFSTVPYADLCEVFQEVEST 132
           P  +A +   K E SL+  + P+    T   VPS    +KF S +P+A+LC+ FQ +E T
Sbjct: 56  PDETAAAPPVKSESSLSNITPPKSRGETLTPVPSK---LKFHSNIPFAELCDTFQAIEVT 112

Query: 133 SSRLSIIKICSDFLIKVMKQDPQNLVPITYLFINKLGPDYEPXXXXXXXXXXXMKTISES 192
           SSRL+I  ICS FL  V+++DP++LVPITYLFI+KLGPDYEP           +KTISE+
Sbjct: 113 SSRLAITAICSKFLYSVLERDPESLVPITYLFIHKLGPDYEPGLELGLGESLLIKTISEA 172

Query: 193 CGKSMQQLKNQYREIGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQSQGKDSQQ 252
           CGKS+QQ++N+YREIGDLG+IA  ARNVQPTMFKPKPLTVGEVF NL  IA+S GKDSQ 
Sbjct: 173 CGKSIQQIRNKYREIGDLGEIAMQARNVQPTMFKPKPLTVGEVFNNLVSIAKSNGKDSQS 232

Query: 253 RKMRLIKRMLTACKGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLNEYETSKDPSME 312
           RK  LIK+MLTACKG EAKFLIRSLESKLRIGLAEKTVLIS+SKA+L +E+   ++PS E
Sbjct: 233 RKGSLIKKMLTACKGYEAKFLIRSLESKLRIGLAEKTVLISVSKAILTHEH-NGQEPSTE 291

Query: 313 LIETAEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEV 372
           ++E AE  IRDAFCQVPNYE+II   L  GIM L+ + KLRPGIPL+PMLAKPTK+I+EV
Sbjct: 292 MVEQAESLIRDAFCQVPNYEMIINVALQYGIMNLNQHIKLRPGIPLQPMLAKPTKSISEV 351

Query: 373 LDAFQGEEFTCEYKYDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFLVKDESNT 432
           LD FQG +FTCEYKYDGER QVHL  +G M+IYSRNGE+MTERYPE+ ++ + VKD   T
Sbjct: 352 LDRFQGTKFTCEYKYDGERAQVHLCRDGSMKIYSRNGEDMTERYPEIDVKHY-VKDLGAT 410

Query: 433 DKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDILYYNGEGL 492
               S I+D E VAWD EQ KILPFQVLSTRKRKGVELKDVKVRVCL+AFDIL  N E L
Sbjct: 411 K---SFIVDSEAVAWDQEQGKILPFQVLSTRKRKGVELKDVKVRVCLYAFDILCLNDEPL 467

Query: 493 ITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGE 552
           I K+  ERR+IL +      G+F +A  L T   DE+QK+LDQ++KDSCEGLMVK+L+GE
Sbjct: 468 INKSFHERRQILLDTFNGTQGQFDFANELTTTNFDELQKYLDQSVKDSCEGLMVKMLEGE 527

Query: 553 ESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMXXXXXXXXXXXXXXXFLLGCYNQDSGE 612
           ES YEPSKRSRNWLKLKKDYL GVGDSLDL V+               FLLGCYN DS E
Sbjct: 528 ESHYEPSKRSRNWLKLKKDYLEGVGDSLDLVVLGAYYGRGKRTGTYGGFLLGCYNLDSEE 587

Query: 613 YETCCKIGTGFSDEMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLFEVLTADL 672
           +ETCCKIGTGFSDEML  LY   ++  +E P +   +DSSA  D+WFEP +LFEVLTADL
Sbjct: 588 FETCCKIGTGFSDEMLQDLYTKLKDTTVEHPSTNVIYDSSAPADVWFEPSMLFEVLTADL 647

Query: 673 SLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHIQ 725
           SLSP+YKAG   + KGISLRFPRF+RIRDDK+V DATSSDQ+IE YE+Q+H++
Sbjct: 648 SLSPVYKAGFEAFGKGISLRFPRFVRIRDDKNVTDATSSDQVIEFYESQAHMK 700

>ACL155W Chr3 (81492..83585) [2094 bp, 697 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YDL164C (CDC9)
          Length = 697

 Score =  838 bits (2164), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/697 (59%), Positives = 502/697 (72%), Gaps = 7/697 (1%)

Query: 27  KKQATLARFFSSMPKRXXXXXXXXXXXXXXXXXXXXXXXXXXLNSDETPTTSAGSVTSKD 86
           KKQATL RFF+++ +                              D     S   +  K 
Sbjct: 5   KKQATLGRFFTALKRPQDGATAAATVKKSKVEAAECLAAPAGHEQDAEVKNSLPELADKP 64

Query: 87  EPSLTSSPQKPIVTPAKVPSNTKPVKFFSTVPYADLCEVFQEVESTSSRLSIIKICSDFL 146
            P     PQ     P    S  KP    ++V YADLC VF+ VE+TSSRLSI K+C+DF+
Sbjct: 65  APG-GVLPQAASAVPRAQSSPVKPAAS-TSVMYADLCAVFEAVEATSSRLSITKLCADFM 122

Query: 147 IKVMKQDPQNLVPITYLFINKLGPDYEPXXXXXXXXXXXMKTISESCGKSMQQLKNQYRE 206
             V+K DP +L+P+TYLFIN+LGPDYEP           +KTIS++CGKS  Q+++ YRE
Sbjct: 123 YSVLKCDPGHLIPVTYLFINRLGPDYEPGLELGLGEGILIKTISDACGKSAAQVRSSYRE 182

Query: 207 IGDLGQIAQDARNVQPTMFKPKPLTVGEVFQNLKDIAQSQGKDSQQRKMRLIKRMLTACK 266
            GDLG +AQ AR VQPTMFKPKPLTV +VF  L+ IAQ++GKDSQ +K+RLIK+MLTAC+
Sbjct: 183 CGDLGTVAQQARVVQPTMFKPKPLTVRDVFSTLQAIAQAEGKDSQGKKIRLIKKMLTACQ 242

Query: 267 GVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLNEYETSKDPSMELIETAEEKIRDAFC 326
           G+EAK+LIRSLESKLRIGLAEKTVL++LSKA+L +E++  K+PS E ++ AE  +RD FC
Sbjct: 243 GMEAKYLIRSLESKLRIGLAEKTVLVALSKAILTHEHD-GKEPSPEQVDAAEALVRDTFC 301

Query: 327 QVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYK 386
           QVPNYE+II + L  GIM L  +C L PGIPLKPMLAKPTK+I EVLD FQG+ FTCEYK
Sbjct: 302 QVPNYEMIINAALQYGIMNLPQHCVLTPGIPLKPMLAKPTKSITEVLDRFQGQRFTCEYK 361

Query: 387 YDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFLVKDESNTDKEVSLILDCEVVA 446
           YDGER QVHL+ +G +RIYSRN ENMTERYPE+    FL    +N     SLI+DCE VA
Sbjct: 362 YDGERAQVHLMEDGTIRIYSRNSENMTERYPEIQFHQFL----ANPQTTRSLIIDCEAVA 417

Query: 447 WDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDILYYNGEGLITKTLRERRKILHE 506
           WDNE+ KILPFQVLSTRKRKGVELKDVKVRVCLFAFD+LY NGE L+  +L +RRK L+ 
Sbjct: 418 WDNEKQKILPFQVLSTRKRKGVELKDVKVRVCLFAFDLLYLNGESLLKCSLADRRKHLYS 477

Query: 507 VTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWL 566
           V K VPGE Q+A  + T EL E+Q +L+Q++  SCEGLMVK+LDGEES+YEPSKRSRNWL
Sbjct: 478 VLKVVPGELQFANEITTMELSELQTYLEQSVSASCEGLMVKMLDGEESQYEPSKRSRNWL 537

Query: 567 KLKKDYLAGVGDSLDLCVMXXXXXXXXXXXXXXXFLLGCYNQDSGEYETCCKIGTGFSDE 626
           KLKKDYL GVGDSLDL V+               FLLGCYN D  E+ETCCKIGTGFS+E
Sbjct: 538 KLKKDYLEGVGDSLDLAVLGAYYGRGKRTGTYGGFLLGCYNPDLEEFETCCKIGTGFSEE 597

Query: 627 MLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLFEVLTADLSLSPIYKAGSATYD 686
           +L  L+   ++  I  P+   ++D S+ PD+WFEP +LFEVLTADLSLSP+YKAG   Y 
Sbjct: 598 VLQSLHAQLKDTVIAAPRGDVSYDDSSPPDVWFEPAMLFEVLTADLSLSPVYKAGRDVYG 657

Query: 687 KGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSH 723
           KGISLRFPRFLRIR+DKSV DATSSDQI+E Y+ Q++
Sbjct: 658 KGISLRFPRFLRIREDKSVTDATSSDQIVEFYQRQAN 694

>TBLA0E02050 Chr5 (498038..500200) [2163 bp, 720 aa] {ON} Anc_7.343
           YDL164C
          Length = 720

 Score =  808 bits (2087), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 401/641 (62%), Positives = 488/641 (76%), Gaps = 15/641 (2%)

Query: 95  QKPIVTPAKVPSNT---KPVK----FFSTVPYADLCEVFQEVESTSSRLSIIKICSDFLI 147
           QK IV P +V ++T   +P K      S++PYADLC++F+ +ES SSRL+I  +C+ F  
Sbjct: 86  QKQIVVPQEVTTSTQTPRPTKKSKPATSSLPYADLCQLFETIESESSRLTITNLCTAFFS 145

Query: 148 KVMKQDPQNLVPITYLFINKLGPDYEPXXXXXXXXXXXMKTISESCGKSMQQLKNQYREI 207
           + ++ DP  LVP+TYL INKLGPDY             +K I  +CG S QQLK QYR++
Sbjct: 146 RTLQLDPSLLVPVTYLCINKLGPDYS-GVELGLGEGLLLKAIGSACGVSQQQLKLQYRKL 204

Query: 208 GDLGQIAQDARNVQPT--MFKPKPLTVGEVFQNLKDIAQSQGKDSQQRKMRLIKRMLTAC 265
           GDLGQ+A   R +QPT  MFK +PLT+ +VF  L  IA SQGKDSQ +K+ +IKR+LT+C
Sbjct: 205 GDLGQLAMSTRVLQPTITMFKLEPLTITKVFDTLAKIAASQGKDSQNQKINMIKRLLTSC 264

Query: 266 KGVEAKFLIRSLESKLRIGLAEKTVLISLSKALLLNEYETSKDPSMELIETAEEKIRDAF 325
           +GVEAKFLIRSLESKLRIGLAEKTVL SL++AL+++E + + +   +    AE+ I+D+F
Sbjct: 265 QGVEAKFLIRSLESKLRIGLAEKTVLTSLARALVIHE-KGNDNIQDDDYSNAEQIIKDSF 323

Query: 326 CQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEY 385
           CQ+PNYEIII + L  G+ +L ++ KL PGIPLKPMLAKPTK+I+EVLD FQ  +FT EY
Sbjct: 324 CQIPNYEIIITTSLQYGVSQLASHIKLTPGIPLKPMLAKPTKSISEVLDTFQNIQFTSEY 383

Query: 386 KYDGERGQVHLLSNGEMRIYSRNGENMTERYPELHIEDFLVKDESNTDKEVSLILDCEVV 445
           KYDGER QVHLL +G MRIYSRNGE+MT+RYPEL+I+D+LV   + T     LILDCE V
Sbjct: 384 KYDGERAQVHLLPDGSMRIYSRNGEDMTQRYPELNIQDYLVDSTTTTQ----LILDCEAV 439

Query: 446 AWDNEQNKILPFQVLSTRKRKGVELKDVKVRVCLFAFDILYYNGEGLITKTLRERRKILH 505
           AWD E  KILPFQVLSTRKRK V+LKD+KVRVCLFAFDIL +N + LI  TLRERR ILH
Sbjct: 440 AWDVELQKILPFQVLSTRKRKSVDLKDIKVRVCLFAFDILRHNNDSLINNTLRERRDILH 499

Query: 506 EVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNW 565
            +TK  PG+FQ+AT L T+ LDE+Q FLD+AIKDSCEGLMVK LDG +S YEPSKRSRNW
Sbjct: 500 SITKPCPGQFQFATELTTSNLDELQTFLDKAIKDSCEGLMVKSLDGTDSHYEPSKRSRNW 559

Query: 566 LKLKKDYLAGVGDSLDLCVMXXXXXXXXXXXXXXXFLLGCYNQDSGEYETCCKIGTGFSD 625
           LKLKKDYL G+GDSLDLCV+               FLL CYNQD+ E+ETCCKIGTGFSD
Sbjct: 560 LKLKKDYLQGMGDSLDLCVLGAYYGRGKRTGTYGGFLLACYNQDTEEFETCCKIGTGFSD 619

Query: 626 EMLTKLYELFREEEIEVPKSFYNFDSSAEPDIWFEPKVLFEVLTADLSLSPIYKAGSATY 685
           EML  LY   +E  IE P++ + FDSSAEPD+WF P ++FEVLTADLSLSPIYKAGS  Y
Sbjct: 620 EMLQTLYNGLKETAIESPRANFVFDSSAEPDVWFNPTMVFEVLTADLSLSPIYKAGSTVY 679

Query: 686 DKGISLRFPRFLRIRDDKSVEDATSSDQIIEMYENQSHIQS 726
            KGISLRFPRF+RIR DKSV DATSS+Q+I+ YENQSH+QS
Sbjct: 680 GKGISLRFPRFIRIRTDKSVNDATSSEQVIDFYENQSHLQS 720

>TDEL0G04510 Chr7 (819479..822388) [2910 bp, 969 aa] {ON} Anc_6.18
           YOR005C
          Length = 969

 Score =  104 bits (260), Expect = 2e-22,   Method: Compositional matrix adjust.
 Identities = 72/236 (30%), Positives = 123/236 (52%), Gaps = 9/236 (3%)

Query: 355 GIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNG-EMRIYSRNGENMT 413
           G    P LAK      E +      +F  E K DGER QVH +  G ++R  SR G + T
Sbjct: 268 GYAFVPQLAKKMTISYEKICTKLNNDFLIEEKMDGERIQVHYMDYGAKIRFLSRRGVDYT 327

Query: 414 ERYPELHIEDFLVKDESNTDKEV-SLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKD 472
           + Y E +++   V +  N D  V   +LD E++ +D ++N +LPF ++ +  R+ +  + 
Sbjct: 328 QLYGE-NLQSGTVANYLNFDSNVRDCVLDGEMITFDTDRNVVLPFGMVKSSARQALSTEG 386

Query: 473 V---KVRVCLFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEI 529
           +     R  L   D++Y NG  LI   L +R++ L+ V K  P   +    +  +E   I
Sbjct: 387 ICSQGHRPMLMVLDLVYLNGVSLIKLPLYQRKEFLNRVLKPCPHAVEILPYVRCSEHTAI 446

Query: 530 QKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVM 585
           +K L+++I    EG+++K     ++RYE   R+  W+K+K +YL   G++LDL ++
Sbjct: 447 RKSLEKSISMGSEGIVLK---SYKARYEIGARNDYWIKVKPEYLEQFGENLDLVII 499

>NCAS0D02650 Chr4 (508606..511458) [2853 bp, 950 aa] {ON} Anc_6.18
           YOR005C
          Length = 950

 Score =  103 bits (258), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 74/244 (30%), Positives = 121/244 (49%), Gaps = 9/244 (3%)

Query: 347 DNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGE-MRIY 405
           +N+  + PG    P LAK      E +      +F  E K DGER Q+H    GE ++ +
Sbjct: 251 NNDLVINPGFAFAPQLAKKLSISYEKICMKLKNDFIIEEKMDGERIQLHYQDYGEKLKFF 310

Query: 406 SRNGENMTERYPELHIEDFLVKDESNTDKEV-SLILDCEVVAWDNEQNKILPFQVLSTRK 464
           SR G + T  Y E  I D  +      +K+V   ILD E++ +D  QN ILPF ++ +  
Sbjct: 311 SRRGTDYTYLYGE-SIHDGFIGKHLKLNKDVKDCILDGEMITYDKTQNMILPFGLVKSSA 369

Query: 465 RKGVE---LKDVKVRVCLFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSL 521
           R  +    + +   +     FD+++ NG  L    L  R++ L+ +    P   +  +S 
Sbjct: 370 RSMLTKDGIMNEGYQPLFMVFDLIFMNGTSLANIPLNVRKEYLNGIFTPEPHIIELLSSY 429

Query: 522 ITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLD 581
                D I+K L+ AI    EG+++K  D   SRY  + R+ +W+K+K +YL   G+++D
Sbjct: 430 HRFNEDSIRKSLELAISMGSEGIVLKRYD---SRYTVASRNDDWIKVKPEYLEQFGENMD 486

Query: 582 LCVM 585
           L V+
Sbjct: 487 LIVI 490

>YOR005C Chr15 complement(334509..337343) [2835 bp, 944 aa] {ON}
           DNL4DNA ligase required for nonhomologous end-joining
           (NHEJ), forms stable heterodimer with required cofactor
           Lif1p, interacts with Nej1p; involved in meiosis, not
           essential for vegetative growth
          Length = 944

 Score =  100 bits (250), Expect = 4e-21,   Method: Compositional matrix adjust.
 Identities = 104/425 (24%), Positives = 175/425 (41%), Gaps = 55/425 (12%)

Query: 334 IIQSCLNDGIMEL-DNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERG 392
           ++ S L D  + L D++  ++ G    P LAK      E +     ++F  E K DGER 
Sbjct: 229 VVTSKLYDPKVRLKDDDLSIKVGFAFAPQLAKKVNLSYEKICRTLHDDFLVEEKMDGERI 288

Query: 393 QVHLLSNGE-MRIYSRNGENMTERYPELHIEDFLVKDESNTDKEVSLILDCEVVAWDNEQ 451
           QVH ++ GE ++ +SR G + T  Y        + +    TD     +LD E+V +D ++
Sbjct: 289 QVHYMNYGESIKFFSRRGIDYTYLYGASLSSGTISQHLRFTDSVKECVLDGEMVTFDAKR 348

Query: 452 NKILPFQVLSTRKRKGV---ELKDVKVRVCLFAFDILYYNGEGLITKTLRERRKILHEVT 508
             ILPF ++    ++ +    + +V        FD+LY NG  L    L +R++ L+ + 
Sbjct: 349 RVILPFGLVKGSAKEALSFNSINNVDFHPLYMVFDLLYLNGTSLTPLPLHQRKQYLNSIL 408

Query: 509 KCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKL 568
             +    +   S     ++ I+K L+ AI    EG+++K  +   S Y  + R+ NW+K+
Sbjct: 409 SPLKNIVEIVRSSRCYGVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKV 465

Query: 569 KKDYLAGVGDSLDLCVMXXXXXXXXXXXXXXXFLLGCYNQDSGEYE-------------- 614
           K +YL   G++LDL V+               F+LG    D  EY+              
Sbjct: 466 KPEYLEEFGENLDLIVI------GRDSGKKDSFMLGLLVLDEEEYKKHQGDSSEIVDHSS 519

Query: 615 ----------------TCCKIGTGFSDEMLTKL-----YELFREEEIEVPKSFYNFDSSA 653
                           + C I  G S E   ++         R  E+  P S   F S  
Sbjct: 520 QEKHIQNSRRRVKKILSFCSIANGISQEEFKEIDRKTRGHWKRTSEVAPPASILEFGSKI 579

Query: 654 EPDIWFEP--KVLFEVLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSS 711
            P  W +P   ++ E+ +  L  +   +     Y    +L      RIR DK   D  + 
Sbjct: 580 -PAEWIDPSESIVLEIKSRSLDNT---ETNMQKYATNCTLYGGYCKRIRYDKEWTDCYTL 635

Query: 712 DQIIE 716
           + + E
Sbjct: 636 NDLYE 640

>ZYRO0C07854g Chr3 (595546..598380) [2835 bp, 944 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 944

 Score =  100 bits (249), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 101/382 (26%), Positives = 162/382 (42%), Gaps = 40/382 (10%)

Query: 355 GIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNG-EMRIYSRNGENMT 413
           G+P  P LAK      + +      +F  E K DGER Q+H +  G +++ +SR G + T
Sbjct: 253 GLPFAPFLAKRLYISYDKVALRLKSDFYIEEKMDGERIQLHYMDYGRKLKWFSRRGNDYT 312

Query: 414 ERYPELHIEDFLVKDESNTDKEV-SLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKD 472
             Y E  I    V      D +V   +LD E++++D E+N +LPF ++ +  R  +  + 
Sbjct: 313 YLYGE-DIGTGTVAKYLQLDPKVRECVLDGEMISFDTEENSVLPFGLVKSSARDSLTAEG 371

Query: 473 V---KVRVCLFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEI 529
           +     R      D LY NG  LI   L  R++ L  +    P   +   S+   +   I
Sbjct: 372 ILTQGYRPLYMVIDFLYLNGVSLINVPLNTRKQYLSAILNPCPHAVEIIQSMHCYDDTSI 431

Query: 530 QKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMXXXX 589
           +  L++AI    EG+++K     +S+YE   R+ NW+K+K +YL   G++LDL V+    
Sbjct: 432 KSSLEKAIMMGSEGIILKHF---KSKYEIGARTDNWIKIKPEYLEQFGENLDLLVIGRDP 488

Query: 590 XXXXXXXXXXXFLLG-----------CYNQDSGEYE----------TCCKIGTGFSDEML 628
                       L G             N DS E E          + C I  G S E  
Sbjct: 489 GKKDSLMCGLAVLEGDEEPGAQSDKQVVNLDSEEEEEPRKAVKKFISFCTIANGISQEEF 548

Query: 629 TKLYE----LFREEEIEVPKSFYNFDSSAEPDIWFEPK--VLFEVLTADLSLSPIYKAGS 682
            ++       ++  E   P     F S   P+ W  P+  V+ EV    L  +   ++  
Sbjct: 549 KQIERKTAGKWKNTEDHKPPKILEFGSKL-PEEWIYPEDSVVLEVKARSLDNT---ESSG 604

Query: 683 ATYDKGISLRFPRFLRIRDDKS 704
             +  G +L      RIR+DK+
Sbjct: 605 RKFKVGCTLHGGYCRRIREDKN 626

>TBLA0G01040 Chr7 complement(258966..261884) [2919 bp, 972 aa] {ON}
           Anc_6.18 YOR005C
          Length = 972

 Score = 99.8 bits (247), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 70/243 (28%), Positives = 119/243 (48%), Gaps = 7/243 (2%)

Query: 347 DNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGE-MRIY 405
           +++  ++ G    P LAK      + +      +F  E K DGER Q+H ++ GE ++ +
Sbjct: 264 NSDLSIKVGYIFAPQLAKRLMLSYDTISNRLNNDFFIEEKMDGERIQLHYMNYGETVKFF 323

Query: 406 SRNGENMTERYPELHIEDFLVKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKR 465
           SR+G + T  Y        + K           +LD E+V +D+   K+LPF ++ +   
Sbjct: 324 SRHGTDYTYLYGNDKSAGTIAKFLRLHKNVKECVLDGEMVTFDSTSKKVLPFGLVKSSAS 383

Query: 466 KGVELKDV---KVRVCLFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLI 522
             +  KD+           FDILY NG  LI   L +R++ L+ V        +  +S+ 
Sbjct: 384 SQLNKKDIDNDSFHPLFMVFDILYLNGSSLIDLPLFKRKEFLNTVLTPYKDYVEILSSIR 443

Query: 523 TAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDL 582
             +  +I+K LD AI    EG+++K      S+Y P+ R  NW+K+K +YL   G+++DL
Sbjct: 444 CTDSIQIKKGLDAAISVGSEGIVLK---QYISKYIPNARHNNWIKVKPEYLEEFGENMDL 500

Query: 583 CVM 585
            V+
Sbjct: 501 IVI 503

>Smik_15.174 Chr15 complement(301851..304688) [2838 bp, 945 aa] {ON}
           YOR005C (REAL)
          Length = 945

 Score = 99.0 bits (245), Expect = 1e-20,   Method: Compositional matrix adjust.
 Identities = 73/257 (28%), Positives = 121/257 (47%), Gaps = 8/257 (3%)

Query: 334 IIQSCLNDGIMELDNN-CKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERG 392
           ++ S L D  + L N+   ++ G    P LAK      E +      +F  E K DGER 
Sbjct: 229 VVASKLYDPRVRLKNDDLTIKVGFAFAPQLAKKVNLPYEKICRALHNDFLVEEKMDGERI 288

Query: 393 QVHLLSNGE-MRIYSRNGENMTERYPELHIEDFLVKDESNTDKEVSLILDCEVVAWDNEQ 451
           QVH ++ G+ +R YSR G + T  Y        +      TD     +LD E+V +D  +
Sbjct: 289 QVHYMNYGKSVRFYSRRGIDYTYLYGASLSSGTISHHLDFTDNVRECVLDGEMVTFDARR 348

Query: 452 NKILPFQVLSTRKRKGVE---LKDVKVRVCLFAFDILYYNGEGLITKTLRERRKILHEVT 508
             ILPF ++    +  +    + +V        FD+LY NG  L    L +R++ L  + 
Sbjct: 349 KVILPFGLVKGSAKDALSFNSINNVDFHPLYVVFDLLYLNGTSLTPLPLHQRKEYLESIL 408

Query: 509 KCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKL 568
             V    +   +     ++ I+K L+ AI    EG+++K  +   S Y  + R+ NW+K+
Sbjct: 409 TPVKNVVEMVRTSRCYNVESIKKSLEVAISLGSEGVVLKYYN---SSYNVASRNNNWIKV 465

Query: 569 KKDYLAGVGDSLDLCVM 585
           K +YL   G++LDL ++
Sbjct: 466 KPEYLEEFGENLDLVII 482

>CAGL0E02695g Chr5 complement(254591..257431) [2841 bp, 946 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005c DNL4 DNA ligase IV
          Length = 946

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 68/244 (27%), Positives = 123/244 (50%), Gaps = 9/244 (3%)

Query: 347 DNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNG-EMRIY 405
           + + K+  G+   P LA       + +    G +F  E K DGER Q+H  + G +++ Y
Sbjct: 258 NQDLKINIGLAFAPQLATKLHVSYQKIGEKLGWDFFIEEKMDGERIQMHYTNFGSDIKFY 317

Query: 406 SRNGENMTERYPELHIEDFLVKDESNTDKEV-SLILDCEVVAWDNEQNKILPFQVLSTRK 464
           SR   + T  Y   +++   + +  N +K V   +LDCEVV +D+    +LPF ++ +  
Sbjct: 318 SRRATDYTYLYGN-NLKTGTLANFINLNKNVKDCVLDCEVVTFDSNNKIVLPFGMVKSSA 376

Query: 465 RKGVELKDVKVRV---CLFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSL 521
           +  +    +  +     L  FD+LY NG  L+     +RR+ L ++        +   S+
Sbjct: 377 KNMLSQDGIDTQGFHPLLMVFDVLYLNGATLVDLPYYKRREYLKQILTPTAHRIEIIKSI 436

Query: 522 ITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLD 581
              +   I+K L++A+    EG+++K  D   SRY  + RS +W+K+K +YL   G+++D
Sbjct: 437 RANDEQMIKKSLEKALSVGSEGIILKRYD---SRYVIASRSDDWIKIKPEYLEQFGENMD 493

Query: 582 LCVM 585
           L +M
Sbjct: 494 LVLM 497

>TPHA0M00260 Chr13 complement(50326..53226) [2901 bp, 966 aa] {ON}
           Anc_6.18 YOR005C
          Length = 966

 Score = 98.6 bits (244), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 109/423 (25%), Positives = 173/423 (40%), Gaps = 65/423 (15%)

Query: 358 LKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNG-EMRIYSRNGENMTERY 416
            +P LAK      EVL      +FT E K DGER Q+H +  G +++ +SR G + T  Y
Sbjct: 264 FEPQLAKKVNLSYEVLSRRMNNKFTIEEKMDGERIQIHYMDYGHQIKYFSRRGNDYTYLY 323

Query: 417 PELHIEDFLVKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKVR 476
            +      + K     +     ILD E+V++D  +N ILPF ++ +     +++  ++  
Sbjct: 324 GKDKSTATISKYLQLNEDVKECILDGEMVSYDKSRNCILPFGMVKSGAANSLKIDGLEND 383

Query: 477 VC---LFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFL 533
           +C      FD+L+ NG  L    L +R++ L  +        +     I  + + I+  L
Sbjct: 384 LCSPLFIVFDVLFLNGSPLTNLPLYQRKEYLSNILTPKKSHIEILKFSIAHDSESIRSAL 443

Query: 534 DQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMXXXXXXXX 593
             AI    EG+++K  D   S Y    R+ +W+K+K +YL   G++LDL V+        
Sbjct: 444 QAAISVGSEGIVLKKYD---SLYSVGDRNNDWIKVKPEYLEQFGENLDLIVIGRDPGKKD 500

Query: 594 XXXXXXXFL----------------LGCYNQDS---------------GEYETCCKIGTG 622
                   L                L   + DS                ++ + C I  G
Sbjct: 501 SLMCGVAVLENEESYEKILQEEVITLTSDDDDSQNNIPEDKPIRTKRITKFISFCVIANG 560

Query: 623 FSDEMLT----KLYELFREEEIEVPKSFYNFDSSAEPDIWFEPK--VLFEV----LTADL 672
            S+E       K +  +++   E P + Y    +  P  W  P   V+ EV    L  + 
Sbjct: 561 ISNEEFKEIDRKTFGCWKKFSDEAPPTDYLEFGTRLPVEWINPHDSVVLEVKARSLENNE 620

Query: 673 SLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDA-TSSDQII---------EMYENQS 722
           +L   +K G   Y  G   R     RIR DK   D  T SD +I         E+Y N S
Sbjct: 621 ALRDKFKTGYTLY--GAYCR-----RIRTDKDFNDCYTFSDLVIATNKKRSSSELYGNHS 673

Query: 723 HIQ 725
           HI+
Sbjct: 674 HIK 676

>ACR008W Chr3 (368913..371858) [2946 bp, 981 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOR005C (DNL4)
          Length = 981

 Score = 97.1 bits (240), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 100/408 (24%), Positives = 163/408 (39%), Gaps = 62/408 (15%)

Query: 348 NNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGE-MRIYS 406
           N+  +R G    P +A+  K   E +    G +F  E K DG+R QVH +  G  +  +S
Sbjct: 284 NDLSVRIGYAFAPHMAQRVKIPYEKVSTKLGNDFYVEEKMDGDRIQVHYMDYGNSIAYFS 343

Query: 407 RNGENMTERYPELHIEDFLVKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRK 466
           RNG N T  Y E   +  +       +     ILD E+V++D E   ILPF +  +    
Sbjct: 344 RNGINYTYLYGENSSKGSISNHLKFVEGVKECILDGEMVSYDKEMQCILPFGLTKSGASH 403

Query: 467 GVELKDV-----KVRVCLFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATSL 521
            V  +         R     FD+LY NG+ L  + + +R++ L ++           +  
Sbjct: 404 QVNFETTGHTEPTYRPLYAVFDLLYLNGQLLTNQDVVKRKEYLEKILIPSKNVVHLLSGP 463

Query: 522 ITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLD 581
             ++ + I   L  A+    EG+++K      S+Y   KR  +W+K+K +YL   G+++D
Sbjct: 464 RCSDAEAITAALGAAVAHGSEGIVLK---KARSKYSVGKRDDSWIKIKPEYLENFGENMD 520

Query: 582 LCVMXXXXXXXXXXXXXXXFLLGCYNQDSGE----------------------------Y 613
           L V+               F+      D  E                            +
Sbjct: 521 LVVI------GRDKGRKDSFICALAVTDDSEKNNPSSYESGSDSDSDSEPIIVQPKIEKF 574

Query: 614 ETCCKIGTGFSDEMLTKLYEL-----FREEEIEVPKSFYNFDSSAEPDIWFEPK--VLFE 666
            + C I  G S+E   ++  L     F  +E + P  +  F +   P  W +PK  V+ E
Sbjct: 575 ISFCSIANGISNEEFKEIDRLTRGNWFPYDERKPPTDWVEFGTKT-PREWIDPKNSVVLE 633

Query: 667 VLTADL----SLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATS 710
           V    +    S S +YK GS  Y+           RIR DK+   A++
Sbjct: 634 VKARSIDNEESKSDLYKTGSTLYNAYCK-------RIRHDKNWSTAST 674

>Kwal_56.22414 s56 complement(117198..120089) [2892 bp, 963 aa] {ON}
           YOR005C (DNL4) - ATP dependent DNA ligase [contig 185]
           FULL
          Length = 963

 Score = 96.3 bits (238), Expect = 1e-19,   Method: Compositional matrix adjust.
 Identities = 73/271 (26%), Positives = 132/271 (48%), Gaps = 11/271 (4%)

Query: 322 RDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEF 381
           +D    V + +++ ++  N  +    N   +  G    P LAK      E + A   ++F
Sbjct: 243 QDYLGVVSDLKVLSETLWNPTMRLGKNELSINIGRAFAPHLAKRLHLSYERVCAKLKQDF 302

Query: 382 TCEYKYDGERGQVHLLSNG-EMRIYSRNGENMTERYPELHIEDFLVKDESNTDKEVS-LI 439
             E K DGER Q+H +  G ++R  SR G + T  Y +  +E  ++        +V   +
Sbjct: 303 IIEEKMDGERIQLHYIERGAKIRFLSRRGTDFTHLYGD-SLEHGVISQHLKFKNDVQDCV 361

Query: 440 LDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVKV-----RVCLFAFDILYYNGEGLIT 494
           LD E+V++D E+N +LPF ++ +   + +   D KV     R     FD++Y NG  L  
Sbjct: 362 LDGEMVSFDKEKNVVLPFGIVKSTAMEELMNSDTKVDTDGYRPLYMIFDLVYLNGVSLTR 421

Query: 495 KTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEES 554
             L  R+  L  +   V    +  + +  +E + I+  L++AI+   EG+++K      S
Sbjct: 422 LPLHLRKSYLRSILSPVANIVEILSDVRASEPNAIKVSLERAIEMGSEGIILKQFS---S 478

Query: 555 RYEPSKRSRNWLKLKKDYLAGVGDSLDLCVM 585
            YE   R+ +W+K+K +Y   +G+++DL V+
Sbjct: 479 PYEIGARNDSWIKIKPEYFEELGETMDLVVI 509

>KNAG0F02870 Chr6 (543177..546041) [2865 bp, 954 aa] {ON} Anc_6.18
           YOR005C
          Length = 954

 Score = 93.6 bits (231), Expect = 8e-19,   Method: Compositional matrix adjust.
 Identities = 77/272 (28%), Positives = 129/272 (47%), Gaps = 17/272 (6%)

Query: 323 DAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFT 382
           D F  V +   + +      +   + +  L+ G    P LAK      E +    G +F+
Sbjct: 220 DYFSVVSDLSSVTKKLYEPSVRLRNEDLTLKIGSAFAPHLAKRLNISYEKILKKLGSDFS 279

Query: 383 CEYKYDGERGQVHLLSNG-EMRIYSRNGENMTERY----PELHIEDFLVKDESNTDKEVS 437
            E K DGER Q+H +  G E++  SR G + T  Y        I  +L  +E+  +    
Sbjct: 280 IEEKMDGERIQIHYMDYGNEIKFLSRRGTDYTYLYGGDTSTGTIACYLKLNENVKE---- 335

Query: 438 LILDCEVVAWDNEQNKILPFQVLSTRKRKGVE---LKDVKVRVCLFAFDILYYNGEGLIT 494
            ILD E+V +D E+  ILPF ++ +  +  +    + +        AFD++Y NG  L+ 
Sbjct: 336 CILDGEMVTYDQEKQMILPFGLVKSSAKNFLSKESISNGSYHPLFMAFDLVYLNGTSLVD 395

Query: 495 KTLRERRKILHEV-TKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEE 553
             L +R+  L ++ TKC  G     +      L+ I K L  AI    EG+++K L+   
Sbjct: 396 LPLYQRKDYLSKILTKC-NGFVDIVSFARCNNLESITKSLAAAISVGSEGIILKKLN--- 451

Query: 554 SRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVM 585
           SRY  + R+ +W+K+K  YL   G+++DL ++
Sbjct: 452 SRYMVASRNDSWIKIKPQYLKQFGENMDLIII 483

>NDAI0I02260 Chr9 complement(514711..517614) [2904 bp, 967 aa] {ON}
           Anc_6.18 YOR005C
          Length = 967

 Score = 93.2 bits (230), Expect = 1e-18,   Method: Compositional matrix adjust.
 Identities = 74/269 (27%), Positives = 129/269 (47%), Gaps = 9/269 (3%)

Query: 322 RDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEF 381
           +D    V + + +     +  +   +++  +  G P  P  AK      E + A    +F
Sbjct: 234 QDYLSVVSDLKTVANKLWDPAVHLKNDDLTINVGSPFAPQSAKKLSISYEKICAKLKHDF 293

Query: 382 TCEYKYDGERGQVHLLSNG-EMRIYSRNGENMTERYPELHIEDFLVKDESNTDKEV-SLI 439
             E K DGER Q+H    G ++   SR G + T  Y E  I+D  V    + D  V + +
Sbjct: 294 FIEEKMDGERIQLHYQDYGNKLSFLSRRGTDYTYLYGE-SIKDGTVSKYLHLDNNVQNCV 352

Query: 440 LDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVK---VRVCLFAFDILYYNGEGLITKT 496
           LD E+V +D E+N +LPF ++ +  R  +  + V     R  L  FD++Y NG  L+   
Sbjct: 353 LDGEMVTFDKERNALLPFGLVKSSARSIITQEGVANEGYRPLLMVFDLVYLNGVSLVNIP 412

Query: 497 LRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRY 556
           L +R+  L ++        +   S   ++   I+  L+ AI    EG+++K  +   SRY
Sbjct: 413 LYQRKLYLEKIFTPERHIVELLRSKRCSDERSIKNALEHAISIGSEGVVLKHYN---SRY 469

Query: 557 EPSKRSRNWLKLKKDYLAGVGDSLDLCVM 585
             + R+ +W+K+K +YL   G+++DL V+
Sbjct: 470 TVASRNDDWIKVKPEYLEQFGENMDLIVI 498

>KLTH0C11286g Chr3 (926742..929597) [2856 bp, 951 aa] {ON} similar
           to uniprot|Q08387 Saccharomyces cerevisiae YOR005C DNL4
           DNA ligase required for nonhomologous end- joining
           (NHEJ) forms stable heterodimer with required cofactor
           Lif1p catalyzes DNA ligation as part of a complex with
           Lif1p and Nej1p involved in meiosis not essential for
           vegetative growth
          Length = 951

 Score = 92.0 bits (227), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 104/421 (24%), Positives = 173/421 (41%), Gaps = 51/421 (12%)

Query: 328 VPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKY 387
           V + +I+ +   N  +     +  +  G    P LAK      E + +    +F  E K 
Sbjct: 235 VTDLKILSKKLWNPSVRLDKRDLSINIGHAFAPHLAKRLHVSYERICSKLKHDFILEEKM 294

Query: 388 DGERGQVHLLSNGE-MRIYSRNGENMTERYPELHIEDFLVKDESNTDKEV-SLILDCEVV 445
           DGER Q+H ++ G  ++  SR G + +  Y +  +   ++        +V   +LD E+V
Sbjct: 295 DGERIQLHYVNGGSVLKFLSRRGIDFSHLYGQ-EVARGVISQYLKLKSDVRDCVLDGEMV 353

Query: 446 AWDNEQNKILPFQVLSTRKRKGVELKDVKV-------RVCLFAFDILYYNGEGLITKTLR 498
           ++D ++  ILPF ++ +      EL + +V       R     FD++Y NG  L    L 
Sbjct: 354 SYDKKRKIILPFGIVKSAAVD--ELINSEVGNENDGYRPLYMVFDLVYLNGVSLTKVPLH 411

Query: 499 ERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEP 558
            R++ L E+   VP   +    +   +   I+ F+ +AI+   EG++VK      S YE 
Sbjct: 412 IRKEYLKEILSPVPDVVEILKGIRACDAKAIKNFMQRAIEMGSEGVIVK---QASSTYEV 468

Query: 559 SKRSRNWLKLKKDYLAGVGDSLDLCVMXXXXXXXXXXXXXXXFLLGCYNQDS-------G 611
             R+ +W+K+K +Y   +G+++DL V+                + G    DS       G
Sbjct: 469 GARNDHWVKIKPEYFEDLGETMDLVVI------GRDPGKKDSLMCGLLVSDSEHILENFG 522

Query: 612 EYE------------TCCKIGTGFSDEMLTKLYELFREEEIEV-----PKSFYNFDSSAE 654
             E            + C +  G SDE   ++    R   +       P S   F S   
Sbjct: 523 PIEHGKEGDPIIKCVSFCNVANGVSDEEFKEINRKTRGSWVSYKEKPPPLSLLEFGSKI- 581

Query: 655 PDIWFEPK--VLFEVLTADLSLSPIYKAGSATYDKGISLRFPRFLRIRDDKSVEDATSSD 712
           P  W +PK  V+ EV    +  S   +  S  Y  G +L      RIR+DK     TS  
Sbjct: 582 PVEWIDPKNSVVIEVKARSVENS---EYSSKRYRAGSTLHSAYCRRIRNDKDWTTCTSVA 638

Query: 713 Q 713
           Q
Sbjct: 639 Q 639

>KLLA0D01089g Chr4 complement(97438..100161) [2724 bp, 907 aa] {ON}
           similar to uniprot|Q08387 Saccharomyces cerevisiae
           YOR005C DNL4 DNA ligase required for nonhomologous end-
           joining (NHEJ) forms stable heterodimer with required
           cofactor Lif1p catalyzes DNA ligation as part of a
           complex with Lif1p and Nej1p involved in meiosis not
           essential for vegetative growth
          Length = 907

 Score = 91.3 bits (225), Expect = 4e-18,   Method: Compositional matrix adjust.
 Identities = 99/394 (25%), Positives = 166/394 (42%), Gaps = 61/394 (15%)

Query: 358 LKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERGQVHLLSNGE-MRIYSRNGENMTERY 416
            +P LAK T    E + +    +F  E K DGER Q+H ++ GE ++  SR G + +  Y
Sbjct: 247 FEPQLAKRTHLSYERVASKLQHDFIIEEKMDGERLQIHYINYGEQIKYLSRRGVDFSYLY 306

Query: 417 ----------PELHIEDFLVKDESNTDKEVSLILDCEVVAWDNEQNKILPFQVLSTRKRK 466
                     P L +  F VKD          ILD E++ +D E++ +LPF ++ +    
Sbjct: 307 GENSSSGPISPSLKLH-FNVKD---------CILDGEMITYDTEKDIVLPFGLVKSSAMN 356

Query: 467 GV--ELKDV----KVRVCLFAFDILYYNGEGLITKTLRERRKILHEVTKCVPGEFQYATS 520
            +  EL  +      +    AFD++Y NG+ L    L  R+  L ++   V    +    
Sbjct: 357 QIQSELAGIAPTESYKPLFVAFDLVYLNGKSLTNLALERRKDYLTKILTPVERSVEIIQY 416

Query: 521 LITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSL 580
           +     + I+  L+QAI    EG+++K L    S+Y    R+ +W+K+K +YL   G+++
Sbjct: 417 MKAINAEAIKDSLEQAISMGSEGIVLKHL---HSKYFVGSRNTDWIKIKPEYLEQFGENM 473

Query: 581 DLCVMXXXXXXXXXXXXXXXFLLGCYNQDSGE------YETCCKIGTGFSDEMLTKL--- 631
           DL ++               F  G    D  E      + + C I  G S+E    +   
Sbjct: 474 DLLII------GREQGKKDSFFCGLSISDPNEVAEKPRFISFCTIANGLSNEEFKDIERK 527

Query: 632 ----YELFREEEIEVPKS--FYNFDSSAEPDIWFEPK--VLFEVLTADLSLSPIYKAGSA 683
               + +F E+    P S     F +   P  W  P+  V+ EV    +      ++   
Sbjct: 528 TWGKWHIFSED----PPSPNLLGFGTKV-PYEWIHPEDSVVLEVKARAIDTK---ESEKR 579

Query: 684 TYDKGISLRFPRFLRIRDDKSVEDATSSDQIIEM 717
            Y  G +L F    +IR DK  +   S  +  +M
Sbjct: 580 KYRSGCTLHFGYCKQIRYDKDWKTVASFSEFEDM 613

>Kpol_1032.7 s1032 complement(12295..15192) [2898 bp, 965 aa] {ON}
           complement(12295..15192) [2898 nt, 966 aa]
          Length = 965

 Score = 89.7 bits (221), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 64/211 (30%), Positives = 116/211 (54%), Gaps = 9/211 (4%)

Query: 380 EFTCEYKYDGERGQVHLLSNG-EMRIYSRNGENMTERYPELHIEDFLVKDESNTDKEVS- 437
           +F  E K DGER Q+H ++ G +++  SR G + +  Y + +  +  +    N  K+V  
Sbjct: 298 DFFIEEKMDGERIQLHYMNYGAKLKFLSRRGLDYSYLYGD-NRNNGAIGRYLNFHKDVKE 356

Query: 438 LILDCEVVAWDNEQNKILPFQVLSTRKRKGVELKDVK---VRVCLFAFDILYYNGEGLIT 494
            ILD E+V +D+ +N ILPF ++ +   + + + D++         AFD++Y NG  L T
Sbjct: 357 CILDGEMVTYDSVKNCILPFGLVKSSAMQSLSVSDIEPDGYHPLYMAFDLVYLNGSSLST 416

Query: 495 KTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEES 554
             L +R+  L ++    P   +   +L   +   I+  L++AI+   EG+++K  D   S
Sbjct: 417 LPLHQRKNYLDKLLIPCPDFVEILPALHCNDSSLIKSSLEKAIELGSEGIILKRFD---S 473

Query: 555 RYEPSKRSRNWLKLKKDYLAGVGDSLDLCVM 585
           +Y  +KRS +W+K+K +YL   G+++DL V+
Sbjct: 474 QYLVAKRSDDWIKIKPEYLEQFGENMDLIVI 504

>Suva_15.180 Chr15 complement(308983..311829) [2847 bp, 948 aa] {ON}
           YOR005C (REAL)
          Length = 948

 Score = 89.4 bits (220), Expect = 1e-17,   Method: Compositional matrix adjust.
 Identities = 71/260 (27%), Positives = 125/260 (48%), Gaps = 14/260 (5%)

Query: 334 IIQSCLNDGIMELDNN-CKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERG 392
           ++ S L D  + L N+   ++ G    P LAK      E +      +F  E K DGER 
Sbjct: 229 VVTSKLYDPDIRLKNDDLSIKVGFAFAPQLAKKVNLSYEKICHALRNDFFVEEKMDGERI 288

Query: 393 QVHLLSNGE-MRIYSRNGENMTERYPELHIEDFLVKDESNTDKEVSLILDCEVVAWDNEQ 451
           QVH ++ G+ ++ +SR G + T  Y    +   + +    +D     +LD E+V +D  +
Sbjct: 289 QVHYMNYGKSIKFFSRRGIDYTYLYGVNLLSGTISQYLKFSDSVKECVLDGEMVTFDAMR 348

Query: 452 NKILPFQVLSTRKRKGVELKDVK---VRVCLFAFDILYYNGEGLITKTLRERRKILHEV- 507
             ILPF ++    ++ +   D+           FD+LY NG  L    L +R++ L  + 
Sbjct: 349 KVILPFGLVKGSAKEALSFNDINNNDFHPLYMVFDLLYLNGTSLTPLPLYQRKEYLSSIL 408

Query: 508 --TKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRNW 565
             +K V    +Y+      + + ++K L+ AI    EG+++K      S Y  + R+ NW
Sbjct: 409 IPSKSVVEIVRYSRCY---DAESVKKSLEVAISLGSEGVVLK---HYSSSYNVASRNNNW 462

Query: 566 LKLKKDYLAGVGDSLDLCVM 585
           +K+K +YL   G++LDL ++
Sbjct: 463 IKVKPEYLEEFGENLDLIII 482

>Skud_15.166 Chr15 complement(294550..297393) [2844 bp, 947 aa] {ON}
           YOR005C (REAL)
          Length = 947

 Score = 89.0 bits (219), Expect = 2e-17,   Method: Compositional matrix adjust.
 Identities = 74/261 (28%), Positives = 124/261 (47%), Gaps = 16/261 (6%)

Query: 334 IIQSCLNDGIMELDNN-CKLRPGIPLKPMLAKPTKAINEVLDAFQGEEFTCEYKYDGERG 392
           ++ S L D  + L N+   ++ G    P LAK      E +      +F  E K DGER 
Sbjct: 229 VVTSKLYDPRVRLKNDDLSIKVGFAFAPQLAKKVSLPYEKICRALHNDFLIEEKMDGERI 288

Query: 393 QVHLLSNGE-MRIYSRNGENMTERY----PELHIEDFLVKDESNTDKEVSLILDCEVVAW 447
           QVH ++ G+ ++ +SR G + T  Y        I  +L    +NT KE   +LD E+V +
Sbjct: 289 QVHYMNYGKSIKFFSRRGIDYTYLYGASLSSGTISQYL--KLTNTVKEC--VLDGEMVTF 344

Query: 448 DNEQNKILPFQVLSTRKRKGVELKDVK---VRVCLFAFDILYYNGEGLITKTLRERRKIL 504
           D+ +  ILPF ++    +  +   D+     R     FD+LY N   L    L +R+K L
Sbjct: 345 DSTRKVILPFGLVKGSAKGVLSCSDINNSDFRPLYMVFDLLYLNEISLAPLPLHQRKKYL 404

Query: 505 HEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMVKILDGEESRYEPSKRSRN 564
             +        +   S    ++  ++  L+ AI    EG+++K  +   S Y  + R+ N
Sbjct: 405 SSILTPFKNVVEIVQSTRCYDVQSVKNSLEVAISLGSEGVVLKYYN---SSYNIASRNYN 461

Query: 565 WLKLKKDYLAGVGDSLDLCVM 585
           W+K+K +YL   G++LDL ++
Sbjct: 462 WIKVKPEYLEEFGENLDLIII 482

>KAFR0A05050 Chr1 (1003515..1006361) [2847 bp, 948 aa] {ON} Anc_6.18
           YOR005C
          Length = 948

 Score = 85.1 bits (209), Expect = 3e-16,   Method: Compositional matrix adjust.
 Identities = 104/433 (24%), Positives = 170/433 (39%), Gaps = 54/433 (12%)

Query: 312 ELIETAEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLRPGIPLKPMLAKPTKAINE 371
           +L+        D    V + + +     N  I    +   +  G    P LAK      +
Sbjct: 208 KLLNAWHPDAEDYLSVVSDLKTVCTRLWNPNIRLRHDELSINIGYAFAPHLAKKLSISYD 267

Query: 372 VLDAFQGEEFTCEYKYDGERGQVHLLSNG-EMRIYSRNGENMTERYPELHIEDFLVKDES 430
            +      +F  E K DGER Q+H +  G +++  SR G + T  Y E ++    +    
Sbjct: 268 KICKKLKNDFFIEEKMDGERIQIHYMDYGNDIKFLSRRGVDYTYLYGE-NLSTGTIACYL 326

Query: 431 NTDKEVS-LILDCEVVAWDNEQNKILPFQVLSTRKRKGV---ELKDVKVRVCLFAFDILY 486
             +++V   +LD E+V +D +Q+ +LPF ++ +     +   E+        L  FD+++
Sbjct: 327 KLNRDVKECVLDGEMVTYDEDQDILLPFGMVKSAAMNALTKEEISGQDYHPLLMVFDLVF 386

Query: 487 YNGEGLITKTLRERRKILHEVTKCVPGEFQYATSLITAELDEIQKFLDQAIKDSCEGLMV 546
            NG  L+   L +R+  L  V +      Q       +  + I+K L+ AI    EG+++
Sbjct: 387 LNGSSLVEFPLYQRKDYLASVLEPYRARVQIVNFTRCSNENIIRKSLEHAISVGSEGIVL 446

Query: 547 KILDGEESRYEPSKRSRNWLKLKKDYLAGVGDSLDLCVMXXXXXXXXXXXXXXXFL---- 602
           K      SRY    R+ +W+K+K +YL   G+++DL V+                L    
Sbjct: 447 K---NYNSRYMIGSRNDSWIKIKPEYLEQFGENMDLIVIGRDSAKKDSFYCGLTVLDEEE 503

Query: 603 --------LGCYN--QDSGEYE------------TCCKIGTGFSDEMLTKLYELFR---- 636
                    G  N   D  +YE            + C I  G S     ++Y   R    
Sbjct: 504 EKLVEEIDKGVVNLVSDESDYENPENNRHIKKVVSFCMIANGISQNEYKEIYRKTRGFWK 563

Query: 637 -EEEIEVPKSFYNFDSSAEPDIWFEPK--VLFEVLTADL----SLSPIYKAGSATYDKGI 689
             EE+  P     F +   P  W EP+  V+ E+    L    S    +KAG   Y  G 
Sbjct: 564 KTEEVPPPPELIEFGTQV-PMEWIEPEHSVVLEIKARSLDNTESSCKRFKAGCTLY--GG 620

Query: 690 SLRFPRFLRIRDD 702
             R     RIRDD
Sbjct: 621 YCR-----RIRDD 628

>Smik_8.288 Chr8 complement(472376..473305) [930 bp, 309 aa] {ON}
           YHR199C (REAL)
          Length = 309

 Score = 31.2 bits (69), Expect = 9.3,   Method: Compositional matrix adjust.
 Identities = 18/62 (29%), Positives = 32/62 (51%), Gaps = 6/62 (9%)

Query: 294 LSKALLLNEYETSKDPSMELIETAEEKIRDAFCQVPNYEIIIQSCLNDGIMELDNNCKLR 353
           LS+A +  E  +S      L+++ +EK+RDA        I+I + L+ GI  +  N  ++
Sbjct: 139 LSQAFIDTESSSS------LVKSHQEKLRDALNDPAKAPILINNLLDSGIRLMSKNTPIK 192

Query: 354 PG 355
            G
Sbjct: 193 AG 194

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.134    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 71,054,588
Number of extensions: 3014216
Number of successful extensions: 10350
Number of sequences better than 10.0: 51
Number of HSP's gapped: 10532
Number of HSP's successfully gapped: 54
Length of query: 726
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 609
Effective length of database: 40,065,477
Effective search space: 24399875493
Effective search space used: 24399875493
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 69 (31.2 bits)