Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_2001.707.342ON5332418051e-100
TDEL0C020507.342ON5012456262e-74
Skud_4.947.342ON4472446129e-73
Skud_12.2707.342ON6261396231e-72
Suva_4.837.342ON4622446075e-72
Smik_4.757.342ON4602456051e-71
ZYRO0F11550g7.342ON5382446092e-71
YDL161W (ENT1)7.342ON4542446014e-71
YLR206W (ENT2)7.342ON6131396124e-71
Smik_12.2647.342ON6121396107e-71
NCAS0H006707.342ON4831396019e-71
CAGL0A03872g7.342ON5101406012e-70
Suva_10.3007.342ON6181396063e-70
TPHA0D045607.342ON4872435965e-70
KAFR0L014607.342ON5501355998e-70
KNAG0C038007.342ON4472415831e-68
TBLA0E004807.342ON5991435862e-67
SAKL0F10934g7.342ON4981395741e-66
KLLA0C16731g7.342ON4782465685e-66
NDAI0D006107.342ON4861395661e-65
KAFR0B008907.342ON4141355549e-65
Kwal_56.246107.342ON5082555434e-62
KLTH0H01430g7.342ON5021355251e-59
Ecym_47317.342ON5141404953e-55
KNAG0B026507.342ON6461404875e-53
ACL157C7.342ON5151324516e-49
TBLA0E020407.342ON7011394482e-47
Kwal_47.168574.346ON3821382484e-22
NDAI0D032004.346ON4351382494e-22
KNAG0M003804.346ON4031352476e-22
TBLA0E047604.346ON4261382442e-21
TDEL0D007104.346ON3751382422e-21
KLTH0D16896g4.346ON4011382432e-21
Kpol_1001.24.346ON4181382433e-21
KAFR0B067404.346ON3991382423e-21
YJR125C (ENT3)4.346ON4081382405e-21
Smik_10.4184.346ON4091382406e-21
KLLA0B04587g4.346ON4001382388e-21
Skud_10.3494.346ON4101382388e-21
SAKL0G17952g4.346ON4151382399e-21
Suva_12.2164.346ON4101382362e-20
AER155C4.346ON3641362314e-20
ZYRO0B14784g4.346ON4241382326e-20
Ecym_11334.346ON3921382263e-19
NCAS0A062104.346ON4231382255e-19
TPHA0B004004.346ON3991362202e-18
CAGL0H04323g4.346ON4121222104e-17
SAKL0H25762g4.17ON2621401832e-14
Kwal_55.206114.17ON2541411771e-13
Kpol_388.54.17ON2681381691e-12
TDEL0G017404.17ON2571451682e-12
TBLA0B062204.346ON3391391676e-12
KLTH0E05874g4.17ON2551311504e-10
TPHA0F002304.17ON2801381434e-09
TBLA0G006504.17ON4231401455e-09
ZYRO0G07876g4.17ON2591331399e-09
KLLA0D03949g4.17ON2251331371e-08
Ecym_84074.17ON2541471381e-08
Suva_10.354.17ON2471301362e-08
Skud_12.304.17ON2471271221e-06
ACL061C4.17ON2341311174e-06
CAGL0E03806g4.17ON2601241132e-05
TBLA0H012108.335ON4911651143e-05
NDAI0H002804.17ON3101451115e-05
YLL038C (ENT4)4.17ON2471131062e-04
YHR161C (YAP1801)5.84ON637791082e-04
Smik_12.194.17ON2471131052e-04
NCAS0C058404.17ON2671351042e-04
SAKL0H02530g5.84ON669721063e-04
Skud_8.2255.84ON621791010.001
KLLA0D16654g8.335ON3991601000.001
KAFR0I014604.17ON275157960.003
Smik_8.2455.84ON62779980.003
NCAS0B036608.335ON416113970.003
KNAG0J028704.17ON329150950.004
CAGL0E01199g8.335ON412117940.007
KAFR0B058008.335ON38297930.009
ZYRO0F13684g8.335ON40798920.011
NDAI0J009308.335ON418113910.015
KLTH0G11902g8.335ON399160890.026
Kpol_344.88.335ON384115870.044
KNAG0A051008.335ON421101860.060
SAKL0H15290g8.335ON393133860.062
Kwal_YGOB_27.112618.335ON404113860.070
TBLA0A040408.335ON415168850.080
AGR046C8.335ON38799850.084
Kwal_27.11263singletonOFF27597830.12
Kpol_1036.768.335ON368120830.14
Suva_2.3158.335ON40398800.32
NDAI0A028305.84ON47377800.37
TDEL0F045908.335ON36197780.49
TPHA0C007408.335ON38597770.86
Smik_4.3988.335ON41698760.92
YDR153C (ENT5)8.335ON41198760.94
Skud_4.4128.335ON40698760.95
NCAS0E038205.84ON42872742.1
Ecym_42648.335ON40870714.2
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_2001.70
         (533 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa] ...   314   e-100
TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.3...   245   2e-74
Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W (...   240   9e-73
Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206...   244   1e-72
Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W (...   238   5e-72
Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W (...   237   1e-71
ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {...   239   2e-71
YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}  ENT1Epsin-...   236   4e-71
YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}  ENT2Epsin...   240   4e-71
Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206...   239   7e-71
NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342    236   9e-71
CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {...   236   2e-70
Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206...   238   3e-70
TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {O...   234   5e-70
KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {...   235   8e-70
KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.3...   229   1e-68
TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}...   230   2e-67
SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some s...   225   1e-66
KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]...   223   5e-66
NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.3...   222   1e-65
KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.3...   218   9e-65
Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]...   213   4e-62
KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some s...   206   1e-59
Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar...   195   3e-55
KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.3...   192   5e-53
ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON} Syn...   178   6e-49
TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {O...   177   2e-47
Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125...   100   4e-22
NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {O...   100   4e-22
KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.34...   100   6e-22
TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa] ...    99   2e-21
TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.3...    98   2e-21
KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]...    98   2e-21
Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..931...    98   3e-21
KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON} Anc_4...    98   3e-21
YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON} ...    97   5e-21
Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {...    97   6e-21
KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} simila...    96   8e-21
Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {...    96   8e-21
SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]...    97   9e-21
Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {...    96   2e-20
AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON} S...    94   4e-20
ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]...    94   6e-20
Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar t...    92   3e-19
NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa] ...    91   5e-19
TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346...    89   2e-18
CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} simila...    86   4e-17
SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some ...    75   2e-14
Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {O...    73   1e-13
Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON} c...    70   1e-12
TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17...    69   2e-12
TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON} Anc_4...    69   6e-12
KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {O...    62   4e-10
TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON} ...    60   4e-09
TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.1...    60   5e-09
ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {O...    58   9e-09
KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar...    57   1e-08
Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to...    58   1e-08
Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON} ...    57   2e-08
Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON} ...    52   1e-06
ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON} Sy...    50   4e-06
CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar...    48   2e-05
TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.3...    49   3e-05
NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON} ...    47   5e-05
YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}  EN...    45   2e-04
YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}  ...    46   2e-04
Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON} ...    45   2e-04
NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4....    45   2e-04
SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly...    45   3e-04
Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON...    44   0.001
KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]...    43   0.001
KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17...    42   0.003
Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON...    42   0.003
NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {O...    42   0.003
KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.1...    41   0.004
CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} simila...    41   0.007
KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa] ...    40   0.009
ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]...    40   0.011
NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8....    40   0.015
KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} simi...    39   0.026
Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON} ...    38   0.044
KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.3...    38   0.060
SAKL0H15290g Chr8 (1322030..1323211) [1182 bp, 393 aa] {ON} simi...    38   0.062
Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)...    38   0.070
TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa] ...    37   0.080
AGR046C Chr7 complement(800910..802073) [1164 bp, 387 aa] {ON} S...    37   0.084
Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {O...    37   0.12 
Kpol_1036.76 s1036 complement(205197..206303) [1107 bp, 368 aa] ...    37   0.14 
Suva_2.315 Chr2 complement(560767..560940,560968..561033,561037....    35   0.32 
NDAI0A02830 Chr1 (636619..638040) [1422 bp, 473 aa] {ON} Anc_5.8...    35   0.37 
TDEL0F04590 Chr6 complement(864567..865652) [1086 bp, 361 aa] {O...    35   0.49 
TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.3...    34   0.86 
Smik_4.398 Chr4 complement(724753..726003) [1251 bp, 416 aa] {ON...    34   0.92 
YDR153C Chr4 complement(766736..767971) [1236 bp, 411 aa] {ON}  ...    34   0.94 
Skud_4.412 Chr4 complement(736255..737475) [1221 bp, 406 aa] {ON...    34   0.95 
NCAS0E03820 Chr5 (750631..751917) [1287 bp, 428 aa] {ON} Anc_5.8...    33   2.1  
Ecym_4264 Chr4 complement(558142..559368) [1227 bp, 408 aa] {ON}...    32   4.2  

>Kpol_2001.70 s2001 complement(192214..193815) [1602 bp, 533 aa]
           {ON} complement(192214..193815) [1602 nt, 534 aa]
          Length = 533

 Score =  314 bits (805), Expect = e-100,   Method: Compositional matrix adjust.
 Identities = 164/241 (68%), Positives = 164/241 (68%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD
Sbjct: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120
           KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120

Query: 121 IIRVKAKELTSLLNDEERLXXXXXXXXXXXXXXXXXXXXXXXXXXXLQRAIEESKXXXXX 180
           IIRVKAKELTSLLNDEERL                           LQRAIEESK     
Sbjct: 121 IIRVKAKELTSLLNDEERLRDERGMNRRGGRRERARPRRRPSDDDELQRAIEESKRTAED 180

Query: 181 XXXXXXXXXXXXXXLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMYYDIFGNPI 240
                         LQTA                               PMYYDIFGNPI
Sbjct: 181 DDRRRRMRDDEEADLQTALQLSKEEEELKRLQELQRLQQQQQQQQQQQQPMYYDIFGNPI 240

Query: 241 S 241
           S
Sbjct: 241 S 241

 Score =  246 bits (627), Expect = 5e-74,   Method: Compositional matrix adjust.
 Identities = 132/215 (61%), Positives = 132/215 (61%)

Query: 319 TGSNNPFAMXXXXXXXXXXXDKAHSELPDFNAKPVSAYQPAEXXXXXXXXXXXXXXXXXX 378
           TGSNNPFAM           DKAHSELPDFNAKPVSAYQPAE                  
Sbjct: 319 TGSNNPFAMNNQALQLNNQNDKAHSELPDFNAKPVSAYQPAELPPQQQISLPPQPQQPQQ 378

Query: 379 XXXXTRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQ 438
               TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQ
Sbjct: 379 PLKQTRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQ 438

Query: 439 VTNDPKNNPFLNSQYTGLPSTNIVPSHTGYGFGNXXXXXXXXXXXXXXXXXXXXXXXXXX 498
           VTNDPKNNPFLNSQYTGLPSTNIVPSHTGYGFGN                          
Sbjct: 439 VTNDPKNNPFLNSQYTGLPSTNIVPSHTGYGFGNQQQQQQQQQQQQQQQQQLQQQQYQQQ 498

Query: 499 XXXXXXXXXXXXXXXXXXXXXXXXSYDQGVSLIDL 533
                                   SYDQGVSLIDL
Sbjct: 499 QQQQQQYQPQQQYQQQYQQQPQQQSYDQGVSLIDL 533

>TDEL0C02050 Chr3 (355071..356576) [1506 bp, 501 aa] {ON} Anc_7.342
           YLR206W
          Length = 501

 Score =  245 bits (626), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 133/245 (54%), Positives = 148/245 (60%), Gaps = 7/245 (2%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           M KQFVRSAKNVVKGYSS QV+VRNAT+N+S GP +D LD LAEKTYDSVEFFEIMDM+D
Sbjct: 1   MSKQFVRSAKNVVKGYSSAQVLVRNATANESEGPSVDELDELAEKTYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120
           KRLNDKGKYW+HIAKSLTVLDYLVRFGSENCVLWC+ENLY+I+TL EF   DD   DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKSLTVLDYLVRFGSENCVLWCRENLYVIKTLMEFRNDDDGGVDQGQ 120

Query: 121 IIRVKAKELTSLLNDEERLXXXXXXXXXXXXXXXXXXXXXXXXX----XXLQRAIEESKX 176
           IIRVKAKELT+LL+D+ERL                               LQRA++ES+ 
Sbjct: 121 IIRVKAKELTNLLSDDERLREEREMNRKGRKNGTRRRRRTTGEQDGFDDDLQRALDESRL 180

Query: 177 XXXXXXXXXXXXXXXXXXLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMYYDIF 236
                             LQ A                                 YYDIF
Sbjct: 181 TAEEDERRRKMLGSEDDDLQAALQLSKEEEELKRLQEMQKLQQQQTQQQPS---QYYDIF 237

Query: 237 GNPIS 241
           GNPIS
Sbjct: 238 GNPIS 242

 Score =  167 bits (424), Expect = 3e-45,   Method: Compositional matrix adjust.
 Identities = 86/157 (54%), Positives = 103/157 (65%), Gaps = 3/157 (1%)

Query: 316 PLATGSNNPFAMXXXXXXXXXXXDKAHSELPDFNAKPVSAYQPAEXXXXXXXXXXXXXXX 375
           P+ATGSNNPFA+               S +P+F +    +                    
Sbjct: 325 PMATGSNNPFALNNLQLQQARPAQ--SSPVPNFTSTQAQSPP-KPQPQAQPQKQAPLPQQ 381

Query: 376 XXXXXXXTRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTG 435
                   RTG+  +T+K+GELN+LLA+GTGIDTFGNTG+ARIPAQHTKTGTFINSQGTG
Sbjct: 382 PQQALKPVRTGDLAMTEKYGELNKLLATGTGIDTFGNTGDARIPAQHTKTGTFINSQGTG 441

Query: 436 YRQVTNDPKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472
           YRQVT +PK NPFL SQYTG+PS+NIVP+HTGYGFGN
Sbjct: 442 YRQVTGEPKKNPFLQSQYTGIPSSNIVPAHTGYGFGN 478

>Skud_4.94 Chr4 (163372..164715) [1344 bp, 447 aa] {ON} YDL161W
           (REAL)
          Length = 447

 Score =  240 bits (612), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 129/244 (52%), Positives = 148/244 (60%), Gaps = 8/244 (3%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           M KQFVRSAKN+VKGYSSTQV+VRNATSND+     D+L  LAEK+YDS +FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120
           KRLNDKGKYW+HIAK+LTVLDYL+RFGSENCVLWCKENLYII+TLKEF + DD   DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGVDQGQ 120

Query: 121 IIRVKAKELTSLLNDEERLXXXXXXXXXXXXXXXXXXXXXXXXXX---XLQRAIEESKXX 177
           I+RVKAKELT+LL+D+ERL                              LQRAI+ S+  
Sbjct: 121 IVRVKAKELTTLLSDDERLNEERNMNIKGRSRKGRKRRGTGRNDEDDDDLQRAIDASRMT 180

Query: 178 XXXXXXXXXXXXXXXXXLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMYYDIFG 237
                            LQ +                               PMYYDIFG
Sbjct: 181 AEEDERRRKQDEDYETALQLS-----KEEEELKRLQDLQRMQQVHAQQQQQQPMYYDIFG 235

Query: 238 NPIS 241
           NPI+
Sbjct: 236 NPIT 239

 Score =  170 bits (430), Expect = 1e-46,   Method: Compositional matrix adjust.
 Identities = 75/89 (84%), Positives = 85/89 (95%)

Query: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442
           TRTGNQ +TDK+G+LN+LLA+GTGIDTFGN G++R+PAQHTKTGTFINSQGTGYRQV+ND
Sbjct: 337 TRTGNQSMTDKYGKLNELLATGTGIDTFGNVGDSRVPAQHTKTGTFINSQGTGYRQVSND 396

Query: 443 PKNNPFLNSQYTGLPSTNIVPSHTGYGFG 471
           PK NPFLNSQYTGLPSTNIVP+ TGYGFG
Sbjct: 397 PKQNPFLNSQYTGLPSTNIVPTQTGYGFG 425

>Skud_12.270 Chr12 (501192..503072) [1881 bp, 626 aa] {ON} YLR206W
           (REAL)
          Length = 626

 Score =  244 bits (623), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 110/139 (79%), Positives = 129/139 (92%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           MPKQFVRSAKN+VKGYSSTQV+VR+AT+NDS  P IDTLD LA+++YDSV+FFEIMDMLD
Sbjct: 1   MPKQFVRSAKNMVKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC+EN Y+I+TL+EF + ++S  D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELTSLLNDEERL 139
           IIRVKAKEL SLLND+ERL
Sbjct: 121 IIRVKAKELVSLLNDDERL 139

 Score =  166 bits (419), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 86/90 (95%)

Query: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442
           TRTGNQ I+DK+ +LN LLA+GTG+DTFGNTGEARIPAQHTKTGTFINSQGTGY+QVT++
Sbjct: 454 TRTGNQSISDKYNDLNVLLATGTGLDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTSE 513

Query: 443 PKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472
           PKNNPFL++QYTGLPSTNIVP+ TGYGFGN
Sbjct: 514 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGN 543

>Suva_4.83 Chr4 (155278..156666) [1389 bp, 462 aa] {ON} YDL161W
           (REAL)
          Length = 462

 Score =  238 bits (607), Expect = 5e-72,   Method: Compositional matrix adjust.
 Identities = 129/244 (52%), Positives = 146/244 (59%), Gaps = 8/244 (3%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           M KQ VRSAKN+VKGYSSTQV+VRNATSND+     D+L  LAEK+YDS +FFEIMDMLD
Sbjct: 1   MSKQLVRSAKNLVKGYSSTQVLVRNATSNDNNQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120
           KRLNDKGKYW+HIAK+LTVLDYL+RFGSENCVLWCKENLYII+TLKEF + DD   DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHDDDEGTDQGQ 120

Query: 121 IIRVKAKELTSLLNDEERLXXXXXXXXXXXXXXXXXXXXXXXXXX---XLQRAIEESKXX 177
           I+RVKAKELTSLL+DEERL                              LQRAI+ S+  
Sbjct: 121 IVRVKAKELTSLLSDEERLNEERNMNIKGRNRGGRRRRRTNRSSEDDDDLQRAIDASRMT 180

Query: 178 XXXXXXXXXXXXXXXXXLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMYYDIFG 237
                            LQ +                               PMY DIFG
Sbjct: 181 ADEDERRRKQDEDYETALQLS-----KEEEELKRLQDLQRIQAQQQQQQQQQPMYCDIFG 235

Query: 238 NPIS 241
           NPI+
Sbjct: 236 NPIT 239

 Score =  166 bits (419), Expect = 9e-45,   Method: Compositional matrix adjust.
 Identities = 73/90 (81%), Positives = 84/90 (93%)

Query: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442
           TRTGNQ +TDK+ +LN+LL +GTGIDTFGN G+ R+PAQHTKTGTFINSQGTGYRQV+ND
Sbjct: 352 TRTGNQSMTDKYSKLNELLGTGTGIDTFGNFGDTRVPAQHTKTGTFINSQGTGYRQVSND 411

Query: 443 PKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472
           PK+NPFLNSQYTGLPSTN+VP+ TGYGFGN
Sbjct: 412 PKHNPFLNSQYTGLPSTNVVPAQTGYGFGN 441

>Smik_4.75 Chr4 (144483..145865) [1383 bp, 460 aa] {ON} YDL161W
           (REAL)
          Length = 460

 Score =  237 bits (605), Expect = 1e-71,   Method: Compositional matrix adjust.
 Identities = 127/245 (51%), Positives = 148/245 (60%), Gaps = 10/245 (4%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           M KQFVRSAKN+VKGYSSTQV+VRNATSND+     D+L  LAEK+YDS +FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120
           KRLNDKGKYW+HIAK+LTVLDYL+RFGSENCVLWCKENLYII+TLKEF + DD   DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVLDYLIRFGSENCVLWCKENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IIRVKAKELTSLLNDEERLXXXXXXXXXXXXXXXXXXXXXXXXX----XXLQRAIEESKX 176
           I+RVK+KELT+LL+D+ERL                               LQRA++ S+ 
Sbjct: 121 IVRVKSKELTALLSDDERLNEERNMNIKGRNRKGRSRRGTGRSSNDNDNDLQRALDASRM 180

Query: 177 XXXXXXXXXXXXXXXXXXLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMYYDIF 236
                             LQ +                               PMYYDIF
Sbjct: 181 TAEEDEKRRKMDEDYETALQLS------KEEEELKRLQDLQRMQQLQTQQQQQPMYYDIF 234

Query: 237 GNPIS 241
           GNPI+
Sbjct: 235 GNPIT 239

 Score =  161 bits (407), Expect = 4e-43,   Method: Compositional matrix adjust.
 Identities = 71/89 (79%), Positives = 83/89 (93%)

Query: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442
           TRTGNQ +TDK+ +LN+LLA+GTGIDTFGN G+AR+PAQHTKTGTFINSQGTGY+QV+ND
Sbjct: 350 TRTGNQSMTDKYNKLNELLATGTGIDTFGNVGDARVPAQHTKTGTFINSQGTGYKQVSND 409

Query: 443 PKNNPFLNSQYTGLPSTNIVPSHTGYGFG 471
           PK NPFL+ QYTGLPSTN+VP+ TGYGFG
Sbjct: 410 PKYNPFLSGQYTGLPSTNVVPTQTGYGFG 438

>ZYRO0F11550g Chr6 complement(947131..948747) [1617 bp, 538 aa] {ON}
           some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 538

 Score =  239 bits (609), Expect = 2e-71,   Method: Compositional matrix adjust.
 Identities = 122/244 (50%), Positives = 145/244 (59%), Gaps = 3/244 (1%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           MP QFVRSAKN +KGY+S QV+VR+AT+N+  GP +D LD LA ++YDSVEFFEIMDM+D
Sbjct: 1   MPTQFVRSAKNALKGYTSAQVLVRDATANEVEGPSVDMLDELAHRSYDSVEFFEIMDMID 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC+ENLYII+TL+EF + DD   D GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENLYIIKTLREFRHDDDGTQDGGQ 120

Query: 121 IIRVKAKELTSLLNDEERLXXXX---XXXXXXXXXXXXXXXXXXXXXXXLQRAIEESKXX 177
           IIRVKAKELT+LL D+ERL                              +QRA++ S+  
Sbjct: 121 IIRVKAKELTNLLMDDERLRMERGEDKGAPPRMMSPSPPTPRRNSYDSEMQRALDASRLT 180

Query: 178 XXXXXXXXXXXXXXXXXLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMYYDIFG 237
                            L+TA                                 YYDIFG
Sbjct: 181 AEEDERRRKTLNNEDADLETALQLSKEEEELKRLQELQKAQQDQQRLSQMQPQGYYDIFG 240

Query: 238 NPIS 241
           NPIS
Sbjct: 241 NPIS 244

 Score =  155 bits (391), Expect = 2e-40,   Method: Compositional matrix adjust.
 Identities = 81/165 (49%), Positives = 103/165 (62%), Gaps = 15/165 (9%)

Query: 316 PLATGSNNPFAMXXXXXXXXXXXDKAHSELPDFN--------AKPVSAYQPAEXXXXXXX 367
           P++TGSNNPFA+            +A S+L   N           +  YQP         
Sbjct: 355 PVSTGSNNPFALNGMPLQSNSKP-QAASDLAGLNNWGNNSTGQLEMPKYQP------RPQ 407

Query: 368 XXXXXXXXXXXXXXXTRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGT 427
                           RTGNQ I+DK+ +LNQLLA  TG+DTFGN G+ARIPAQHTKTGT
Sbjct: 408 QPQHNTAPEPQPMQPVRTGNQSISDKYNDLNQLLAQPTGVDTFGNVGDARIPAQHTKTGT 467

Query: 428 FINSQGTGYRQVTNDPKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472
           FINSQGTG++Q +N+PK NPFL +Q+TG+P++++VPSHTGYGFGN
Sbjct: 468 FINSQGTGFKQYSNEPKKNPFLPTQFTGIPTSSVVPSHTGYGFGN 512

>YDL161W Chr4 (167714..169078) [1365 bp, 454 aa] {ON}
           ENT1Epsin-like protein involved in endocytosis and actin
           patch assembly and functionally redundant with Ent2p;
           binds clathrin via a clathrin-binding domain motif at
           C-terminus
          Length = 454

 Score =  236 bits (601), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 127/244 (52%), Positives = 147/244 (60%), Gaps = 8/244 (3%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           M KQFVRSAKN+VKGYSSTQV+VRNATSND+     D+L  LAEK+YDS +FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNLVKGYSSTQVLVRNATSNDNHQVSKDSLIELAEKSYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120
           KRLNDKGKYW+HIAK+LTV+DYL+RFGSENCVLWC+ENLYII+TLKEF + DD   DQGQ
Sbjct: 61  KRLNDKGKYWRHIAKALTVIDYLIRFGSENCVLWCRENLYIIKTLKEFRHEDDEGIDQGQ 120

Query: 121 IIRVKAKELTSLLNDEERLXXXXXXXXXXXXXXXXXXXXXXXXXXX---LQRAIEESKXX 177
           I+RVKAKELT+LL+D+ERL                              LQRAI  S+  
Sbjct: 121 IVRVKAKELTALLSDDERLNEERNMNIKGRNRKGRRRRGTGRSDENDDDLQRAISASRLT 180

Query: 178 XXXXXXXXXXXXXXXXXLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMYYDIFG 237
                            LQ +                               PMYYDIFG
Sbjct: 181 AEEDERRRKQDEDYETALQLS-----KEEEELKRLQDLQRMQQQQGQQQLQQPMYYDIFG 235

Query: 238 NPIS 241
           NPI+
Sbjct: 236 NPIT 239

 Score =  160 bits (406), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 71/87 (81%), Positives = 82/87 (94%)

Query: 384 RTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTNDP 443
           RTGNQ +TDK+ +LN+LLA+GTGIDTFGN GEARIPAQHTKTGTFINSQGTGYRQV++DP
Sbjct: 345 RTGNQSMTDKYSKLNELLATGTGIDTFGNVGEARIPAQHTKTGTFINSQGTGYRQVSDDP 404

Query: 444 KNNPFLNSQYTGLPSTNIVPSHTGYGF 470
            +NPFLNSQYTGLPST++VP+ TGYGF
Sbjct: 405 NHNPFLNSQYTGLPSTSVVPTQTGYGF 431

>YLR206W Chr12 (554578..556419) [1842 bp, 613 aa] {ON}
           ENT2Epsin-like protein required for endocytosis and
           actin patch assembly and functionally redundant with
           Ent1p; contains clathrin-binding motif at C-terminus
          Length = 613

 Score =  240 bits (612), Expect = 4e-71,   Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 128/139 (92%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           M KQFVRSAKN++KGYSSTQV+VR+AT+NDS  P IDTLD LA+++YDSV+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC+EN Y+I+TL+EF + ++S  D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELTSLLNDEERL 139
           IIRVKAKEL SLLNDEERL
Sbjct: 121 IIRVKAKELVSLLNDEERL 139

 Score =  169 bits (427), Expect = 6e-45,   Method: Compositional matrix adjust.
 Identities = 77/90 (85%), Positives = 86/90 (95%)

Query: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442
           TRTGNQ I+DK+ +LN LLA+GTGIDTFGNTGEARIPAQHTKTGTFINSQGTGY+QVTN+
Sbjct: 428 TRTGNQSISDKYSDLNTLLATGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 487

Query: 443 PKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472
           PKNNPFL++QYTGLPSTNIVP+ TGYGFGN
Sbjct: 488 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGN 517

>Smik_12.264 Chr12 (501598..503436) [1839 bp, 612 aa] {ON} YLR206W
           (REAL)
          Length = 612

 Score =  239 bits (610), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 108/139 (77%), Positives = 128/139 (92%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           M KQFVRSAKN++KGYSSTQV+VR+AT+NDS  P IDTLD LA+++YDSV+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSSTQVLVRDATANDSRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC+EN Y+I+TL+EF + ++S  D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELTSLLNDEERL 139
           IIRVKAKEL SLLND+ERL
Sbjct: 121 IIRVKAKELVSLLNDDERL 139

 Score =  165 bits (417), Expect = 1e-43,   Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 84/90 (93%)

Query: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442
           TRTGNQ I+DK+ +LN LLA+GTG DTFGNTGEARIPAQHTKTGTFINSQGTGY+QV N+
Sbjct: 429 TRTGNQSISDKYNDLNTLLATGTGTDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVINE 488

Query: 443 PKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472
           PKNNPFL++QYTGLPSTNIVP+ TGYGFGN
Sbjct: 489 PKNNPFLSNQYTGLPSTNIVPTQTGYGFGN 518

>NCAS0H00670 Chr8 (117595..119046) [1452 bp, 483 aa] {ON} Anc_7.342
          Length = 483

 Score =  236 bits (601), Expect = 9e-71,   Method: Compositional matrix adjust.
 Identities = 109/139 (78%), Positives = 125/139 (89%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           M KQFVRSAKN+VKGYS+TQV+VR+ATSND+  P  + L  LA++++DSV+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSTTQVLVRDATSNDASNPSFELLYELAQRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWCKENLYII+TL+EF + DD   DQGQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDDGGADQGQ 120

Query: 121 IIRVKAKELTSLLNDEERL 139
           IIRVKAKELTSLL DEERL
Sbjct: 121 IIRVKAKELTSLLLDEERL 139

 Score =  180 bits (457), Expect = 4e-50,   Method: Compositional matrix adjust.
 Identities = 96/158 (60%), Positives = 103/158 (65%), Gaps = 19/158 (12%)

Query: 316 PLATGSNNPFAMXXXXXXXXXXXDKAHSELPDFNAKP-VSAYQPAEXXXXXXXXXXXXXX 374
           PL TGSNNPFAM                   +FN KP V + Q                 
Sbjct: 319 PLQTGSNNPFAMN------------------NFNNKPAVESTQAYTASAPQLNQQPAQQQ 360

Query: 375 XXXXXXXXTRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGT 434
                   TRTGNQ ITDK+ +LN LLA+GTGIDTFGNTGE RIPAQHT+TGTFINSQGT
Sbjct: 361 PQQQPLKQTRTGNQSITDKYSQLNTLLATGTGIDTFGNTGEQRIPAQHTQTGTFINSQGT 420

Query: 435 GYRQVTNDPKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472
           GYRQVTNDPKNNPFLNSQYTGLPSTNIV + TGYGFGN
Sbjct: 421 GYRQVTNDPKNNPFLNSQYTGLPSTNIVSTQTGYGFGN 458

>CAGL0A03872g Chr1 complement(392922..394454) [1533 bp, 510 aa] {ON}
           highly similar to uniprot|Q05785 Saccharomyces
           cerevisiae YLR206w ENT2
          Length = 510

 Score =  236 bits (601), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 111/140 (79%), Positives = 126/140 (90%), Gaps = 1/140 (0%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           MP Q VRSAKN+VKGYSSTQVMVR+AT+NDS  P +  L+ LA+KTYD+VEFFEIMDMLD
Sbjct: 1   MPSQLVRSAKNMVKGYSSTQVMVRDATANDSTSPSVGVLEDLADKTYDTVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDD-SDHDQG 119
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWCKENLYII+TL+EF + D+ S  D+G
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCKENLYIIKTLREFRHEDEVSGSDEG 120

Query: 120 QIIRVKAKELTSLLNDEERL 139
           QIIRVKAKELTSLL D+ERL
Sbjct: 121 QIIRVKAKELTSLLTDDERL 140

 Score =  176 bits (446), Expect = 3e-48,   Method: Compositional matrix adjust.
 Identities = 81/89 (91%), Positives = 86/89 (96%)

Query: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442
           TRTGNQ I+DK+ ELN LLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGY+QVTN+
Sbjct: 361 TRTGNQSISDKYSELNNLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYKQVTNE 420

Query: 443 PKNNPFLNSQYTGLPSTNIVPSHTGYGFG 471
           PKNNPFL+SQYTGLPSTNIVPSHTGYGFG
Sbjct: 421 PKNNPFLSSQYTGLPSTNIVPSHTGYGFG 449

>Suva_10.300 Chr10 (527412..529268) [1857 bp, 618 aa] {ON} YLR206W
           (REAL)
          Length = 618

 Score =  238 bits (606), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 108/139 (77%), Positives = 127/139 (91%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           M KQFVRSAKN+VKGYSSTQV+VR+AT+ND   P IDTLD LA+++YDSV+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMVKGYSSTQVLVRDATANDPRTPSIDTLDDLAQRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120
           KRLNDKGKYW+H+AKSLTVLDYLVRFGSENCVLWC+EN Y+I+TL+EF + ++S  D+GQ
Sbjct: 61  KRLNDKGKYWRHVAKSLTVLDYLVRFGSENCVLWCRENFYVIKTLREFRHENESGFDEGQ 120

Query: 121 IIRVKAKELTSLLNDEERL 139
           IIRVKAKEL SLLND+ERL
Sbjct: 121 IIRVKAKELVSLLNDDERL 139

 Score =  164 bits (414), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 75/90 (83%), Positives = 84/90 (93%)

Query: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442
           TRTGNQ I+DK+ +LN LLA+GTG DTFGNTGE+RIPAQHTKTGTFINSQGTGY+QV N+
Sbjct: 437 TRTGNQSISDKYNDLNVLLATGTGADTFGNTGESRIPAQHTKTGTFINSQGTGYKQVVNE 496

Query: 443 PKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472
           PKNNPFLNSQYTGLPST+IVP+ TGYGFGN
Sbjct: 497 PKNNPFLNSQYTGLPSTSIVPTQTGYGFGN 526

>TPHA0D04560 Chr4 complement(994552..996015) [1464 bp, 487 aa] {ON}
           Anc_7.342 YLR206W
          Length = 487

 Score =  234 bits (596), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 132/243 (54%), Positives = 148/243 (60%), Gaps = 8/243 (3%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           M  QFVRS KNVVKGYSSTQV+VRNAT+N+  GP+ID L  +AEKTYDS +FFEIMDMLD
Sbjct: 1   MSNQFVRSMKNVVKGYSSTQVLVRNATANEGTGPNIDLLADIAEKTYDSADFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDH--DQ 118
           KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLY+I+TL EF Y D++    DQ
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYLIKTLTEFRYEDENSGGVDQ 120

Query: 119 GQIIRVKAKELTSLLNDEERLXXXXXXXXXXXXXXXXXXXXXXXXXXXLQRAIEESKXXX 178
           GQIIRVKAKELT+LL D+ERL                           LQRA+EES+   
Sbjct: 121 GQIIRVKAKELTALLMDDERLREERRLNNRRDRNRNRRPPARNGSDEDLQRALEESR-RT 179

Query: 179 XXXXXXXXXXXXXXXXLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMYYDIFGN 238
                           LQ A                               P+YYD+FGN
Sbjct: 180 AEEDERKRRLNQDDSDLQAA-----LQLSKEEEELKRLQELQSSMHMQQQQPVYYDVFGN 234

Query: 239 PIS 241
           PIS
Sbjct: 235 PIS 237

 Score =  169 bits (428), Expect = 6e-46,   Method: Compositional matrix adjust.
 Identities = 87/153 (56%), Positives = 104/153 (67%), Gaps = 3/153 (1%)

Query: 319 TGSNNPFAMXXXXXXXXXXXDKAHSELPDFNAKPVSAYQPAEXXXXXXXXXXXXXXXXXX 378
           TGSNNPFA+            +A SELPDF      +YQPA+                  
Sbjct: 313 TGSNNPFALNNQQTNNNNV--QAASELPDFTKPQAQSYQPAKLPEQIEIQQPVQQPVQQP 370

Query: 379 XXXXTRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQ 438
                RTGN+++T+K+ ELNQLLASGTGIDTFGNTGE RIPAQHT+TGTFINSQGTGYRQ
Sbjct: 371 LQQ-NRTGNKEMTNKYNELNQLLASGTGIDTFGNTGETRIPAQHTQTGTFINSQGTGYRQ 429

Query: 439 VTNDPKNNPFLNSQYTGLPSTNIVPSHTGYGFG 471
            + + K NPFL++QYTGLPS+NI+P+ TGYGFG
Sbjct: 430 QSGESKVNPFLSNQYTGLPSSNIIPTQTGYGFG 462

>KAFR0L01460 Chr12 complement(270433..272085) [1653 bp, 550 aa] {ON}
           Anc_7.342 YLR206W
          Length = 550

 Score =  235 bits (599), Expect = 8e-70,   Method: Compositional matrix adjust.
 Identities = 110/135 (81%), Positives = 123/135 (91%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           M KQFVRSAKNV+KGYSSTQV+VR+ATSND+   +IDTLD +A ++YDSV+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNVMKGYSSTQVLVRDATSNDNRVTNIDTLDDIASRSYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120
           KRLNDKGKYWKHI KSLTVLDYLVRFGSENCVLWCKENLY+I+TL+EF Y DD+  DQGQ
Sbjct: 61  KRLNDKGKYWKHIVKSLTVLDYLVRFGSENCVLWCKENLYVIKTLREFRYEDDTGIDQGQ 120

Query: 121 IIRVKAKELTSLLND 135
           IIRVKAKELTSLL D
Sbjct: 121 IIRVKAKELTSLLQD 135

 Score =  159 bits (402), Expect = 8e-42,   Method: Compositional matrix adjust.
 Identities = 86/158 (54%), Positives = 101/158 (63%), Gaps = 8/158 (5%)

Query: 316 PLATGSNNPFAMXXXXXXXXXXXDKAHSELPDFNAKPVSAYQPAEXXXXXXXXXXXXXXX 375
           P+ TGSNNPF+M              ++  P    +P  A Q                  
Sbjct: 328 PMVTGSNNPFSMDNLGKVN-------NAPPPQPVPQPQLAVQSPPQQIPQVAMPPLPQQQ 380

Query: 376 XXXXXXXTRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTG 435
                   RTGN++IT+K+ ELN LLA GTG+DTFGNTG+ RIPAQHTKTGTFINSQGTG
Sbjct: 381 EQQPLKQNRTGNEEITEKYSELNNLLAQGTGVDTFGNTGQERIPAQHTKTGTFINSQGTG 440

Query: 436 YRQVTND-PKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472
           Y+QVTN+  KNNPFLN+QYTGLPS+NIVPS TGYGFGN
Sbjct: 441 YKQVTNERSKNNPFLNTQYTGLPSSNIVPSSTGYGFGN 478

>KNAG0C03800 Chr3 (746891..748234) [1344 bp, 447 aa] {ON} Anc_7.342
           YLR206W
          Length = 447

 Score =  229 bits (583), Expect = 1e-68,   Method: Compositional matrix adjust.
 Identities = 119/241 (49%), Positives = 144/241 (59%), Gaps = 5/241 (2%)

Query: 5   FVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLN 64
            +RSAKN+VKGYS T+V+VR+AT+N+S  P  + LD LA+K+Y+SVEFFEI+DMLDKR+N
Sbjct: 1   MLRSAKNIVKGYSDTEVLVRDATANNSTNPSRELLDDLADKSYNSVEFFEILDMLDKRIN 60

Query: 65  DKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQIIRV 124
           DKGKYW+H+AK+LTVLDYLVRFGSENCV+WC+ENLYII+TL+EFS+ D    D+G+IIRV
Sbjct: 61  DKGKYWRHVAKALTVLDYLVRFGSENCVIWCQENLYIIKTLREFSHEDAGGEDEGKIIRV 120

Query: 125 KAKELTSLLNDEERLXXXXXXXXXX----XXXXXXXXXXXXXXXXXLQRAIEESKXXXXX 180
           KAKELTSLL DEERL                               LQRAIEESK     
Sbjct: 121 KAKELTSLLMDEERLKEERAMNIRRRGGPKRRSGGSRERNNRSDEDLQRAIEESKRTAEE 180

Query: 181 XXXXXXXXXXXXXXLQTAXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMYYDIFGNPI 240
                          Q A                               PMYYD+FGNPI
Sbjct: 181 EERRRRNGASSEADRQAA-LQLSREEEDLRRLQEQARLAQQQQQQQQQQPMYYDVFGNPI 239

Query: 241 S 241
           +
Sbjct: 240 T 240

 Score =  164 bits (416), Expect = 2e-44,   Method: Compositional matrix adjust.
 Identities = 88/156 (56%), Positives = 97/156 (62%), Gaps = 23/156 (14%)

Query: 317 LATGSNNPFAMXXXXXXXXXXXDKAHSELPDFNAKPVSAYQPAEXXXXXXXXXXXXXXXX 376
           L TGSNNPFA+             A        A+P +   PA                 
Sbjct: 295 LPTGSNNPFALNNATQPSAPASTTA--------ARPAAIETPA---------------TQ 331

Query: 377 XXXXXXTRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGY 436
                 TR+GNQ I+DK+  LN LLASGTGIDTFGNTGE RIPAQHT+TGTFINSQGTGY
Sbjct: 332 TKPLTQTRSGNQAISDKYSALNNLLASGTGIDTFGNTGEQRIPAQHTQTGTFINSQGTGY 391

Query: 437 RQVTNDPKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472
           RQV ND K NPFLN QYTGLPSTNIVP+ TG+GFGN
Sbjct: 392 RQVNNDDKPNPFLNGQYTGLPSTNIVPTQTGFGFGN 427

>TBLA0E00480 Chr5 complement(88019..89818) [1800 bp, 599 aa] {ON}
           Anc_7.342 YLR206W
          Length = 599

 Score =  230 bits (586), Expect = 2e-67,   Method: Compositional matrix adjust.
 Identities = 107/143 (74%), Positives = 123/143 (86%), Gaps = 4/143 (2%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           M KQF+RS KN+VKGYSSTQ++VR+AT+ND   P ID LD +AEKTYDSV+FFEIMDMLD
Sbjct: 1   MSKQFLRSTKNMVKGYSSTQILVRDATANDENTPSIDILDDIAEKTYDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSD----H 116
           KRLNDKGKYWKH+AKSLTVLDYL+RFGSENCV WCKENLY+I+TLKEF   D  D    +
Sbjct: 61  KRLNDKGKYWKHVAKSLTVLDYLIRFGSENCVFWCKENLYLIKTLKEFRVDDAIDYNTGY 120

Query: 117 DQGQIIRVKAKELTSLLNDEERL 139
           DQGQI+RV+A ELTSLL D+ERL
Sbjct: 121 DQGQIVRVRATELTSLLMDDERL 143

 Score =  163 bits (413), Expect = 5e-43,   Method: Compositional matrix adjust.
 Identities = 84/161 (52%), Positives = 105/161 (65%), Gaps = 6/161 (3%)

Query: 316 PLATGSNNPFAMXXXXXXXXXX---XDKAHSELPDFNA-KPVSAYQPAEXXXXXXXXXXX 371
           P+ TG+NNPF++                + + LPD ++ K  ++  PA            
Sbjct: 401 PMVTGTNNPFSLSNINNPQQQQPPLMSSSSTTLPDLSSFKQSTSVPPA--TQSSYTTKTN 458

Query: 372 XXXXXXXXXXXTRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINS 431
                       RTGNQ+I+DK+  LN LLA+GTGIDTFGNTG+ RIPAQHT TGTFINS
Sbjct: 459 ASSLPPQPIPQMRTGNQEISDKYNNLNTLLATGTGIDTFGNTGDMRIPAQHTATGTFINS 518

Query: 432 QGTGYRQVTNDPKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472
           QGTGY+Q  NDPKNNPF+++QYTGLPSTN+VPS+TGYGFGN
Sbjct: 519 QGTGYKQYINDPKNNPFMSNQYTGLPSTNVVPSYTGYGFGN 559

>SAKL0F10934g Chr6 (856966..858462) [1497 bp, 498 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 498

 Score =  225 bits (574), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 106/139 (76%), Positives = 120/139 (86%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           M K  +R+AKNVV GYSS QV+VRNATSN+  GP +D LD LAEKTYD+VEFFEIMDMLD
Sbjct: 1   MSKALLRTAKNVVNGYSSVQVLVRNATSNEPTGPTVDQLDELAEKTYDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120
           KRLNDKGK W+H+AKSLTVLDYLVR+GSENCVLW +ENLYII+TL+EF + D+   D GQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRYGSENCVLWSQENLYIIKTLREFMHEDEMGVDHGQ 120

Query: 121 IIRVKAKELTSLLNDEERL 139
           IIRVKAKELTSLL DEERL
Sbjct: 121 IIRVKAKELTSLLRDEERL 139

 Score =  156 bits (394), Expect = 5e-41,   Method: Compositional matrix adjust.
 Identities = 72/91 (79%), Positives = 83/91 (91%), Gaps = 1/91 (1%)

Query: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442
           TRTGNQ I+ K+ +LN LLASGTG+DTFGNTG+ RIPAQHT+TG FINSQGTGY+QVTND
Sbjct: 374 TRTGNQSISQKYNDLNNLLASGTGLDTFGNTGQTRIPAQHTRTGNFINSQGTGYKQVTND 433

Query: 443 -PKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472
            PKNNPFL +QYTGLPST++VPS+TGYGFGN
Sbjct: 434 QPKNNPFLAAQYTGLPSTSVVPSYTGYGFGN 464

>KLLA0C16731g Chr3 complement(1463616..1465052) [1437 bp, 478 aa]
           {ON} some similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 478

 Score =  223 bits (568), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 120/246 (48%), Positives = 145/246 (58%), Gaps = 5/246 (2%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           M K F+RSAKN+V GYS  QV+VR+ATSND  GP +D L+ LAE+T+D+VEFFEIMDMLD
Sbjct: 1   MSKAFLRSAKNLVNGYSQAQVLVRSATSNDKDGPSVDQLEELAERTFDNVEFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDD-SDHDQG 119
           KRLNDKG+ W+H+AKSLT LD+LVR GSENCV WCKENLYII+TL+EF++ D+ ++ D G
Sbjct: 61  KRLNDKGRNWRHVAKSLTCLDFLVRCGSENCVFWCKENLYIIKTLREFTHTDEFTEIDNG 120

Query: 120 QIIRVKAKELTSLLNDEERLXXXXXX-XXXXXXXXXXXXXXXXXXXXXLQRAIEESKXXX 178
           +I+RVKAKELT+LL DEERL                            LQRA+EES+   
Sbjct: 121 EIVRVKAKELTALLRDEERLKEERMMRLKGRKRGGRKNRRDDNEDDDDLQRALEESRITA 180

Query: 179 XXXXXXXXXXXXX--XXXLQTA-XXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXPMYYDI 235
                             LQ A                                PMYYDI
Sbjct: 181 EEEERRRKQLMMQGDDSSLQAALELSKEEEELRRLQQLQAQQQAALWQQQQQQQPMYYDI 240

Query: 236 FGNPIS 241
           FGNPIS
Sbjct: 241 FGNPIS 246

 Score =  160 bits (405), Expect = 9e-43,   Method: Compositional matrix adjust.
 Identities = 74/90 (82%), Positives = 82/90 (91%), Gaps = 1/90 (1%)

Query: 384 RTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND- 442
           RTGNQ I+DKF ELN LLASGTGIDTFGNTGE R+PAQHTKTGTFINSQGTGY+Q+TND 
Sbjct: 360 RTGNQSISDKFSELNNLLASGTGIDTFGNTGETRVPAQHTKTGTFINSQGTGYKQITNDA 419

Query: 443 PKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472
           PK+NPFL SQYTG+PS+ I PS+TGYGFGN
Sbjct: 420 PKHNPFLTSQYTGIPSSAIAPSYTGYGFGN 449

>NDAI0D00610 Chr4 (133678..135138) [1461 bp, 486 aa] {ON} Anc_7.342
           YDL161W
          Length = 486

 Score =  222 bits (566), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 103/139 (74%), Positives = 124/139 (89%), Gaps = 1/139 (0%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           M KQFVRSAKN++KGYS+TQV+VR+ATSNDS  P  + L  ++++++DSV+FFEIMDMLD
Sbjct: 1   MSKQFVRSAKNMMKGYSTTQVLVRDATSNDSSNPSFEILYEISKRSFDSVDFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120
           KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCK+NLYII+TLKEF  ++D + D+  
Sbjct: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKQNLYIIKTLKEFK-LEDDNVDESS 119

Query: 121 IIRVKAKELTSLLNDEERL 139
           IIRVKAKELT+LL D+ERL
Sbjct: 120 IIRVKAKELTALLQDDERL 138

 Score =  162 bits (409), Expect = 3e-43,   Method: Compositional matrix adjust.
 Identities = 87/154 (56%), Positives = 98/154 (63%), Gaps = 22/154 (14%)

Query: 319 TGSNNPFAMXXXXXXXXXXXDKAHSELPDFNAKPVSAYQPAEXXXXXXXXXXXXXXXXXX 378
           TGSNNPFA+                     N  P+   +PAE                  
Sbjct: 323 TGSNNPFALNAT-----------------INTSPI---RPAEQQPQPQFTAPQQQQQPLQ 362

Query: 379 XXXX-TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYR 437
                TRTGNQ I+DK+ ELN LLASGTGIDTFGNTG+ RIPAQHT+TGTFINSQGTGY+
Sbjct: 363 QPLKQTRTGNQSISDKYNELNNLLASGTGIDTFGNTGDQRIPAQHTQTGTFINSQGTGYK 422

Query: 438 QVTNDP-KNNPFLNSQYTGLPSTNIVPSHTGYGF 470
           Q+ NDP K NPFLN+QYTGLPS+NIVPSHTGYGF
Sbjct: 423 QIVNDPVKKNPFLNNQYTGLPSSNIVPSHTGYGF 456

>KAFR0B00890 Chr2 (166365..167609) [1245 bp, 414 aa] {ON} Anc_7.342
           YLR206W
          Length = 414

 Score =  218 bits (554), Expect = 9e-65,   Method: Compositional matrix adjust.
 Identities = 100/135 (74%), Positives = 117/135 (86%)

Query: 5   FVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLN 64
            +RSAKN+VKGYSSTQ +VR+ATSN    P ID L  LAE TY+++EFFEIMDMLDKR+N
Sbjct: 1   MLRSAKNLVKGYSSTQKLVRDATSNSHDNPPIDQLSELAEMTYNNMEFFEIMDMLDKRIN 60

Query: 65  DKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQIIRV 124
            KGKYWKH+ KSL VLDYLVRFGSENCV+WCKENLYII+TL+EF+Y D+S  DQGQ++RV
Sbjct: 61  SKGKYWKHVIKSLIVLDYLVRFGSENCVIWCKENLYIIKTLREFTYEDESGMDQGQMVRV 120

Query: 125 KAKELTSLLNDEERL 139
           +AKELTSLL DEERL
Sbjct: 121 RAKELTSLLMDEERL 135

 Score =  157 bits (397), Expect = 3e-42,   Method: Compositional matrix adjust.
 Identities = 85/157 (54%), Positives = 99/157 (63%), Gaps = 28/157 (17%)

Query: 316 PLATGSNNPFAMXXXXXXXXXXXDKAHSELPDFNAKPVSAYQPAEXXXXXXXXXXXXXXX 375
           PLATGSNNPFA+            + H+  P      ++   P +               
Sbjct: 275 PLATGSNNPFALNNKKL-------QQHTPEPSVIDTTLNTQAPLKQ-------------- 313

Query: 376 XXXXXXXTRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTG 435
                  TRTG+Q I+DK+  LN LLA+GTGIDTFGNTG  RIPAQHTKTGTFINSQGTG
Sbjct: 314 -------TRTGSQSISDKYSALNTLLATGTGIDTFGNTGNQRIPAQHTKTGTFINSQGTG 366

Query: 436 YRQVTNDPKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472
           Y+QV+ +  NN FLNSQYTGLPS+NIVPS TGYGFGN
Sbjct: 367 YKQVSTNGFNNVFLNSQYTGLPSSNIVPSQTGYGFGN 403

>Kwal_56.24610 s56 complement(1073855..1075381) [1527 bp, 508 aa]
           {ON} YDL161W (ENT1) - Ent1p [contig 161] FULL
          Length = 508

 Score =  213 bits (543), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 117/255 (45%), Positives = 142/255 (55%), Gaps = 16/255 (6%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           M K  +R AKNVV GYS+TQV++R ATSND  GP +D +D +AE+++DSV FFEIMDMLD
Sbjct: 1   MSKSLIRKAKNVVNGYSTTQVLLREATSNDPEGPSLDIMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120
           KRLNDKGK W+H+AKSLTVLDYLVR GSE+CV W KENLY+I+TL+EF + D+   DQGQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYVIKTLREFMHEDELGIDQGQ 120

Query: 121 IIRVKAKELTSLLNDEERLXXXXXXXXXXXXXXXXXXXXXXXXXXXLQRAIEESKXXXXX 180
           I+RVKA+ELT+LL D+ERL                           LQRA+EES+     
Sbjct: 121 IVRVKARELTALLLDDERL--REERSLRTKNRKPRRRPTAGSEDEDLQRAMEESRLTAEQ 178

Query: 181 XXXXXXXXXX----XXXXLQTAXXXXXXXXXXXXXXXXXXXXXX----------XXXXXX 226
                             LQTA                                      
Sbjct: 179 EEAERRRKLEIYDNSSDDLQTALQLSKEEEELRRLRELQMQQQMQQAQQQMFGLSQQQTQ 238

Query: 227 XXXPMYYDIFGNPIS 241
              PMYYD+FGNPIS
Sbjct: 239 AQQPMYYDVFGNPIS 253

 Score =  156 bits (395), Expect = 3e-41,   Method: Compositional matrix adjust.
 Identities = 71/89 (79%), Positives = 80/89 (89%)

Query: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442
           TRTGNQ IT+K  ELN LLASGTG+DTFGNTG+ RIPAQHTKTG FINSQGTGY+QV++ 
Sbjct: 395 TRTGNQSITEKHSELNNLLASGTGLDTFGNTGQTRIPAQHTKTGNFINSQGTGYKQVSST 454

Query: 443 PKNNPFLNSQYTGLPSTNIVPSHTGYGFG 471
           PK+NPFL  QYTGLPSTN+VPS+TGYGFG
Sbjct: 455 PKHNPFLGQQYTGLPSTNVVPSYTGYGFG 483

>KLTH0H01430g Chr8 (132738..134246) [1509 bp, 502 aa] {ON} some
           similarities with uniprot|Q12518 Saccharomyces
           cerevisiae YDL161W ENT1
          Length = 502

 Score =  206 bits (525), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 93/135 (68%), Positives = 115/135 (85%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           M K  +R AKNVV GYS+TQV++R ATSND  GP +D +D +AE+++DSV FFEIMDMLD
Sbjct: 1   MSKSLMRRAKNVVNGYSTTQVLLREATSNDPDGPSLDLMDEIAERSWDSVSFFEIMDMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120
           KRLNDKGK W+H+AKSLTVLDYLVR GSE+CV W KENLYII+TL+EF++ D++  DQGQ
Sbjct: 61  KRLNDKGKNWRHVAKSLTVLDYLVRCGSEHCVPWAKENLYIIKTLREFTHEDETGVDQGQ 120

Query: 121 IIRVKAKELTSLLND 135
           I+RVKA+ELT+LL D
Sbjct: 121 IVRVKARELTALLQD 135

 Score =  158 bits (400), Expect = 7e-42,   Method: Compositional matrix adjust.
 Identities = 85/159 (53%), Positives = 98/159 (61%), Gaps = 7/159 (4%)

Query: 316 PLATGSNNPFAMXXXXXXXXXXXDKAHSELPDFNAKPVSAYQPAEXXXXXXXXXXXXXXX 375
           PL TGSNNPFA              A +  P       +     +               
Sbjct: 325 PLETGSNNPFAKNAQQPSAEDPSKYAAASSPQ-----RTQQLSPQLQPQPEQFQQQQQQI 379

Query: 376 XXXXXXXTRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTG 435
                  TRTGNQ +TDKF +LN LLASGTG+DTFGNTG+ RIPAQHTKTGTFINSQGTG
Sbjct: 380 PQQPLKQTRTGNQSVTDKFSDLNNLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTG 439

Query: 436 YRQVTNDP--KNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472
           Y+QV+N P  K+NPFL  QYTGLPST++VPS+TGYGFGN
Sbjct: 440 YKQVSNMPQGKHNPFLGQQYTGLPSTSVVPSYTGYGFGN 478

 Score = 32.3 bits (72), Expect = 3.3,   Method: Compositional matrix adjust.
 Identities = 11/12 (91%), Positives = 12/12 (100%)

Query: 230 PMYYDIFGNPIS 241
           PMYYD+FGNPIS
Sbjct: 240 PMYYDVFGNPIS 251

>Ecym_4731 Chr4 (1427875..1429419) [1545 bp, 514 aa] {ON} similar to
           Ashbya gossypii ACL157C
          Length = 514

 Score =  195 bits (495), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 90/140 (64%), Positives = 112/140 (80%), Gaps = 1/140 (0%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           M KQ +RSAKNV+ GYS  QV+VRNATSND  GP +D ++ LAE+TY +VEFFEIM MLD
Sbjct: 1   MSKQLLRSAKNVMNGYSQAQVLVRNATSNDEYGPSLDQMEELAERTYSAVEFFEIMVMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSD-HDQG 119
           +RLNDK K W+H+AKSLTV DYLVR G+E CV W +EN++II+ L EF ++D+S   D G
Sbjct: 61  RRLNDKPKNWRHVAKSLTVTDYLVRTGAEACVDWARENMFIIRKLTEFVHVDESSGTDHG 120

Query: 120 QIIRVKAKELTSLLNDEERL 139
           Q+IRVKAKEL +LL D+ERL
Sbjct: 121 QLIRVKAKELIALLRDDERL 140

 Score =  158 bits (400), Expect = 9e-42,   Method: Compositional matrix adjust.
 Identities = 73/91 (80%), Positives = 84/91 (92%), Gaps = 1/91 (1%)

Query: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442
           TRTGNQ I+DK+GELN LLA+GTGIDTFGNTG+ARI +QHTKT TFINS GTG++QV+N+
Sbjct: 403 TRTGNQSISDKYGELNALLATGTGIDTFGNTGQARISSQHTKTETFINSHGTGFKQVSNE 462

Query: 443 -PKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472
            PK+NPFL +QYTGLPSTNIVPSHTGYGFGN
Sbjct: 463 PPKHNPFLTTQYTGLPSTNIVPSHTGYGFGN 493

>KNAG0B02650 Chr2 (511995..513935) [1941 bp, 646 aa] {ON} Anc_7.342
           YLR206W
          Length = 646

 Score =  192 bits (487), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 86/140 (61%), Positives = 115/140 (82%), Gaps = 1/140 (0%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           M +QFVRSAKNV+KGYSSTQV+VR+AT+ND   P +DTL+ +A  ++DSV+FFEIMD+L+
Sbjct: 1   MSRQFVRSAKNVMKGYSSTQVLVRDATANDGRTPHLDTLEDIAGLSFDSVDFFEIMDVLE 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDS-DHDQG 119
           KRLND GKYW+HI KSLTVLDYLVRFGSE+C  W +++L++++ L+ F ++DD    DQG
Sbjct: 61  KRLNDSGKYWRHIEKSLTVLDYLVRFGSEHCADWARDHLFLLKALRNFRFVDDGIGFDQG 120

Query: 120 QIIRVKAKELTSLLNDEERL 139
           QI+RVKA++L  LL   E+L
Sbjct: 121 QIVRVKARDLVELLQSGEQL 140

 Score =  144 bits (363), Expect = 3e-36,   Method: Compositional matrix adjust.
 Identities = 67/91 (73%), Positives = 79/91 (86%), Gaps = 3/91 (3%)

Query: 385 TGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTN--- 441
           TGNQ++T+K+ ELN LLA GTG+DTFGN G  RIPAQHT+TGTFINSQGTG++QV +   
Sbjct: 496 TGNQEVTNKYSELNNLLAQGTGVDTFGNEGTQRIPAQHTQTGTFINSQGTGFKQVNSEGK 555

Query: 442 DPKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472
           DP +NPFLNSQYTGLPST IVP++TGYGFGN
Sbjct: 556 DPNSNPFLNSQYTGLPSTGIVPAYTGYGFGN 586

>ACL157C Chr3 complement(79325..80872) [1548 bp, 515 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLR206W
           (ENT2) and YDL161W (ENT1)
          Length = 515

 Score =  178 bits (451), Expect = 6e-49,   Method: Compositional matrix adjust.
 Identities = 80/132 (60%), Positives = 105/132 (79%), Gaps = 1/132 (0%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           M KQ +RSAKNVV GYS  Q++VRNATSN+  GP +D ++ LAE++Y +VEFFEI+ MLD
Sbjct: 1   MSKQLLRSAKNVVNGYSPAQILVRNATSNEEYGPSMDQMEELAERSYSAVEFFEIVVMLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDH-DQG 119
           KRL+DK K+W+H+AKSLTV D+LVR G+E CV W +ENLY+ + L EF ++D+S   D G
Sbjct: 61  KRLSDKPKHWRHVAKSLTVTDFLVRTGAETCVDWARENLYLFRRLTEFYHVDESTGVDHG 120

Query: 120 QIIRVKAKELTS 131
           QIIRVKA+EL +
Sbjct: 121 QIIRVKARELVA 132

 Score =  160 bits (405), Expect = 1e-42,   Method: Compositional matrix adjust.
 Identities = 75/91 (82%), Positives = 84/91 (92%), Gaps = 1/91 (1%)

Query: 383 TRTGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTND 442
           TRTGNQ ITDK+ ELN LLASGTG+DTFGNTG+ RIPAQHTKTGTFINSQGTGY+QV N+
Sbjct: 401 TRTGNQSITDKYSELNTLLASGTGLDTFGNTGQTRIPAQHTKTGTFINSQGTGYKQVGNE 460

Query: 443 -PKNNPFLNSQYTGLPSTNIVPSHTGYGFGN 472
            PK+NPF+ +QYTGLPSTN+VPSHTGYGFGN
Sbjct: 461 PPKHNPFIATQYTGLPSTNMVPSHTGYGFGN 491

>TBLA0E02040 Chr5 complement(494899..497004) [2106 bp, 701 aa] {ON}
           Anc_7.342 YLR206W
          Length = 701

 Score =  177 bits (448), Expect = 2e-47,   Method: Compositional matrix adjust.
 Identities = 81/139 (58%), Positives = 104/139 (74%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLD 60
           M  QFVRS KN+ KGYS TQV+VR+AT+N+  G  ID LD L E +YD+ EF +I  +LD
Sbjct: 1   MSHQFVRSTKNMFKGYSPTQVLVRDATANNDSGTSIDVLDQLGEMSYDTHEFRDIFSVLD 60

Query: 61  KRLNDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120
           +R++DK KYW+H+AKSLTV+DYLVRFGSE CV W ++N   ++ L++F Y D +  DQGQ
Sbjct: 61  RRISDKPKYWRHVAKSLTVVDYLVRFGSEACVQWARDNARQLEILRDFYYSDSAGIDQGQ 120

Query: 121 IIRVKAKELTSLLNDEERL 139
           +IRVKA EL  LL D ERL
Sbjct: 121 LIRVKAAELIDLLRDPERL 139

 Score =  110 bits (275), Expect = 8e-25,   Method: Compositional matrix adjust.
 Identities = 53/78 (67%), Positives = 59/78 (75%)

Query: 385 TGNQDITDKFGELNQLLASGTGIDTFGNTGEARIPAQHTKTGTFINSQGTGYRQVTNDPK 444
           TGN  I+ K+  LNQLLA GTGIDTFGN G  RIPAQHTKTGTFINSQGTGY+QVT+   
Sbjct: 596 TGNSVISAKYSNLNQLLAQGTGIDTFGNEGATRIPAQHTKTGTFINSQGTGYKQVTSSSS 655

Query: 445 NNPFLNSQYTGLPSTNIV 462
             P L +QYTGLP+   V
Sbjct: 656 PIPLLPTQYTGLPAQTAV 673

>Kwal_47.16857 s47 (145176..146324) [1149 bp, 382 aa] {ON} YJR125C
           (ENT3) - Ent3p [contig 219] FULL
          Length = 382

 Score =  100 bits (248), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 51/138 (36%), Positives = 83/138 (60%), Gaps = 1/138 (0%)

Query: 3   KQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKR 62
           K++ R A+NVV  Y+  +  VR AT+N+  G     ++ +A+ TY+  E  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQIAQGTYNYREREEILGMIFRR 75

Query: 63  LNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQI 121
             +K    W+ I K+L +LDYL+R G+E  +   + NL +I+ L+ F YID    DQG  
Sbjct: 76  FTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELTSLLNDEERL 139
           +R +A EL  LL+D+ ++
Sbjct: 136 VRNRAHELALLLDDDAKV 153

>NDAI0D03200 Chr4 complement(764129..765436) [1308 bp, 435 aa] {ON}
           Anc_4.346
          Length = 435

 Score =  100 bits (249), Expect = 4e-22,   Method: Compositional matrix adjust.
 Identities = 52/138 (37%), Positives = 83/138 (60%), Gaps = 1/138 (0%)

Query: 3   KQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKR 62
           K++ R A+NVV  Y+  +  VR AT+N+  G     ++ +A+ TY+  E +EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVFNYTEMESKVREATNNEPWGASSTLMEQIAQGTYNVRERYEIVGMIFRR 75

Query: 63  LNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQI 121
             +K G  W+ I K+L +LDYL++ GSE  +   + +L +IQ L+ F YID    DQG  
Sbjct: 76  FTEKAGSEWRQIYKALQLLDYLIKHGSEPFIDDVRSSLKLIQMLETFHYIDSEGRDQGIN 135

Query: 122 IRVKAKELTSLLNDEERL 139
           +R +AK L  LL D+  +
Sbjct: 136 VRNRAKLLVELLQDDSNI 153

>KNAG0M00380 Chr13 (56675..57886) [1212 bp, 403 aa] {ON} Anc_4.346
           YJR125C
          Length = 403

 Score = 99.8 bits (247), Expect = 6e-22,   Method: Compositional matrix adjust.
 Identities = 51/135 (37%), Positives = 81/135 (60%), Gaps = 1/135 (0%)

Query: 3   KQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKR 62
           K++ R A+NVV  ++  +  VR AT+N+  G     ++ +A+ TY+  E  E+M ML +R
Sbjct: 16  KKYFRKAQNVVFNFTEMESKVREATNNEPWGASSTLMEQIAQGTYNYKEREEVMMMLMRR 75

Query: 63  LNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQI 121
             +K G  W+ I K+L +LDYL+R GSE  +   +  L I++ L+ F YID    DQG  
Sbjct: 76  FTEKAGSEWRQIYKALQLLDYLIRRGSEKFIDDVRAALRIVRLLESFHYIDSQGRDQGVN 135

Query: 122 IRVKAKELTSLLNDE 136
           +R +AK++  LL D+
Sbjct: 136 VRNRAKQIVELLQDD 150

>TBLA0E04760 Chr5 complement(1226806..1228086) [1281 bp, 426 aa]
           {ON} Anc_4.346 YJR125C
          Length = 426

 Score = 98.6 bits (244), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 84/138 (60%), Gaps = 1/138 (0%)

Query: 3   KQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKR 62
           K++ R A+NVV  Y+  +  VR AT+N+  G     ++ +A+ TY+  E  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVFNYTDMEAKVREATNNEPWGASSTLMEQIAQGTYNPREREEILSMILRR 75

Query: 63  LNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQI 121
             +K G  W+ I K+L +L+YL+  G+E  +   + +L +I+ L+ F Y+D    DQG  
Sbjct: 76  FTEKSGNLWRQIYKALQLLEYLITHGAERFIDEARSSLGLIRMLESFHYVDSEGRDQGAN 135

Query: 122 IRVKAKELTSLLNDEERL 139
           +R +A+ +TSLL+ ++ +
Sbjct: 136 VRSRAQAMTSLLSSDDAI 153

>TDEL0D00710 Chr4 (127174..128301) [1128 bp, 375 aa] {ON} Anc_4.346
           YJR125C
          Length = 375

 Score = 97.8 bits (242), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 50/138 (36%), Positives = 83/138 (60%), Gaps = 1/138 (0%)

Query: 3   KQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKR 62
           K++ R A+NVV  Y+  +  VR AT+N+  G     ++ +++ TY+  E  EI+ M+ +R
Sbjct: 16  KKYFRRAQNVVFNYTDMEAKVREATNNEPWGASTTLMEQISQGTYNMREREEILGMIFRR 75

Query: 63  LNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQI 121
           L +K    W+ I K+L +LDYL+R  SE  +   + ++ +I+ L+ F YID    DQG  
Sbjct: 76  LTEKRANEWRQIYKALQLLDYLIRHASERFIDDTRSSISLIKMLESFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELTSLLNDEERL 139
           +R +AK L  LL+D+E +
Sbjct: 136 VRNRAKALAELLSDDETI 153

>KLTH0D16896g Chr4 complement(1395711..1396916) [1206 bp, 401 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 401

 Score = 98.2 bits (243), Expect = 2e-21,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 83/138 (60%), Gaps = 1/138 (0%)

Query: 3   KQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKR 62
           K++ R A+N+V  Y+  +  VR AT+N+  G     ++ +++ TY+  E  EI+ M+ +R
Sbjct: 16  KKYFRKAQNMVFNYTEMEAKVREATNNEPWGASSTLMEQISQGTYNYREREEILGMIFRR 75

Query: 63  LNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQI 121
             +K    W+ I K+L +LDYL+R G+E  +   + NL +I+ L+ F YID    DQG  
Sbjct: 76  FTEKTASEWRQIYKALQLLDYLIRHGAERFIDDTRANLSLIKMLESFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELTSLLNDEERL 139
           +R +A EL  LL+D+ ++
Sbjct: 136 VRNRAHELVLLLDDDGKI 153

>Kpol_1001.2 s1001 (8057..9313) [1257 bp, 418 aa] {ON} (8057..9313)
           [1257 nt, 419 aa]
          Length = 418

 Score = 98.2 bits (243), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 85/138 (61%), Gaps = 1/138 (0%)

Query: 3   KQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKR 62
           K++ R A+NV+  Y+  +  VR AT+N+  G     ++ +++ TY+  E  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVMFNYTEMEGKVREATNNEPWGASSTLMEQISQGTYNIREREEILSMIFRR 75

Query: 63  LNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQI 121
             +K    W+ I K+L +L+YL++ GSE  +   + +L +I+ L+ F YID    DQG  
Sbjct: 76  FTEKTASEWRQIYKALQLLEYLIKHGSERFIDDVRSSLSLIKMLESFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELTSLLNDEERL 139
           +R KA+ LT+LL D+E++
Sbjct: 136 VRNKAQSLTALLKDDEQI 153

>KAFR0B06740 Chr2 (1406075..1407274) [1200 bp, 399 aa] {ON}
           Anc_4.346 YJR125C
          Length = 399

 Score = 97.8 bits (242), Expect = 3e-21,   Method: Compositional matrix adjust.
 Identities = 52/138 (37%), Positives = 84/138 (60%), Gaps = 1/138 (0%)

Query: 3   KQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKR 62
           K++ R A+NVV  Y+  +  VR AT+N+  G     ++ +A+ TY+  E  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNLREREEILGMIFRR 75

Query: 63  LNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQI 121
             +K G  W+ I KSL +LDYL+R GSE  +   + ++ +I+ L+ F YID    DQG  
Sbjct: 76  FTEKAGSEWRQIYKSLQLLDYLIRRGSERFIDDVRSSIRLIELLETFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELTSLLNDEERL 139
           +R +AK L  LL+D+ ++
Sbjct: 136 VRNRAKALGELLSDDTKI 153

>YJR125C Chr10 complement(654737..655963) [1227 bp, 408 aa] {ON}
           ENT3Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p
          Length = 408

 Score = 97.1 bits (240), Expect = 5e-21,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 83/138 (60%), Gaps = 1/138 (0%)

Query: 3   KQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKR 62
           K++ R A+NVV  Y+  +  VR AT+N+  G     +D +++ TY+  E  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRR 75

Query: 63  LNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQI 121
             +K G  W+ I K+L +LDYL++ GSE  +   + ++ +I+ L+ F YID    DQG  
Sbjct: 76  FTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELTSLLNDEERL 139
           +R + K L  LL+D+ ++
Sbjct: 136 VRTRVKALIELLSDDNKI 153

>Smik_10.418 Chr10 complement(643833..645062) [1230 bp, 409 aa] {ON}
           YJR125C (REAL)
          Length = 409

 Score = 97.1 bits (240), Expect = 6e-21,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 83/138 (60%), Gaps = 1/138 (0%)

Query: 3   KQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKR 62
           K++ R A+NVV  Y+  +  VR AT+N+  G     +D +++ TY+  E  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRR 75

Query: 63  LNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQI 121
             +K G  W+ I K+L +LDYL++ GSE  +   + ++ +I+ L+ F YID    DQG  
Sbjct: 76  FTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRNSINLIRILETFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELTSLLNDEERL 139
           +R + K L  LL+D+ ++
Sbjct: 136 VRTRVKALIDLLSDDNKI 153

>KLLA0B04587g Chr2 (411097..412299) [1203 bp, 400 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125C ENT3
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p
          Length = 400

 Score = 96.3 bits (238), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 82/138 (59%), Gaps = 1/138 (0%)

Query: 3   KQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKR 62
           K++ R A+NVV  Y+  +  VR AT+N+  G     ++ +A+ TY+  E  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEHIAQGTYNYREREEILGMIFRR 75

Query: 63  LNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQI 121
             +K    W+ I K+L +L+YLV+ GSE  +   + NL +++ L+ F YID    DQG  
Sbjct: 76  FTEKTASEWRQIYKALQLLEYLVKHGSERFIDDVRTNLNLVKMLESFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELTSLLNDEERL 139
           +R +A +L  LL  +E++
Sbjct: 136 VRNRASQLVKLLESDEQI 153

>Skud_10.349 Chr10 complement(613398..614630) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 96.3 bits (238), Expect = 8e-21,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 83/138 (60%), Gaps = 1/138 (0%)

Query: 3   KQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKR 62
           K++ R A+NVV  Y+  +  VR AT+N+  G     +D +++ TY+  E  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRR 75

Query: 63  LNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQI 121
             +K G  W+ I K+L +LDYL++ GSE  +   + ++ +I+ L+ F YID    DQG  
Sbjct: 76  FTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILETFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELTSLLNDEERL 139
           +R + K L  LL+D+ ++
Sbjct: 136 VRTRVKTLIELLSDDNKI 153

>SAKL0G17952g Chr7 complement(1555520..1556767) [1248 bp, 415 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 415

 Score = 96.7 bits (239), Expect = 9e-21,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 83/138 (60%), Gaps = 1/138 (0%)

Query: 3   KQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKR 62
           K++ R A+NVV  Y+  +  VR AT+N+  G     ++ ++  TY+  E  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVFNYTEMEAKVREATNNEPWGASSTLMEQISAGTYNYREREEILGMIFRR 75

Query: 63  LNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQI 121
             +K    W+ I K+L +L+YL++ GSE  +   + NL +I+ L+ F Y D    DQG  
Sbjct: 76  FTEKTASEWRQIYKALQLLEYLIKHGSERFIDDSRANLTLIKMLESFHYTDSQGRDQGIN 135

Query: 122 IRVKAKELTSLLNDEERL 139
           +R +A+EL  LLN+++++
Sbjct: 136 VRNRAQELVKLLNNDDQI 153

>Suva_12.216 Chr12 complement(334254..335486) [1233 bp, 410 aa] {ON}
           YJR125C (REAL)
          Length = 410

 Score = 95.5 bits (236), Expect = 2e-20,   Method: Compositional matrix adjust.
 Identities = 48/138 (34%), Positives = 82/138 (59%), Gaps = 1/138 (0%)

Query: 3   KQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKR 62
           K++ R A+NVV  Y+  +  VR AT+N+  G     +D +++ TY+  E  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMDQISQGTYNFREREEILSMIFRR 75

Query: 63  LNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQI 121
             +K G  W+ I K+L +LDYL++ GSE  +   + ++ +I+ L+ F Y D    DQG  
Sbjct: 76  FTEKAGSEWRQIYKALQLLDYLIKHGSERFIDDTRSSINLIKILESFHYTDSQGRDQGIN 135

Query: 122 IRVKAKELTSLLNDEERL 139
           +R + K L  LL+D+ ++
Sbjct: 136 VRTRVKALVELLSDDSKI 153

>AER155C Chr5 complement(929042..930136) [1095 bp, 364 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YJR125C
           (ENT3)
          Length = 364

 Score = 93.6 bits (231), Expect = 4e-20,   Method: Compositional matrix adjust.
 Identities = 50/136 (36%), Positives = 79/136 (58%), Gaps = 1/136 (0%)

Query: 3   KQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKR 62
           K++ R A+NV+  Y+  +  VR AT+N+  G     +  +A+ TY+  E  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVMLNYTGMEAKVREATNNEPWGASSTLMTQIAQGTYNFREREEILAMILRR 75

Query: 63  LNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQI 121
             +K    W+ I KS+ +L+YLV+ GSE  +   + NL +I+ L+ F YID    DQG  
Sbjct: 76  FLEKSANEWRQIYKSMQLLEYLVKHGSERFIDDVRSNLNLIRMLETFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELTSLLNDEE 137
           +R + K L  LL D+E
Sbjct: 136 VRNRTKALVKLLEDDE 151

>ZYRO0B14784g Chr2 complement(1205944..1207218) [1275 bp, 424 aa]
           {ON} similar to uniprot|P47160 Saccharomyces cerevisiae
           YJR125C ENT3 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p
          Length = 424

 Score = 94.0 bits (232), Expect = 6e-20,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 83/138 (60%), Gaps = 1/138 (0%)

Query: 3   KQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKR 62
           K++ R A+NVV  Y+  +  VR AT+N+  G     ++ +A+ TY+  E  EI+ M+ +R
Sbjct: 51  KKYFRKAQNVVFNYTEMEAKVREATNNEPWGTSSTLMEYIAQGTYNLREREEILGMIFRR 110

Query: 63  LNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQI 121
             +K    W+ I K+L +L+YL++ GSE  +   + ++ +++ L+ F Y+D    DQG  
Sbjct: 111 FTEKTANEWRQIYKALQLLEYLIKHGSERFIDDTRCSISLLKMLESFHYVDSQGRDQGIN 170

Query: 122 IRVKAKELTSLLNDEERL 139
           +R +AK LT LL D+ ++
Sbjct: 171 VRTRAKALTELLGDDNKI 188

>Ecym_1133 Chr1 (274069..275247) [1179 bp, 392 aa] {ON} similar to
           Ashbya gossypii AER155C
          Length = 392

 Score = 91.7 bits (226), Expect = 3e-19,   Method: Compositional matrix adjust.
 Identities = 49/138 (35%), Positives = 81/138 (58%), Gaps = 1/138 (0%)

Query: 3   KQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKR 62
           K++ R A+NVV  Y+  +  VR AT+N+S G     +  +A+ TY+  E  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVFNYTGMEAKVREATNNESWGAPSSLMAQIAQGTYNYRERKEILGMIFRR 75

Query: 63  LNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQI 121
             +K    W+ I KS+ +L+YL+  GSE  +   +  L +I+ L+ F YID    DQG  
Sbjct: 76  FVEKTASEWRQIYKSVQLLEYLIYHGSEGFIDDVRSGLNLIKMLESFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELTSLLNDEERL 139
           +R + + L  LLN++E++
Sbjct: 136 VRNRTQALVQLLNNDEQI 153

>NCAS0A06210 Chr1 complement(1229758..1231029) [1272 bp, 423 aa]
           {ON} Anc_4.346
          Length = 423

 Score = 91.3 bits (225), Expect = 5e-19,   Method: Compositional matrix adjust.
 Identities = 47/138 (34%), Positives = 80/138 (57%), Gaps = 1/138 (0%)

Query: 3   KQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKR 62
           K++ R A+NVV  Y+  +  VR AT+N+  G     ++ +A+ TY+  E  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVFNYTEMEGKVREATNNEPWGASSTLMEQIAQGTYNIREREEILSMIFRR 75

Query: 63  LNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQI 121
             +K G  W+ I K+L +LDYL++ GSE  +   + ++ +++ L+ F YID    DQG  
Sbjct: 76  FTEKTGSEWRQIYKALQLLDYLIKHGSEKFIDDVRSSVAVLKLLQTFHYIDAEGRDQGIN 135

Query: 122 IRVKAKELTSLLNDEERL 139
           +R +   L  LL D+  +
Sbjct: 136 VRNRVTTLIELLRDDNSI 153

>TPHA0B00400 Chr2 (83356..84555) [1200 bp, 399 aa] {ON} Anc_4.346
           YJR125C
          Length = 399

 Score = 89.4 bits (220), Expect = 2e-18,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 79/136 (58%), Gaps = 1/136 (0%)

Query: 3   KQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKR 62
           K++ R A+NV+  Y+  +  VR AT+N+  G     +  +A+ TY+  E  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVMFNYTDMEAKVREATNNEPWGASSTLMKQIAQGTYNIREREEILGMVFRR 75

Query: 63  LNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQI 121
             +K    W+ I KSL + DYL++ GSE  +   + ++ +I+ L+ F YID    DQG  
Sbjct: 76  YTEKTASEWRQIYKSLQLTDYLIKHGSERFIDDVRTSISLIKMLESFHYIDSQGRDQGIN 135

Query: 122 IRVKAKELTSLLNDEE 137
           +R KA+ L + L D++
Sbjct: 136 VRNKAQSLVAFLKDDD 151

>CAGL0H04323g Chr8 (407884..409122) [1239 bp, 412 aa] {ON} similar
           to uniprot|P47160 Saccharomyces cerevisiae YJR125c ENT3
           cytoskeletal adaptor
          Length = 412

 Score = 85.5 bits (210), Expect = 4e-17,   Method: Compositional matrix adjust.
 Identities = 43/122 (35%), Positives = 73/122 (59%), Gaps = 1/122 (0%)

Query: 3   KQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKR 62
           K++ R A+NVV  Y+  +  VR AT+N+  G     ++ +A+ TY+  E  EI+ M+ +R
Sbjct: 16  KKYFRKAQNVVYNYTDMESKVREATNNEPWGASSTLMEQIAQGTYNIREREEILGMIFRR 75

Query: 63  LNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQI 121
             +K G  W+ I K+L +L+YL++ GSE  +   + ++ I++ L+ F YID    DQG  
Sbjct: 76  FTEKSGSEWRQIYKALQLLEYLIKHGSERFIDDTRNSISIVKLLESFHYIDSQGRDQGVN 135

Query: 122 IR 123
           +R
Sbjct: 136 VR 137

>SAKL0H25762g Chr8 (2256842..2257630) [789 bp, 262 aa] {ON} some
           similarities with uniprot|Q07872 Saccharomyces
           cerevisiae YLL038C ENT4 Protein of unknown function
           contains an N-terminal epsin-like domain
          Length = 262

 Score = 75.1 bits (183), Expect = 2e-14,   Method: Compositional matrix adjust.
 Identities = 45/140 (32%), Positives = 79/140 (56%), Gaps = 12/140 (8%)

Query: 5   FVRSAKNVVKGYSSTQVMVRNATSNDS-GGPDIDTLDALAEKTYDSVEFFEIMDMLDKRL 63
           F+RS +N+  G S+T+V V+ AT +D   G     ++ ++  TY +    EI  ++ +RL
Sbjct: 3   FIRSVRNM--GQSTTEVKVKKATDDDEYSGATGALMNEISVLTYSAKTLREITQVIHRRL 60

Query: 64  NDKGKYWK-------HIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDH 116
           +  G Y K       HI K+LT++ YL+  GS + V W ++  Y++ TL+EF+   D D 
Sbjct: 61  S--GNYRKSSHRNAVHILKTLTLISYLINNGSNDFVSWIRQYAYLVDTLREFNVSADKDR 118

Query: 117 DQGQIIRVKAKELTSLLNDE 136
              + +R+ + +L+ LL D+
Sbjct: 119 KMAEQVRMLSIKLSKLLKDD 138

>Kwal_55.20611 s55 complement(489968..490732) [765 bp, 254 aa] {ON}
           YLL038C (ENT4) - Ent4p [contig 144] FULL
          Length = 254

 Score = 72.8 bits (177), Expect = 1e-13,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 75/141 (53%), Gaps = 8/141 (5%)

Query: 5   FVRSAKNVVKGYSSTQVMVRNATSNDS-GGPDIDTLDALAEKTYDSVEFFEIMDMLDKRL 63
            +++ +N+  G SST+V  RNAT++D   G     ++ L+  TY      EI  ++ KRL
Sbjct: 3   LLKTVRNI--GQSSTEVKTRNATNDDEHNGATGSLMNELSVLTYSPRTLREITQVIRKRL 60

Query: 64  NDKGKYWKH-----IAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQ 118
           +   +   H     + K+LT++ YL+  GS+  V+W +  LY+I TLKEF+    +    
Sbjct: 61  SGNSRMSSHKNAVHLLKTLTLIAYLINNGSDEFVVWIRSYLYLIDTLKEFNGGSRTKERM 120

Query: 119 GQIIRVKAKELTSLLNDEERL 139
              IR  A  L ++L DEE L
Sbjct: 121 ASQIRNLASSLAAILRDEELL 141

>Kpol_388.5 s388 complement(17825..18631) [807 bp, 268 aa] {ON}
           complement(17825..18631) [807 nt, 269 aa]
          Length = 268

 Score = 69.7 bits (169), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 73/138 (52%), Gaps = 8/138 (5%)

Query: 8   SAKNVVKGYSSTQVMVRNATS-NDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLNDK 66
           S +N V+  S+T+  V+ AT  N++ G     ++ ++  TY      EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SATEAKVKEATDDNETSGATGTLMNEISVLTYSPKTLKEIIQVLKKRLTGS 63

Query: 67  GKYWKH-----IAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQI 121
            K   H     I K++T++ YL+  GS + + W + N+ I + LK+F  I + D    + 
Sbjct: 64  SKKSSHRNCVHILKTMTLISYLINNGSNDFIAWARSNIMIFEVLKDFEVIHEDDEKMAEQ 123

Query: 122 IRVKAKELTSLLNDEERL 139
           IR  A +L  L+ND+E L
Sbjct: 124 IRYIAGDLCILINDDELL 141

>TDEL0G01740 Chr7 (342371..343144) [774 bp, 257 aa] {ON} Anc_4.17
           YLL038C
          Length = 257

 Score = 69.3 bits (168), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 45/145 (31%), Positives = 81/145 (55%), Gaps = 10/145 (6%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNAT-SNDSGGPDIDTLDALAEKTYDSVEFFEIMDML 59
           MP   + S + +V+  S+T++ V+ AT  N+S G     ++ ++  TY      EI+ ++
Sbjct: 1   MP--LLDSVRTLVQ--STTELKVKQATDENESSGATGTLMNEISVLTYSPKTLKEIVQVV 56

Query: 60  DKRLNDKG-----KYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDS 114
            KRL   G     K   H+ K+LT++ YL+  GS + + W + N+ ++  LKEF+  D +
Sbjct: 57  RKRLMGHGRRNSHKICIHLVKTLTLVTYLMNNGSNDFIAWVRGNMALVDCLKEFNVQDRN 116

Query: 115 DHDQGQIIRVKAKELTSLLNDEERL 139
           D   GQ IR  +++L +L+ D++ L
Sbjct: 117 DEKIGQQIRAMSQDLCTLIKDDDLL 141

>TBLA0B06220 Chr2 (1466908..1467927) [1020 bp, 339 aa] {ON}
           Anc_4.346 YJR125C
          Length = 339

 Score = 68.9 bits (167), Expect = 6e-12,   Method: Compositional matrix adjust.
 Identities = 44/139 (31%), Positives = 72/139 (51%), Gaps = 1/139 (0%)

Query: 2   PKQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDK 61
            K+F R A+N +   +  +  VR AT+ND  G  +  +  +   T++  +  +I++ML  
Sbjct: 15  AKKFFRMAENFLFNLTDMESKVREATNNDPWGTSVILMAQINAGTFEINQRADIINMLLN 74

Query: 62  RLNDK-GKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQ 120
           R  +K G  W+ I KS+ +L YL+  GS   V   K NL +I+ L  F +IDD  ++Q  
Sbjct: 75  RFLEKNGSQWRQIYKSVLLLQYLLINGSTEFVSEVKLNLTLIKNLMLFEFIDDQGYNQSS 134

Query: 121 IIRVKAKELTSLLNDEERL 139
            I    + L  L+ D+  L
Sbjct: 135 KISKATERLIELMTDDHLL 153

>KLTH0E05874g Chr5 complement(530814..531581) [768 bp, 255 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 255

 Score = 62.4 bits (150), Expect = 4e-10,   Method: Compositional matrix adjust.
 Identities = 43/131 (32%), Positives = 67/131 (51%), Gaps = 6/131 (4%)

Query: 15  GYSSTQVMVRNATSNDS-GGPDIDTLDALAEKTYDSVEFFEIMDMLDKRL--NDKGKYWK 71
           G S T++  +NAT++D   G     ++ ++  TY S    EI  ++ KRL  N++    K
Sbjct: 11  GQSQTEIKTKNATNDDEYSGATGSLMNEISVLTYSSRTLREITAVVRKRLSGNNRKSSHK 70

Query: 72  ---HIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQIIRVKAKE 128
              HI K+LT+  YL+  GS   V W +  +Y+I +LKEF+            IR  A  
Sbjct: 71  NAVHILKTLTLTAYLINNGSNEFVAWIRSYVYLIDSLKEFTIGSRGQERMAVQIRSLAST 130

Query: 129 LTSLLNDEERL 139
           L+ +L D+E L
Sbjct: 131 LSVILRDDELL 141

>TPHA0F00230 Chr6 complement(43589..44431) [843 bp, 280 aa] {ON}
           Anc_4.17 YLL038C
          Length = 280

 Score = 59.7 bits (143), Expect = 4e-09,   Method: Compositional matrix adjust.
 Identities = 41/138 (29%), Positives = 71/138 (51%), Gaps = 8/138 (5%)

Query: 8   SAKNVVKGYSSTQVMVRNATSND-SGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRL--- 63
           S +N V+  S T+  VR AT +D + G     ++ ++  TY      EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SPTESKVRQATDDDETSGATGTLMNEISVLTYSPKTLKEIVQILKKRLTGY 63

Query: 64  --NDKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQI 121
              +  K   HI K+LT++ YL+  GS + + W + N+ + + LK F   +  D   GQ 
Sbjct: 64  SKKNSHKNCVHILKTLTLITYLINNGSNDFIAWTRSNIMLFEYLKNFEVQNLEDEKMGQQ 123

Query: 122 IRVKAKELTSLLNDEERL 139
           I     ++ +++ND++ L
Sbjct: 124 IVFICNDICNIINDDDML 141

>TBLA0G00650 Chr7 (140678..141949) [1272 bp, 423 aa] {ON} Anc_4.17
           YLL038C
          Length = 423

 Score = 60.5 bits (145), Expect = 5e-09,   Method: Compositional matrix adjust.
 Identities = 43/140 (30%), Positives = 75/140 (53%), Gaps = 11/140 (7%)

Query: 8   SAKNVVKGYSSTQVMVRNATS-NDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLNDK 66
           S +N V+  S T++ VR AT  N++ G     ++ ++  TY +    EI+ +L KRL   
Sbjct: 6   SVRNFVQ--SPTELKVRTATDDNENSGATGTLMNEISVLTYSTKTNKEIVTVLKKRLTGY 63

Query: 67  GKYWKH-----IAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQI 121
           GK   H     I K+LT++ YL+  GS   + W  EN  + + +K F  + D+ HD+   
Sbjct: 64  GKKSSHRNCIHIIKTLTLIAYLMNNGSLEFIRWINENQLLFEVMKNFE-VSDTIHDEKFA 122

Query: 122 IRVK--AKELTSLLNDEERL 139
           I+++  ++ +  L+N+ E L
Sbjct: 123 IQIRDLSERILELINNRELL 142

>ZYRO0G07876g Chr7 complement(636468..637247) [780 bp, 259 aa] {ON}
           similar to uniprot|Q07872 Saccharomyces cerevisiae
           YLL038C ENT4 Protein of unknown function contains an N-
           terminal epsin-like domain
          Length = 259

 Score = 58.2 bits (139), Expect = 9e-09,   Method: Compositional matrix adjust.
 Identities = 42/133 (31%), Positives = 64/133 (48%), Gaps = 6/133 (4%)

Query: 13  VKGYSSTQVMVRNATSNDSGGPDIDTL-DALAEKTYDSVEFFEIMDMLDKRLNDKGKYWK 71
           V G SST++ VR AT+ D       TL + ++  TY      EI  +L +RL+  G+   
Sbjct: 9   VFGPSSTELKVRKATNEDEKTGATGTLMNEISVLTYSPKTVREITQVLKRRLSSYGRRTS 68

Query: 72  H-----IAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQIIRVKA 126
           H     I K+LT++ YL+  GSE  V W + NL   + LK        D    + IR  +
Sbjct: 69  HKNSIHIVKALTLILYLINNGSEEFVAWVRGNLIYFECLKSCEVSQKRDEPLAKQIRSMS 128

Query: 127 KELTSLLNDEERL 139
            ++   + D+E L
Sbjct: 129 NQICDCVKDDELL 141

>KLLA0D03949g Chr4 (333566..334243) [678 bp, 225 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038C ENT4
           Protein of unknown function contains an N- terminal
           epsin- like domain
          Length = 225

 Score = 57.4 bits (137), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 40/133 (30%), Positives = 74/133 (55%), Gaps = 8/133 (6%)

Query: 15  GYSSTQVMVRNAT-SNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLNDKGKYWK-- 71
           G S+TQ+ V+ AT SN+S G     ++ L+  TY      EI +++ KRL +     K  
Sbjct: 11  GQSTTQLKVKQATDSNESYGATGTLMNELSVLTYSEKSANEIYEVIRKRLMNGSSRLKNS 70

Query: 72  -----HIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQIIRVKA 126
                 + K+LT+++YL+  GSE  VLW + +L  I+ LK++   +D D  + + I+  +
Sbjct: 71  HDSVVQVLKTLTLIEYLLYNGSEEFVLWMRRHLAYIEALKDYHCSNDKDKSKVKQIKSLS 130

Query: 127 KELTSLLNDEERL 139
           ++++  L +++ L
Sbjct: 131 EDISKNLKEDDFL 143

>Ecym_8407 Chr8 (843359..844123) [765 bp, 254 aa] {ON} similar to
           Ashbya gossypii ACL061C
          Length = 254

 Score = 57.8 bits (138), Expect = 1e-08,   Method: Compositional matrix adjust.
 Identities = 45/147 (30%), Positives = 75/147 (51%), Gaps = 14/147 (9%)

Query: 1   MPKQFVRSAKNVVKGYSSTQVMVRNATSN-DSGGPDIDTLDALAEKTYDSVEFFEIMDML 59
           MP  F+ S +++  G SST V V+ AT + +  G     ++ +A  TY      EI  +L
Sbjct: 1   MP--FLSSVRHL--GSSSTTVKVKKATDDSEHNGAYGSLMNEIAILTYSPNTLREITQVL 56

Query: 60  DKRLNDKGKYWK-------HIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYID 112
            KRL   G Y K       ++ K+LT++ +LV  GSE C+ W + +L +I++ ++F+  D
Sbjct: 57  KKRL--VGNYKKTPSKRAVNLLKTLTLIRFLVINGSEECIAWLRRHLVLIRSFQDFTLRD 114

Query: 113 DSDHDQGQIIRVKAKELTSLLNDEERL 139
                    I++ + +L  LL D   L
Sbjct: 115 GEKKQMVNQIQLLSCKLCQLLTDSNLL 141

>Suva_10.35 Chr10 complement(70188..70931) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 57.0 bits (136), Expect = 2e-08,   Method: Compositional matrix adjust.
 Identities = 39/130 (30%), Positives = 66/130 (50%), Gaps = 7/130 (5%)

Query: 17  SSTQVMVRNATSND-SGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ ATS D + G     ++ ++  TY      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQIVRKRLLLGQNRRNSHRS 72

Query: 70  WKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQIIRVKAKEL 129
              + K+LT++ YL+  GS   + W K N+ +I+ L++F   D  D   G+ IR  ++ L
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQAQDARDDRNGEEIRKLSRNL 132

Query: 130 TSLLNDEERL 139
             LL D+E L
Sbjct: 133 HELLQDDELL 142

>Skud_12.30 Chr12 complement(56967..57710) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 51.6 bits (122), Expect = 1e-06,   Method: Compositional matrix adjust.
 Identities = 36/127 (28%), Positives = 63/127 (49%), Gaps = 7/127 (5%)

Query: 17  SSTQVMVRNATSND-SGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ ATS D + G     ++ ++  TY      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATSEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQIIRVKAKEL 129
              + K+LT++ YL+  GS   + W K N+ +I+ L+ F   D  D  + + IR  ++ L
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILENFHIQDVRDERKREEIRKLSRNL 132

Query: 130 TSLLNDE 136
             LL D+
Sbjct: 133 LELLQDD 139

>ACL061C Chr3 complement(256803..257507) [705 bp, 234 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YLL038C
           (ENT4)
          Length = 234

 Score = 49.7 bits (117), Expect = 4e-06,   Method: Compositional matrix adjust.
 Identities = 37/131 (28%), Positives = 60/131 (45%), Gaps = 6/131 (4%)

Query: 15  GYSSTQVMVRNATS-NDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLNDKG-----K 68
           G S T   VR AT  N+  G     +  +   TY      ++  +L KRL+        K
Sbjct: 11  GSSPTAAKVRKATDDNEFVGASSALISEITILTYSCKTLLDVTRVLKKRLSGNANKSSHK 70

Query: 69  YWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQIIRVKAKE 128
              HI K+LT+ +YL+  GSE+ V W +    +++ LK+F+  ++ D      IR  +  
Sbjct: 71  NAVHILKALTLTNYLIANGSEDFVQWLQGCAVLLRRLKDFTTGNERDSHMASQIRSFSLS 130

Query: 129 LTSLLNDEERL 139
           L  L+ +   L
Sbjct: 131 LLELMQNPALL 141

>CAGL0E03806g Chr5 (356594..357376) [783 bp, 260 aa] {ON} similar to
           uniprot|Q07872 Saccharomyces cerevisiae YLL038c ENT4
          Length = 260

 Score = 48.1 bits (113), Expect = 2e-05,   Method: Compositional matrix adjust.
 Identities = 34/124 (27%), Positives = 61/124 (49%), Gaps = 8/124 (6%)

Query: 8   SAKNVVKGY--SSTQVMVRNATS-NDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLN 64
           S  +  KG+  S T++ VR AT  N+  G     ++ ++  TY      +++ ++ KRL+
Sbjct: 2   SLMHTFKGFLLSPTELKVRQATDDNELAGATGTLMNEISVLTYSKKTLKDVIQVIRKRLS 61

Query: 65  -----DKGKYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQG 119
                +  +   H+ K+LT++ YL+  GS + + W K + Y+I+ L  F     SD    
Sbjct: 62  GVNKRNSHRTCLHVLKTLTLVSYLLNNGSNDFIAWLKSSKYVIEYLSSFEAQSSSDEPMV 121

Query: 120 QIIR 123
             IR
Sbjct: 122 NQIR 125

>TBLA0H01210 Chr8 (269471..270946) [1476 bp, 491 aa] {ON} Anc_8.335
           YDR153C
          Length = 491

 Score = 48.5 bits (114), Expect = 3e-05,   Method: Compositional matrix adjust.
 Identities = 46/165 (27%), Positives = 74/165 (44%), Gaps = 34/165 (20%)

Query: 6   VRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLND 65
            R A+N++  Y   Q+ +R AT+ DS GP    LD +     + V   +I+D + KRL D
Sbjct: 20  ARYAQNMIIAYEPYQIDIRQATNTDSWGPTKKHLDQIL-LDRNKVPLRKIVDYIMKRLMD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYL---VRFGSE---------NCVLW 94
                               G  W+ + KSL VL +L   V  G +         N   +
Sbjct: 79  HINTRPRNLYDRARKDYVNYGTEWRVVFKSLIVLKFLLLNVDPGEQLDDLVEYLLNHYGF 138

Query: 95  CKENLYIIQTLKEFSYIDDSDHDQGQIIRVKAKELTSLLNDEERL 139
            K ++  I  ++  S   DS H   ++I++K +E+  L+NDE+ L
Sbjct: 139 FKHDILEIYQVQNSSDGKDSKHQ--EVIQLKCQEIIELINDEKLL 181

>NDAI0H00280 Chr8 complement(48177..49109) [933 bp, 310 aa] {ON}
           Anc_4.17 YLL038C
          Length = 310

 Score = 47.4 bits (111), Expect = 5e-05,   Method: Compositional matrix adjust.
 Identities = 40/145 (27%), Positives = 78/145 (53%), Gaps = 15/145 (10%)

Query: 8   SAKNVVKGYSSTQVMVRNATS-NDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLND- 65
           + KN V+  + T+  V+ AT  N++ G     ++ ++  TY      +I+ ++ KRL+  
Sbjct: 6   TVKNFVQ--TPTESKVKQATDDNETTGATGTLMNEISVLTYSPKTLKDIIQVIKKRLSSA 63

Query: 66  --KGKYWKH-----IAKSLTVLDYLVRFGSENCVLWCKENLYIIQTL-KEFSY-IDDSDH 116
               K   H     I K+LT++ YL+  GS   + W + N Y+++ + K+ ++ + D+  
Sbjct: 64  TSSNKKLSHKTSVYIIKTLTLISYLINNGSNEFIEWLRLNFYLVENITKKCNFQLQDNSA 123

Query: 117 DQGQI--IRVKAKELTSLLNDEERL 139
           D   I  I+V A+++T+L+N+E  L
Sbjct: 124 DSKMIGQIKVIAEDMTNLINNENLL 148

>YLL038C Chr12 complement(65775..66518) [744 bp, 247 aa] {ON}
           ENT4Protein of unknown function, contains an N-terminal
           epsin-like domain; proposed to be involved in the
           trafficking of Arn1p in the absence of ferrichrome
          Length = 247

 Score = 45.4 bits (106), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 30/113 (26%), Positives = 56/113 (49%), Gaps = 7/113 (6%)

Query: 17  SSTQVMVRNATSND-SGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ D + G     ++ ++  TY      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVIRKRLLLGQNRRNSHRN 72

Query: 70  WKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQII 122
              + K+LT++ YL+  GS   + W K N+ +I+ L++F   D  D  + + I
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKGNMILIEILEDFQVQDPRDERKAEDI 125

>YHR161C Chr8 complement(420373..422286) [1914 bp, 637 aa] {ON}
          YAP1801Protein involved in clathrin cage assembly;
          binds Pan1p and clathrin; homologous to Yap1802p,
          member of the AP180 protein family
          Length = 637

 Score = 46.2 bits (108), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 27/79 (34%), Positives = 42/79 (53%), Gaps = 3/79 (3%)

Query: 22 MVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLNDKGKYWKHIAKSLTVLD 81
          +V+ AT   S  P    LD +   T +  +F+EI+  LD R+ND    W  + KSL V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLGTSNEEDFYEIVKGLDSRINDTA--WTIVYKSLLVVH 64

Query: 82 YLVRFGSENCVL-WCKENL 99
           ++R GS++  L +   NL
Sbjct: 65 LMIREGSKDVALRYYSRNL 83

>Smik_12.19 Chr12 complement(50134..50877) [744 bp, 247 aa] {ON}
           YLL038C (REAL)
          Length = 247

 Score = 45.1 bits (105), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 29/113 (25%), Positives = 56/113 (49%), Gaps = 7/113 (6%)

Query: 17  SSTQVMVRNATSND-SGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRL------NDKGKY 69
           S T+  V+ AT+ D + G     ++ ++  TY      EI+ ++ KRL       +  + 
Sbjct: 13  SPTESKVKQATNEDETSGATGTLMNEISILTYSPKTVREIIQVVRKRLLLGQNRRNSHRN 72

Query: 70  WKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQII 122
              + K+LT++ YL+  GS   + W K N+ +++ L++F   D  D  + + I
Sbjct: 73  CIQVMKTLTLVSYLMNNGSNEFIKWLKSNMILVEILEDFQVQDARDERKAEDI 125

>NCAS0C05840 Chr3 (1202292..1203095) [804 bp, 267 aa] {ON} Anc_4.17
           YLL038C
          Length = 267

 Score = 44.7 bits (104), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 39/135 (28%), Positives = 63/135 (46%), Gaps = 8/135 (5%)

Query: 13  VKGY--SSTQVMVRNATSND-SGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLNDKGKY 69
           VK +  S T+  V+ AT+ D + G     ++ ++  TY      EI+ +L KRL+   + 
Sbjct: 7   VKSFVQSPTESKVKQATNEDETMGATGTLMNEISVLTYSPKTLKEIVQVLKKRLSGYSRK 66

Query: 70  WKH-----IAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYIDDSDHDQGQIIRV 124
             H     I K+LT++ YL+  GS   V W + N  +I  L         D   G  I+ 
Sbjct: 67  TSHKNCIFIIKTLTLMAYLINNGSNEFVAWIRNNSSLISNLISEKVEYPKDDKMGPEIKS 126

Query: 125 KAKELTSLLNDEERL 139
            A +L  L+ D++ L
Sbjct: 127 IAADLMELIQDDDLL 141

>SAKL0H02530g Chr8 (250148..252157) [2010 bp, 669 aa] {ON} weakly
          similar to uniprot|P53309 Saccharomyces cerevisiae
          YGR241C YAP1802 Yeast Assembly Polypeptide, member of
          AP180 protein family, binds Pan1p and clathrin; member
          of clathrin assembly polypeptide AP180 family and
          weakly similar to uniprot|P38856 Saccharomyces
          cerevisiae YHR161C YAP1801 Yeast Assembly Polypeptide
          member of AP180 protein family binds Pan1p and clathrin
          clathrin assembly protein
          Length = 669

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 24/72 (33%), Positives = 36/72 (50%), Gaps = 2/72 (2%)

Query: 22 MVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLNDKGKYWKHIAKSLTVLD 81
          +V+ AT      P    +D +   T DS EF EIM  L+ R+ND    W  + KSL V+ 
Sbjct: 7  LVKGATKIKMAPPKQKYIDPILLGTSDSSEFMEIMKALESRINDTA--WTIVYKSLIVIH 64

Query: 82 YLVRFGSENCVL 93
           ++R G  +  +
Sbjct: 65 LMMRDGDRDVTI 76

>Skud_8.225 Chr8 complement(391820..393685) [1866 bp, 621 aa] {ON}
          YHR161C (REAL)
          Length = 621

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 40/79 (50%), Gaps = 3/79 (3%)

Query: 22 MVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLNDKGKYWKHIAKSLTVLD 81
          +V+ AT   S  P    LD +   T    +F+EI+  LD R+ND    W  + K+L V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLATGSEEDFYEIVKALDSRVNDTA--WTIVYKTLLVVH 64

Query: 82 YLVRFGSENCVL-WCKENL 99
           ++R G ++  L +   NL
Sbjct: 65 LMMREGKKDVALRYYSRNL 83

>KLLA0D16654g Chr4 complement(1413507..1414706) [1200 bp, 399 aa]
           {ON} similar to uniprot|Q6Q5U2 Saccharomyces cerevisiae
           YDR153C ENT5 Protein containing an N-terminal epsin-like
           domain involved in clathrin recruitment and traffic
           between the Golgi and endosomes associates with the
           clathrin adaptor Gga2p clathrin adaptor complex AP-1 and
           clathrin
          Length = 399

 Score = 43.1 bits (100), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 44/160 (27%), Positives = 67/160 (41%), Gaps = 33/160 (20%)

Query: 6   VRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLND 65
            R A+NV+  Y   Q+ +R AT+ DS GP    L  +    Y+ V  F + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDSWGPTPKHLAKVMRHRYE-VSMFLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYLV----RFGSENCVLWCKENLYII 102
                               G  W+ + K L +L+YL+    R    + VL C +    I
Sbjct: 79  HMAKRPKNMYEKARKQYVNYGNEWRVVLKCLVLLEYLLMRSDRGKETDQVLSCLQAHKHI 138

Query: 103 QTLKEFSYIDD--SD-----HDQGQIIRVKAKELTSLLND 135
            T +   Y  D  SD     H++G  I+ K + +  L+ D
Sbjct: 139 LTKETMQYRVDFSSDGKMELHERG--IKKKCEHIIQLIED 176

>KAFR0I01460 Chr9 (304865..305692) [828 bp, 275 aa] {ON} Anc_4.17
           YLL038C
          Length = 275

 Score = 41.6 bits (96), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 44/157 (28%), Positives = 74/157 (47%), Gaps = 30/157 (19%)

Query: 5   FVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTL-DALAEKTYDSVEFFEIMDMLDKRL 63
           F  S +N+V  YS T++ VR AT  +       TL + ++  TY +    EI+ +L K+L
Sbjct: 3   FFNSVRNLV--YSQTELKVRQATDENEIIRSTGTLMNEISVLTYSAKTLKEIIGILKKKL 60

Query: 64  -------NDKG----KYWKHIAKSLTVLDYLVRFGSENCVLWCKENLYIIQTLKEFSYID 112
                  N  G    K    + K+ T++ YL+  GS + + W K N  ++Q L   + +D
Sbjct: 61  SLLYGLKNGNGIISHKVCVQVLKTFTLISYLLNNGSNDFINWLKLNNGVLQIL---AKVD 117

Query: 113 DSDH----------DQGQIIRVKAKELTSLLNDEERL 139
            ++H          +Q Q I    K++  L+ND + L
Sbjct: 118 SNNHITDDEDLHILNQAQKI---TKDIILLINDNKLL 151

>Smik_8.245 Chr8 complement(397342..399225) [1884 bp, 627 aa] {ON}
          YHR161C (REAL)
          Length = 627

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 25/79 (31%), Positives = 41/79 (51%), Gaps = 3/79 (3%)

Query: 22 MVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLNDKGKYWKHIAKSLTVLD 81
          +V+ AT   S  P    LD +   T    +F+EI+  L+ R+ND    W  + KSL V+ 
Sbjct: 7  LVKGATKIKSAPPKQKYLDPILLGTSSEEDFYEIVKGLNFRINDTA--WTIVYKSLLVVH 64

Query: 82 YLVRFGSENCVL-WCKENL 99
           ++R G+++  L +   NL
Sbjct: 65 LMIREGAKDVALRYYSRNL 83

>NCAS0B03660 Chr2 complement(653627..654877) [1251 bp, 416 aa] {ON}
           Anc_8.335 YDR153C
          Length = 416

 Score = 42.0 bits (97), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 33/113 (29%), Positives = 48/113 (42%), Gaps = 24/113 (21%)

Query: 6   VRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLND 65
            R A+NV+  Y   QV +R AT+ D+ GP    L  +    Y  V  + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYLVRFGSE----NCVLWC 95
                               G  W+ + K L V+D+L+   SE    N VL C
Sbjct: 79  HIASRPKNFYEKARKEYVNYGAEWRVVLKCLVVIDFLILNVSEGDELNQVLSC 131

>KNAG0J02870 Chr10 (549107..550096) [990 bp, 329 aa] {ON} Anc_4.17
           YLL038C
          Length = 329

 Score = 41.2 bits (95), Expect = 0.004,   Method: Compositional matrix adjust.
 Identities = 40/150 (26%), Positives = 68/150 (45%), Gaps = 23/150 (15%)

Query: 8   SAKNVVKGYSSTQVMVRNATSND-----SGGPDIDTLDALAEKTYDSVEFFEIMDMLDKR 62
           S +N V   S+T++ V+ AT +      S G  ++ +  L   TY      EI  +L KR
Sbjct: 6   SVRNFVN--STTELKVKQATDDSEVLSSSTGTVMNEISVL---TYSPKTLKEIQSVLRKR 60

Query: 63  LNDKGKYWKHIA--------KSLTVLDYLVRFGSENCVLWCKENLYIIQTLK-----EFS 109
            +      + +         K+LT++ +L+  GS   V W K N+   + L+     EFS
Sbjct: 61  FHLMSTLPRKVLHRSCLIVLKTLTLILFLLNNGSNAFVSWIKSNVGAFEPLQNVPITEFS 120

Query: 110 YIDDSDHDQGQIIRVKAKELTSLLNDEERL 139
           + D +D    + IR  A ++  L+ D+  L
Sbjct: 121 FTDKADLPMYEQIRQSASDILQLIGDDNLL 150

>CAGL0E01199g Chr5 (108041..109279) [1239 bp, 412 aa] {ON} similar
           to uniprot|Q03769 Saccharomyces cerevisiae YDR153c ENT5
          Length = 412

 Score = 40.8 bits (94), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 42/117 (35%), Positives = 54/117 (46%), Gaps = 20/117 (17%)

Query: 6   VRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLND 65
            R A+NV+  Y   QV VR AT+ DS GP    L  +    Y  V  + I + + KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDVRRATNTDSWGPTPKHLAKVLRNRY-QVPLYLITEYILKRLID 78

Query: 66  KGKYWKHIAKSLTVL------DYLVRFGSE-NCVLWCKENLYIIQTLKEFSYIDDSD 115
                 HIA+    L      DY V +GSE   VL C   L +I+ L     +DD D
Sbjct: 79  ------HIAQRPKNLYEKARKDY-VNYGSEWRVVLKC---LVVIEYL--LMNVDDGD 123

>KAFR0B05800 Chr2 complement(1200666..1201814) [1149 bp, 382 aa]
           {ON} Anc_8.335 YDR153C
          Length = 382

 Score = 40.4 bits (93), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/97 (27%), Positives = 44/97 (45%), Gaps = 20/97 (20%)

Query: 7   RSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLNDK 66
           R A+NV+  Y   Q+ VR AT+ D+ GP    L+ +    +  V  + + + + KRL D 
Sbjct: 21  RFAQNVIVQYEPYQIDVRRATNTDAWGPTTKHLEKVMRNRF-QVPMYLVTEYILKRLIDH 79

Query: 67  -------------------GKYWKHIAKSLTVLDYLV 84
                              G  W+ + K LTV++YL+
Sbjct: 80  IATKPKNLYEKARKEYVNYGSEWRVVLKCLTVIEYLL 116

>ZYRO0F13684g Chr6 complement(1125731..1126954) [1224 bp, 407 aa]
           {ON} highly similar to uniprot|Q6Q5U2 Saccharomyces
           cerevisiae YDR153C ENT5 Protein containing an N-terminal
           epsin-like domain involved in clathrin recruitment and
           traffic between the Golgi and endosomes associates with
           the clathrin adaptor Gga2p clathrin adaptor complex AP-1
           and clathrin
          Length = 407

 Score = 40.0 bits (92), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 30/98 (30%), Positives = 43/98 (43%), Gaps = 20/98 (20%)

Query: 6   VRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLND 65
            R A+N++  Y   QV VR AT+ DS GP    L+ +    Y  V  + I +   KRL D
Sbjct: 20  ARFAQNMIVQYEPYQVDVRRATNTDSWGPTPKHLEKVLRNRY-QVPMYLITEYTLKRLID 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYLV 84
                               G  W+ + K LTV++YL+
Sbjct: 79  HIATRPKNFYEKARKEYVNYGSEWRVVLKCLTVVEYLL 116

>NDAI0J00930 Chr10 (209579..210835) [1257 bp, 418 aa] {ON} Anc_8.335
           YDR153C
          Length = 418

 Score = 39.7 bits (91), Expect = 0.015,   Method: Compositional matrix adjust.
 Identities = 34/113 (30%), Positives = 49/113 (43%), Gaps = 24/113 (21%)

Query: 6   VRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLND 65
            R A+NV+  Y   QV +R AT+ D+ GP    L  +    Y  V  + +++   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLQKVLRNRY-QVPLYLMVEYTLKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYL---VRFGSE-NCVLWC 95
                               G  W+ + K LTV++YL   V  G E N V+ C
Sbjct: 79  HIAVKPKNFYERARKEYVNYGAEWRVVLKCLTVVEYLMLNVDDGDELNQVVRC 131

>KLTH0G11902g Chr7 (1002588..1003787) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q6Q5U2 Saccharomyces cerevisiae YDR153C ENT5
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p clathrin adaptor complex AP-1 and clathrin
          Length = 399

 Score = 38.9 bits (89), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 45/160 (28%), Positives = 68/160 (42%), Gaps = 33/160 (20%)

Query: 6   VRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLND 65
            R A+NV+  Y   QV +R AT+ DS GP    L  +    Y  V    + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKYQ-VPLHLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYL---VRFGSE-----NCVLWCKEN 98
                               G  W+ + K L VL+YL   V  GSE     +C+L  K  
Sbjct: 79  HIASRPKNFYEKARKQYVNYGSEWRVVLKCLVVLEYLLLNVDNGSELDQVTSCLLTHKHI 138

Query: 99  LY--IIQTLKEFSYIDDSD-HDQGQIIRVKAKELTSLLND 135
           L   ++Q   +FS     + H++G  I+ K +++   + D
Sbjct: 139 LTRDVMQFRVDFSADGKMEVHERG--IKKKCEQMIQYIED 176

>Kpol_344.8 s344 complement(20765..21919) [1155 bp, 384 aa] {ON}
           complement(20765..21919) [1155 nt, 385 aa]
          Length = 384

 Score = 38.1 bits (87), Expect = 0.044,   Method: Compositional matrix adjust.
 Identities = 36/115 (31%), Positives = 51/115 (44%), Gaps = 24/115 (20%)

Query: 7   RSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFF--------EIMDM 58
           R  +N++  Y   Q+ +R AT+ D+ GP    L  +    Y SV  +         I+D 
Sbjct: 21  RFMQNMIVQYEPYQIDIRRATNTDAWGPTTKHLQKVIRNKY-SVPLYLMTEYVLKRIVDH 79

Query: 59  LDKR---LNDK--------GKYWKHIAKSLTVLDYLVRFGSE----NCVLWCKEN 98
           L KR   L +K        G  W+ I K L V++YL+   SE    N V  C EN
Sbjct: 80  LAKRPKNLYEKARKEYVNYGSEWRIILKCLIVIEYLLLNVSEPEELNQVKSCLEN 134

>KNAG0A05100 Chr1 (744989..746254) [1266 bp, 421 aa] {ON} Anc_8.335
           YDR153C
          Length = 421

 Score = 37.7 bits (86), Expect = 0.060,   Method: Compositional matrix adjust.
 Identities = 27/101 (26%), Positives = 44/101 (43%), Gaps = 20/101 (19%)

Query: 3   KQFVRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKR 62
           +   R A+NV+  Y   QV +R AT+ D+ GP    L  +    Y  V  + + + + KR
Sbjct: 17  RNAARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLSKVLRHRY-QVPMYLMTEYILKR 75

Query: 63  LNDK-------------------GKYWKHIAKSLTVLDYLV 84
           L D                    G  W+ + K LTV+++L+
Sbjct: 76  LVDHIATRPKNLYEKARKDYVNYGAEWRVVLKCLTVIEFLM 116

>SAKL0H15290g Chr8 (1322030..1323211) [1182 bp, 393 aa] {ON} similar
           to uniprot|Q6Q5U2 Saccharomyces cerevisiae YDR153C ENT5
           Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes associates with the clathrin adaptor
           Gga2p clathrin adaptor complex AP-1 and clathrin
          Length = 393

 Score = 37.7 bits (86), Expect = 0.062,   Method: Compositional matrix adjust.
 Identities = 36/133 (27%), Positives = 57/133 (42%), Gaps = 30/133 (22%)

Query: 6   VRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLND 65
            R A+N++  Y   QV +R AT+ DS GP    L  +    +  V  + + + + KRL D
Sbjct: 20  ARFAQNMIVQYEPYQVDIRRATNTDSWGPTPKHLSKVMRNRF-QVPLYLMTEYILKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYL---VRFGSE-----NCVLWCKEN 98
                               G  W+ + K L +L+++   V  G+E     NC+L  K  
Sbjct: 79  HIATRPKNLYEKARKQYVNYGNEWRVVLKCLVLLEHMLLNVDVGNELDQVVNCILTHKHI 138

Query: 99  LY--IIQTLKEFS 109
           L   I+Q   +FS
Sbjct: 139 LTRDIMQYHVDFS 151

>Kwal_YGOB_27.11261 s27 complement(716644..717033,717035..717859)
           [1215 bp, 404 aa] {ON} ANNOTATED BY YGOB -
          Length = 404

 Score = 37.7 bits (86), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 35/113 (30%), Positives = 47/113 (41%), Gaps = 24/113 (21%)

Query: 6   VRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLND 65
            R A+NV+  Y   QV +R AT+ DS GP    L  +    Y  V    + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKY-QVPLHLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYL---VRFGSE-NCVLWC 95
                               G  W+ + K L VL+YL   V  GSE + V+ C
Sbjct: 79  HIASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLLLNVDSGSEVDQVIGC 131

>TBLA0A04040 Chr1 complement(1004703..1005950) [1248 bp, 415 aa]
           {ON} Anc_8.335 YDR153C
          Length = 415

 Score = 37.4 bits (85), Expect = 0.080,   Method: Compositional matrix adjust.
 Identities = 42/168 (25%), Positives = 71/168 (42%), Gaps = 38/168 (22%)

Query: 7   RSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLNDK 66
           R A+NV+  Y   Q+ +R AT+ D+ GP    L  +    Y  V  + + + + KR+ D 
Sbjct: 21  RFAQNVIVQYEPYQIDIRRATNTDAWGPTSKHLAKVLRNRY-QVPLYLMTEYILKRIVDH 79

Query: 67  -------------------GKYWKHIAKSLTVLDYL---VRFGSE-----NCVLWCKENL 99
                              G  W+ + K L V+D+L   V  G E     +C+L  K  L
Sbjct: 80  IAVRPKNFYEKARKDYVNYGAEWRVVLKCLVVIDFLFLNVEEGEELNQVKSCMLTHKHIL 139

Query: 100 YIIQTLKEFSYIDDSD---HDQGQIIRVKAKELTSLLND-----EERL 139
                  +  + +D     H++G  IR K++ +   ++D     EER+
Sbjct: 140 TSQVASYKIPFSNDGKMEIHERG--IRKKSELILQYMDDPRFLREERI 185

>AGR046C Chr7 complement(800910..802073) [1164 bp, 387 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR153C
           (ENT5)
          Length = 387

 Score = 37.4 bits (85), Expect = 0.084,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 42/99 (42%), Gaps = 22/99 (22%)

Query: 6   VRSAKNVVKGYSSTQVMVRNATSNDSGGPD-IDTLDALAEKTYDSVEFFEIMDMLDKRLN 64
            R A+NV+  Y   QV VR AT+ DS GP     L  +  K +  V  + I +   KRL 
Sbjct: 20  ARFAQNVIIQYEPYQVDVRRATNTDSWGPTPKQMLKVMRHKNH--VPMYLITEYTMKRLV 77

Query: 65  DK-------------------GKYWKHIAKSLTVLDYLV 84
           D                    G  W+ + K L VL++L+
Sbjct: 78  DHMAKRPKNLYEKARKQYVNYGHEWRVVLKCLVVLEFLI 116

>Kwal_27.11263 s27 complement(717032..717859) [828 bp, 275 aa] {OFF}
           YDR153C - Hypothetical ORF [contig 29] FULL
          Length = 275

 Score = 36.6 bits (83), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 40/97 (41%), Gaps = 20/97 (20%)

Query: 7   RSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLNDK 66
           R A+NV+  Y   QV +R AT+ DS GP    L  +    Y  V    + +   KRL D 
Sbjct: 21  RFAQNVIVQYEPYQVDIRRATNTDSWGPTPKHLFKVMRNKY-QVPLHLMTEYTLKRLVDH 79

Query: 67  -------------------GKYWKHIAKSLTVLDYLV 84
                              G  W+ + K L VL+YL+
Sbjct: 80  IASRPKNLYEKARKQYVNYGNEWRVVLKCLVVLEYLL 116

>Kpol_1036.76 s1036 complement(205197..206303) [1107 bp, 368 aa]
           {ON} complement(205197..206303) [1107 nt, 369 aa]
          Length = 368

 Score = 36.6 bits (83), Expect = 0.14,   Method: Compositional matrix adjust.
 Identities = 32/120 (26%), Positives = 55/120 (45%), Gaps = 25/120 (20%)

Query: 7   RSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ +R AT+ DS GP    L  +    Y  V  + + + + KRL D 
Sbjct: 21  RFAQNMIVQYEPYQIDIRTATNTDSWGPTSKHLQKVIRHKY-HVPVYLMTEYILKRLIDH 79

Query: 67  -------------------GKYWKHIAKSLTVLDYL---VRFGSE-NCVLWC-KENLYII 102
                              G  W+ + K L ++++L   V  G E + VL C K++++I+
Sbjct: 80  IASKPKNFYEKARKEYVNYGNEWRVVMKCLILIEFLLMNVSDGDELHQVLTCLKKHIHIL 139

>Suva_2.315 Chr2
           complement(560767..560940,560968..561033,561037..562005)
           [1209 bp, 403 aa] {ON} YDR153C (REAL)
          Length = 403

 Score = 35.4 bits (80), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 41/98 (41%), Gaps = 20/98 (20%)

Query: 6   VRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLND 65
            R A+NV+  Y   QV +R AT+ D+ GP    L  +    Y  V  + + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYLV 84
                               G  W+ + K L V+++L+
Sbjct: 79  HIATRPKNLYEKARKDYVNYGSEWRVVLKCLVVVEFLL 116

>NDAI0A02830 Chr1 (636619..638040) [1422 bp, 473 aa] {ON} Anc_5.84
          YGR241C
          Length = 473

 Score = 35.4 bits (80), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 21/77 (27%), Positives = 38/77 (49%), Gaps = 1/77 (1%)

Query: 17 SSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLNDKGKYWKHIAKS 76
          +S + +V+ AT      P    +D +   T +++EF +I+  L  R+N+    W  I K+
Sbjct: 2  TSYKKLVKGATKIKMAPPKQKYVDPILLGTSNNIEFQQIVSELTSRINN-CNIWSVIYKT 60

Query: 77 LTVLDYLVRFGSENCVL 93
          L V+  ++  G  N  L
Sbjct: 61 LIVVHLMISIGEPNVTL 77

>TDEL0F04590 Chr6 complement(864567..865652) [1086 bp, 361 aa] {ON}
           Anc_8.335 YDR153C
          Length = 361

 Score = 34.7 bits (78), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 24/97 (24%), Positives = 42/97 (43%), Gaps = 20/97 (20%)

Query: 7   RSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLNDK 66
           R A+N++  Y   Q+ +R AT+ D+ GP    L+ +    Y  V  + + +   KRL D 
Sbjct: 21  RFAQNMIVQYEPYQIDIRRATNTDAWGPTPKHLEKVLRNRY-QVPLYLLTEYTLKRLVDH 79

Query: 67  -------------------GKYWKHIAKSLTVLDYLV 84
                              G  W+ + K L V+++L+
Sbjct: 80  VATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLL 116

>TPHA0C00740 Chr3 (144476..145633) [1158 bp, 385 aa] {ON} Anc_8.335
           YDR153C
          Length = 385

 Score = 34.3 bits (77), Expect = 0.86,   Method: Compositional matrix adjust.
 Identities = 26/97 (26%), Positives = 41/97 (42%), Gaps = 20/97 (20%)

Query: 7   RSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLNDK 66
           R  +N++  Y   Q+ VR A++ D+ GP    L  +    Y SV  + I +   KRL D 
Sbjct: 21  RFMQNMIVQYEPYQIDVRRASNTDAWGPTSKHLQKVLRHKY-SVPLYLITEYTLKRLIDH 79

Query: 67  -------------------GKYWKHIAKSLTVLDYLV 84
                              G  W+ + K L +LD+L+
Sbjct: 80  IATNSKNVYEKARKEYVNFGSEWRVVFKCLVILDFLL 116

>Smik_4.398 Chr4 complement(724753..726003) [1251 bp, 416 aa] {ON}
           YDR153C (REAL)
          Length = 416

 Score = 33.9 bits (76), Expect = 0.92,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 41/98 (41%), Gaps = 20/98 (20%)

Query: 6   VRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLND 65
            R A+NV+  Y   Q+ +R AT+ D+ GP    L  +    Y  V  + + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYLV 84
                               G  W+ + K L V+++L+
Sbjct: 79  HIATRPKNFYEKARKDYVNYGSEWRVVLKCLAVIEFLL 116

>YDR153C Chr4 complement(766736..767971) [1236 bp, 411 aa] {ON}
           ENT5Protein containing an N-terminal epsin-like domain
           involved in clathrin recruitment and traffic between the
           Golgi and endosomes; associates with the clathrin
           adaptor Gga2p, clathrin adaptor complex AP-1, and
           clathrin
          Length = 411

 Score = 33.9 bits (76), Expect = 0.94,   Method: Compositional matrix adjust.
 Identities = 25/98 (25%), Positives = 41/98 (41%), Gaps = 20/98 (20%)

Query: 6   VRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLND 65
            R A+NV+  Y   Q+ +R AT+ D+ GP    L  +    Y  V  + + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQIDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYLV 84
                               G  W+ + K L V+++L+
Sbjct: 79  HIATRPKNLYEKARKDYVNYGSEWRVVLKCLVVIEFLL 116

>Skud_4.412 Chr4 complement(736255..737475) [1221 bp, 406 aa] {ON}
           YDR153C (REAL)
          Length = 406

 Score = 33.9 bits (76), Expect = 0.95,   Method: Compositional matrix adjust.
 Identities = 26/98 (26%), Positives = 41/98 (41%), Gaps = 20/98 (20%)

Query: 6   VRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLND 65
            R A+NV+  Y   QV +R AT+ D+ GP    L  +    Y  V  + + +   KRL D
Sbjct: 20  ARFAQNVIVQYEPYQVDIRRATNTDAWGPTPKHLAKVLRNRY-QVPLYLMTEYTLKRLVD 78

Query: 66  K-------------------GKYWKHIAKSLTVLDYLV 84
                               G  W+ + K L V+++L+
Sbjct: 79  HIASRPKNLYEKARKDYVNYGSEWRVVLKCLVVVEFLL 116

>NCAS0E03820 Chr5 (750631..751917) [1287 bp, 428 aa] {ON} Anc_5.84
          YGR241C
          Length = 428

 Score = 33.1 bits (74), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 18/72 (25%), Positives = 34/72 (47%), Gaps = 1/72 (1%)

Query: 22 MVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLNDKGKYWKHIAKSLTVLD 81
          +V+ AT      P    +D +   T + +EF +I+  L  R+N+    W  + K+L V+ 
Sbjct: 7  LVKGATKVKMAPPKQKYVDPILLGTANPMEFEQIVSQLTARINN-CNIWSVVYKTLIVVH 65

Query: 82 YLVRFGSENCVL 93
           ++  G +   L
Sbjct: 66 LMISIGEQGVTL 77

>Ecym_4264 Chr4 complement(558142..559368) [1227 bp, 408 aa] {ON}
          similar to Ashbya gossypii AGR046C
          Length = 408

 Score = 32.0 bits (71), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 33/70 (47%), Gaps = 7/70 (10%)

Query: 6  VRSAKNVVKGYSSTQVMVRNATSNDSGGPDIDTLDALAEKTYDSVEFFEIMDMLDKRLND 65
           R A+N++  Y   QV +R AT+ DS GP    L  +    Y  V  + I +   KRL D
Sbjct: 20 ARFAQNMIIQYEPYQVDIRRATNTDSWGPTPKQLAKVMRNRY-QVPMYLITEYTMKRLVD 78

Query: 66 KGKYWKHIAK 75
                H+AK
Sbjct: 79 ------HMAK 82

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.132    0.384 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 34,061,312
Number of extensions: 1274837
Number of successful extensions: 2884
Number of sequences better than 10.0: 99
Number of HSP's gapped: 2889
Number of HSP's successfully gapped: 129
Length of query: 533
Length of database: 53,481,399
Length adjustment: 114
Effective length of query: 419
Effective length of database: 40,409,475
Effective search space: 16931570025
Effective search space used: 16931570025
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.9 bits)
S2: 68 (30.8 bits)