Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_2000.671.81ON82480937950.0
TPHA0B045001.81ON73369014750.0
TDEL0C062001.81ON70058614170.0
Suva_14.701.81ON75158013401e-173
Skud_14.681.81ON75253113311e-172
SAKL0C02596g1.81ON73458013291e-172
Smik_14.651.81ON79057313281e-171
NCAS0A005801.81ON68959113171e-171
KAFR0D039601.81ON66457712981e-168
YNL272C (SEC2)1.81ON75957712701e-163
TBLA0A054301.81ON79561712611e-161
NDAI0F042301.81ON70153412521e-161
KLTH0F02354g1.81ON73357412431e-159
KLLA0C02299g1.81ON65856812091e-155
ZYRO0F16698g1.81ON77954212181e-155
CAGL0J08228g1.81ON75252712001e-153
Ecym_10851.81ON70570911851e-151
Kwal_33.133891.81ON69457611811e-150
AFR670W1.81ON71758211641e-148
KNAG0F004601.81ON65452411221e-142
YMR120C (ADE17)2.418ON59299880.071
YLR285C-AsingletonOFF5625760.10
NCAS0A041502.418ON59270810.48
Smik_13.3152.418ON59299790.87
Skud_13.2802.418ON59299781.0
SAKL0D11396g1.468ON738110771.5
KAFR0G032004.238ON1869146762.0
Suva_13.2992.418ON59270752.6
KLLA0E13025g5.695ON85851743.6
Suva_13.3032.414ON96790735.1
TPHA0G027602.418ON59174717.0
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_2000.67
         (824 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_2000.67 s2000 (144161..146635) [2475 bp, 824 aa] {ON} (1441...  1466   0.0  
TPHA0B04500 Chr2 (1059147..1061348) [2202 bp, 733 aa] {ON} Anc_1...   572   0.0  
TDEL0C06200 Chr3 (1128241..1130343) [2103 bp, 700 aa] {ON} Anc_1...   550   0.0  
Suva_14.70 Chr14 complement(121375..123630) [2256 bp, 751 aa] {O...   520   e-173
Skud_14.68 Chr14 complement(115311..117569) [2259 bp, 752 aa] {O...   517   e-172
SAKL0C02596g Chr3 complement(238404..240608) [2205 bp, 734 aa] {...   516   e-172
Smik_14.65 Chr14 complement(105762..108134) [2373 bp, 790 aa] {O...   516   e-171
NCAS0A00580 Chr1 complement(99945..102014) [2070 bp, 689 aa] {ON...   511   e-171
KAFR0D03960 Chr4 (776847..778841) [1995 bp, 664 aa] {ON} Anc_1.8...   504   e-168
YNL272C Chr14 complement(126805..129084) [2280 bp, 759 aa] {ON} ...   493   e-163
TBLA0A05430 Chr1 complement(1334141..1336528) [2388 bp, 795 aa] ...   490   e-161
NDAI0F04230 Chr6 (1031871..1033976) [2106 bp, 701 aa] {ON} Anc_1...   486   e-161
KLTH0F02354g Chr6 complement(193705..195906) [2202 bp, 733 aa] {...   483   e-159
KLLA0C02299g Chr3 complement(194267..196243) [1977 bp, 658 aa] {...   470   e-155
ZYRO0F16698g Chr6 (1382642..1384981) [2340 bp, 779 aa] {ON} weak...   473   e-155
CAGL0J08228g Chr10 (815653..817911) [2259 bp, 752 aa] {ON} simil...   466   e-153
Ecym_1085 Chr1 complement(170657..172774) [2118 bp, 705 aa] {ON}...   461   e-151
Kwal_33.13389 s33 complement(197441..199525) [2085 bp, 694 aa] {...   459   e-150
AFR670W Chr6 (1668415..1670568) [2154 bp, 717 aa] {ON} Syntenic ...   452   e-148
KNAG0F00460 Chr6 complement(64086..66050) [1965 bp, 654 aa] {ON}...   436   e-142
YMR120C Chr13 complement(507502..509280) [1779 bp, 592 aa] {ON} ...    39   0.071
YLR285C-A Chr12 complement(708168..708338) [171 bp, 56 aa] {OFF}...    34   0.10 
NCAS0A04150 Chr1 (841619..843397) [1779 bp, 592 aa] {ON} Anc_2.4...    36   0.48 
Smik_13.315 Chr13 complement(490547..492325) [1779 bp, 592 aa] {...    35   0.87 
Skud_13.280 Chr13 complement(481756..483534) [1779 bp, 592 aa] {...    35   1.0  
SAKL0D11396g Chr4 (953470..955686) [2217 bp, 738 aa] {ON} simila...    34   1.5  
KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {...    34   2.0  
Suva_13.299 Chr13 complement(487129..488907) [1779 bp, 592 aa] {...    33   2.6  
KLLA0E13025g Chr5 complement(1154244..1156820) [2577 bp, 858 aa]...    33   3.6  
Suva_13.303 Chr13 (492495..495398) [2904 bp, 967 aa] {ON} YMR124...    33   5.1  
TPHA0G02760 Chr7 (588533..590308) [1776 bp, 591 aa] {ON} Anc_2.4...    32   7.0  

>Kpol_2000.67 s2000 (144161..146635) [2475 bp, 824 aa] {ON}
           (144161..146635) [2475 nt, 825 aa]
          Length = 824

 Score = 1466 bits (3795), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 731/809 (90%), Positives = 731/809 (90%)

Query: 1   MEDSSDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKY 60
           MEDSSDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKY
Sbjct: 1   MEDSSDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKY 60

Query: 61  DQLDKNFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADA 120
           DQLDKNFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADA
Sbjct: 61  DQLDKNFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADA 120

Query: 121 RRGAQEIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNXXXXX 180
           RRGAQEIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRN     
Sbjct: 121 RRGAQEIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNSLIST 180

Query: 181 XXXXXXXXXXXXXXXXNSTTNIDLLSNAIYTPKVPAVRYDLYLYNEFLKFIAVLPFCESI 240
                           NSTTNIDLLSNAIYTPKVPAVRYDLYLYNEFLKFIAVLPFCESI
Sbjct: 181 TSASSSSVSLKKTITSNSTTNIDLLSNAIYTPKVPAVRYDLYLYNEFLKFIAVLPFCESI 240

Query: 241 KHTTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNENYR 300
           KHTTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNENYR
Sbjct: 241 KHTTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNENYR 300

Query: 301 FXXXXXXXXXXXXXDPKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARMYML 360
           F             DPKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARMYML
Sbjct: 301 FSSSAPVSNVNSNNDPKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARMYML 360

Query: 361 KTQTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTIAKGDS 420
           KTQTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTIAKGDS
Sbjct: 361 KTQTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTIAKGDS 420

Query: 421 KKXXXXXXXXXXXXXXXXXXXXXXXLMKRRSIMAGFGIXXXXXXXXXXXXXXVGVVDQSG 480
           KK                       LMKRRSIMAGFGI              VGVVDQSG
Sbjct: 421 KKFSSVTAATSSISKSKIEEKFDSKLMKRRSIMAGFGISSISNTTTTKSETSVGVVDQSG 480

Query: 481 LPTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRPELSESNQNGTELEDQQILAN 540
           LPTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRPELSESNQNGTELEDQQILAN
Sbjct: 481 LPTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRPELSESNQNGTELEDQQILAN 540

Query: 541 INNTSEESFTSVRESVEPSDNEDDEPFDFETNESTIQDAVPANAEVNDGGXXXXXXXNHL 600
           INNTSEESFTSVRESVEPSDNEDDEPFDFETNESTIQDAVPANAEVNDGG       NHL
Sbjct: 541 INNTSEESFTSVRESVEPSDNEDDEPFDFETNESTIQDAVPANAEVNDGGETETETENHL 600

Query: 601 GNILDDYDTESIGFENSETEPVLGKENDLTPEEETIEKDESTVGESAEIIDIVQESEVTA 660
           GNILDDYDTESIGFENSETEPVLGKENDLTPEEETIEKDESTVGESAEIIDIVQESEVTA
Sbjct: 601 GNILDDYDTESIGFENSETEPVLGKENDLTPEEETIEKDESTVGESAEIIDIVQESEVTA 660

Query: 661 NDDELKNEAEVTEIQETHEIAENLKEEESNLEIAEDIVKTVDEEQSPLTPEDEHAVPIHI 720
           NDDELKNEAEVTEIQETHEIAENLKEEESNLEIAEDIVKTVDEEQSPLTPEDEHAVPIHI
Sbjct: 661 NDDELKNEAEVTEIQETHEIAENLKEEESNLEIAEDIVKTVDEEQSPLTPEDEHAVPIHI 720

Query: 721 VEEVQNEEFIGTSKVEDKVLLKEQNFDEDTEKVVPSNLQVEQPKAEESLVINEEASEEHS 780
           VEEVQNEEFIGTSKVEDKVLLKEQNFDEDTEKVVPSNLQVEQPKAEESLVINEEASEEHS
Sbjct: 721 VEEVQNEEFIGTSKVEDKVLLKEQNFDEDTEKVVPSNLQVEQPKAEESLVINEEASEEHS 780

Query: 781 VDNDEQVEEETSTIVENEGTTVEETKNEQ 809
           VDNDEQVEEETSTIVENEGTTVEETKNEQ
Sbjct: 781 VDNDEQVEEETSTIVENEGTTVEETKNEQ 809

>TPHA0B04500 Chr2 (1059147..1061348) [2202 bp, 733 aa] {ON} Anc_1.81
           YNL272C
          Length = 733

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/690 (46%), Positives = 423/690 (61%), Gaps = 70/690 (10%)

Query: 1   MEDSSDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKY 60
           M  +SDE KR S+QLT+LSTQL+ESI KQ+ LEDKL++SR+ I EQ+T I QYN+L++KY
Sbjct: 1   MSGNSDEDKRVSVQLTSLSTQLLESIEKQSSLEDKLRQSRKIIEEQKTTITQYNELRIKY 60

Query: 61  DQLDKNFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADA 120
           DQLDKNF+  KV + +LE + + E   +  AE+KVDELNKEVEELTASLFDEANNMVADA
Sbjct: 61  DQLDKNFSKKKVDLQRLEQQLQAEKLGKAEAERKVDELNKEVEELTASLFDEANNMVADA 120

Query: 121 RRGAQEIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNXXXXX 180
           R+    I+ KN+KL E L EKDTILET+NLQLKNLK VL DLQ + +   ++N N     
Sbjct: 121 RKETDSIETKNKKLTEQLLEKDTILETLNLQLKNLKTVLQDLQTESSMSIINNGNISLKG 180

Query: 181 X---XXXXXXXXXXXXXXXNSTTNI----DLLSNAIYTPKVPAVRYDLYLYNEFLKFIAV 233
                              ++TT+     ++++ AI+TPK+  +RYD +LYNEFLKF+AV
Sbjct: 181 DVPLSNENGGSSSHSLKKMSTTTSFQSQQEVVNYAIFTPKITNIRYDTFLYNEFLKFVAV 240

Query: 234 LPFCESIKHTTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLS 293
           LP C SIK+T++ESKLLRRLI+DEI PVLRLD ++GLGW+ KRTLMN ++EGLVVIEPLS
Sbjct: 241 LPHCNSIKNTSAESKLLRRLISDEIHPVLRLDTSNGLGWLTKRTLMNQIVEGLVVIEPLS 300

Query: 294 GVNENYRFXXXXXXXXXXXXXDPKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENRNDVLE 353
           G+NE YR                   +K   +F +P++SPPIAV +PCAFC E+R+D + 
Sbjct: 301 GINETYRQSALYEVSISKSSIKSDQITK-AKMFNFPADSPPIAVRDPCAFCDESRSDCIG 359

Query: 354 HARMYMLKTQTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLS 413
           HARMYMLKTQT+N+D+TLSITNQ+PLCQ CLIKVRQTC+IFAFLRSLK G W LEKVTLS
Sbjct: 360 HARMYMLKTQTRNDDDTLSITNQYPLCQACLIKVRQTCDIFAFLRSLKSGVWQLEKVTLS 419

Query: 414 TIAKGDSKKXXXXXXXXXXXXXXXXXXXXXXXLMKRRSIMAGFGIXXXXXXXXXXXXXXV 473
           TI+KGD+                           KR+SI++  G                
Sbjct: 420 TISKGDTSSFLKVAENQFKQNEKATAQEKK---QKRKSIISSLGKSHSSYVNAKLD---- 472

Query: 474 GVVDQSGLPTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTT--------------KLR 519
             V+  GLP+TNIQRAW+ L KLRS+LHW+HIGI NT++ VT+              KL 
Sbjct: 473 CTVEPVGLPSTNIQRAWLQLCKLRSILHWSHIGISNTEDCVTSTFAPVATNNKVVADKLE 532

Query: 520 PELS-ESNQNGTELEDQQILANINNTSEESFTSVRE------SVEPSDNEDDEPFDFETN 572
           P LS  S  NG+ +  +      NN SEESF S+ E       +   +NE +   + E  
Sbjct: 533 PSLSGTSGTNGSFIPQRD-----NNASEESFLSIPEDIDNDDDIFDFENEGNTTGNIENG 587

Query: 573 ESTIQDAVPANAEVNDGGXXXXXXXNHLGNILDDYDTESI-----------GFENSETEP 621
            +T++D                   N   N+ D+ DT ++             ++ E   
Sbjct: 588 NTTLED---------------RKEENETANLTDELDTANVRDIVDSTDGVEAVDDIEATD 632

Query: 622 VLGKENDLTPEEETIEKDESTVGESAEIID 651
            +G  ++    E T+E D  +VG+  +IID
Sbjct: 633 EIGATDET---EATVEDDILSVGDLVKIID 659

>TDEL0C06200 Chr3 (1128241..1130343) [2103 bp, 700 aa] {ON} Anc_1.81
           YNL272C
          Length = 700

 Score =  550 bits (1417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/586 (50%), Positives = 392/586 (66%), Gaps = 31/586 (5%)

Query: 1   MEDSSDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKY 60
           M +S +ES+R S+Q+++LSTQL+ESI+KQ QLE++L +++RTI  Q+ +++ YNDLK K+
Sbjct: 1   MGESVEESRRVSVQISSLSTQLIESIDKQFQLEEQLNQAKRTIQSQRNSLDSYNDLKSKF 60

Query: 61  DQLDKNFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADA 120
           D ++ +       I +L+ E  +E  LR +AE+ VD+LNKE+E+LTASLFDEAN MVA A
Sbjct: 61  DGVESSLQTKNQIIEELKEELVKEKTLRTTAERNVDDLNKEIEDLTASLFDEANKMVATA 120

Query: 121 RRGAQEIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNXXXXX 180
           R+ +  I+IKN KL E L EKD ILET+NLQLKNLK V+ +L+ +      S  +     
Sbjct: 121 RKESYTIEIKNNKLKEQLDEKDMILETLNLQLKNLKKVIQNLEKE------STTHSGSRS 174

Query: 181 XXXXXXXXXXXXXXXXNSTTNIDLLS-NAIYTPKVPAVRYDLYLYNEFLKFIAVLPFCES 239
                            ST+N D LS   IY+P + +VRYDL LY EFLKFIAVLP+CE+
Sbjct: 175 SFVGNDNSTSSISLNKTSTSNSDELSLGPIYSPNITSVRYDLNLYTEFLKFIAVLPYCET 234

Query: 240 IKHTTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNENY 299
           +K T+S+SKLLRRL+NDEIQP LRLDNASGLGWIV+RTLM+LM+EGLVV+EPLSG+NEN+
Sbjct: 235 LKDTSSDSKLLRRLVNDEIQPALRLDNASGLGWIVRRTLMSLMMEGLVVVEPLSGLNENF 294

Query: 300 RFXXXXXXXXXXXXXDPKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARMYM 359
           ++             +P +  K+ HLF YPS+SPPIAVH+ C+FC E R+DV+EHARMY+
Sbjct: 295 QY-GYTSPVLPSSSFNPSMGGKDSHLFSYPSDSPPIAVHDKCSFCSEARDDVIEHARMYV 353

Query: 360 LKTQTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTIAKGD 419
           LKTQT+ ED +L +TN FPLC+ CL+KVRQTCEIFAFLRSLKLGAWNLEKVTL+ IAKG+
Sbjct: 354 LKTQTRIEDGSLVVTNSFPLCRYCLLKVRQTCEIFAFLRSLKLGAWNLEKVTLTKIAKGE 413

Query: 420 SKKXXXXXXXXXXXXXXXXXXXXXXXLMKRRSIMAGFGIXXXXXXXXXXXXXXVGV-VDQ 478
           S +                        ++R S++ G                 V + VDQ
Sbjct: 414 SSEFSQVSNGNHKGPQKEEKR------LQRMSLITG-------KNQSSKLAPQVDIPVDQ 460

Query: 479 SGLPTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRPELSESNQNGTELEDQQIL 538
            G PTTNIQRAW+ L KLR  LHWAHIGIW+ ++AVT K+ P + E ++N    +D+ I 
Sbjct: 461 IGAPTTNIQRAWLQLCKLRITLHWAHIGIWSVEDAVTQKIGPFVKEEDEN----DDEPIS 516

Query: 539 ANINN-----TSEESFTSVRESVEPSDNEDDEPFDFETNESTIQDA 579
            N N      TSE+   +++ S E  +  DD+ FDFE  ++ +Q A
Sbjct: 517 PNENPPLTKVTSEDGSFTLKNSDEIDEINDDDAFDFEKGKAPVQTA 562

>Suva_14.70 Chr14 complement(121375..123630) [2256 bp, 751 aa] {ON}
           YNL272C (REAL)
          Length = 751

 Score =  520 bits (1340), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 267/580 (46%), Positives = 369/580 (63%), Gaps = 26/580 (4%)

Query: 3   DSSDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKYDQ 62
           ++S+E+KR SIQ+T+LSTQL+ES++KQ+ LE++L +S +TI  Q+ AI+ YN LK  YD 
Sbjct: 2   EASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIAGQKAAIDNYNKLKTDYDT 61

Query: 63  LDKNFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADARR 122
           L K       ++ KL     +E +LR  AE + D+LN+EVE+LTASLFDEAN+MVADAR+
Sbjct: 62  LKKTLLERDNEVMKLNGNIAKETQLRTKAEDESDKLNREVEDLTASLFDEANHMVADARK 121

Query: 123 GAQEIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNXXXXXXX 182
               I+I N++L E L EKD +LET+ LQLKNLK V+H L N+      S R        
Sbjct: 122 EKYAIEILNKRLTEQLREKDALLETLTLQLKNLKKVMHSLDNESTVTNNSGRYSTILSDS 181

Query: 183 XXXXXXXXXXXXXXNSTTNIDLLSNAIYTPKVPAVRYDLYLYNEFLKFIAVLPFCESIKH 242
                         NS T+ DL S  +Y+P + ++RYD  LYNEFLKF+A LP CE+IK 
Sbjct: 182 ATSSSTSLNKVPTSNSFTSQDLYSGIVYSPTISSIRYDSNLYNEFLKFVAALPHCENIKA 241

Query: 243 TTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNENYRFX 302
           T+SESKL+RRL+NDEIQP+L++DNASG+GW+VK+TL++L+I+G+VV+EPLSGVN  Y+  
Sbjct: 242 TSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGMVVVEPLSGVNATYQIG 301

Query: 303 XXXXXXXXXXXXD-PKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARMYMLK 361
                       + PK       +FK+P +SPP+AVH  C+FCGE+R+D++EHARMY+LK
Sbjct: 302 YNSSSPVKQAAPNMPK-------MFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYVLK 354

Query: 362 TQTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTIAKGDSK 421
           T  K +D T  +TN +PLC  CL+KVRQTCEIFAFLRSLK+GAW+LEKVT+  I KGD +
Sbjct: 355 TLHKADDGTEHVTNTYPLCHWCLLKVRQTCEIFAFLRSLKVGAWHLEKVTMQNIVKGDLE 414

Query: 422 KXXXXXXXXXXXXXXXXXXXXXXXLMKRRSIMAGFGIXXXXXXXXXXXXXXVGVVDQSGL 481
           +                       + KR S MAG GI                +  + G 
Sbjct: 415 R----FSEVTKRTKADGRVSPHDKMAKRLSFMAGLGINSSTKSKPRVEVPSSEMTVKPGH 470

Query: 482 PTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRP----ELSESNQNGT---ELED 534
           PTTNIQRAW+ L KLR +LHW+HIGIW  D+++++K+ P    E ++  QN T    L+D
Sbjct: 471 PTTNIQRAWIQLCKLRCILHWSHIGIWAVDDSISSKIGPFVDDEGTDEGQNDTIPVRLQD 530

Query: 535 QQILANINNTSEESFTSVRESVEPSDNEDDEPFDFETNES 574
           + +    N  +  S +S  ES      +  + FDFE++++
Sbjct: 531 KSLWKK-NADTPLSSSSTDES------QKSDTFDFESDDT 563

>Skud_14.68 Chr14 complement(115311..117569) [2259 bp, 752 aa] {ON}
           YNL272C (REAL)
          Length = 752

 Score =  517 bits (1331), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 256/531 (48%), Positives = 345/531 (64%), Gaps = 16/531 (3%)

Query: 3   DSSDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKYDQ 62
           D+S+E+KR SIQ+T+LSTQL+ES++KQ+ LE++L +S +TI  Q+ AIE YN L+  ++ 
Sbjct: 2   DASEEAKRISIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLETDHNT 61

Query: 63  LDKNFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADARR 122
           L K  +    ++ KL  +  +E +LR  AE + D+LN+EVE+LTASLFDEAN MVADARR
Sbjct: 62  LKKTLSERDDEVKKLHEDIAKETQLRTKAEDENDKLNREVEDLTASLFDEANTMVADARR 121

Query: 123 GAQEIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNXXXXXXX 182
               I+I N++L E L EKD +LET+ LQLKNLK V+H L N+      SNR        
Sbjct: 122 EKYAIEILNKRLTEQLREKDVLLETLTLQLKNLKKVMHSLDNESTVTNNSNRYSTILSDS 181

Query: 183 XXXXXXXXXXXXXXNSTTNIDLLSNAIYTPKVPAVRYDLYLYNEFLKFIAVLPFCESIKH 242
                         NS  + D+ S  +Y+P + ++RYD+ LYNEFLKF+A LP CE+IK 
Sbjct: 182 ATSSSTSLNKVPTLNSFASQDMYSGIVYSPTISSIRYDISLYNEFLKFVAALPQCENIKA 241

Query: 243 TTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNENYRFX 302
           T+SESKL+RRL+NDEIQP+L++DNASG+GW+VK+TL++L+I+GLV++EPLSGVN  Y   
Sbjct: 242 TSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVIVEPLSGVNATYHIG 301

Query: 303 XXXXXXXXXXXXD-PKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARMYMLK 361
                       + PK       +FK+P NSPP+AVH  C+FCGE+R+D++EHARMY+LK
Sbjct: 302 YNSSSPVKQSTANMPK-------MFKFPLNSPPVAVHAACSFCGESRDDIIEHARMYVLK 354

Query: 362 TQTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTIAKGDSK 421
           T  K +D T  +TN +PLC  CL+K+RQTCEIFAFLRSLK+GAW+LEK+ +  IAKGD  
Sbjct: 355 TLHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLVMQNIAKGDLV 414

Query: 422 KXXXXXXXXXXXXXXXXXXXXXXXLMKRRSIMAGFGIXXXXXXXXXXXXXXVGVVDQSGL 481
           K                         KR S MAG GI                +  + G 
Sbjct: 415 KFSEVTQRTKTEDRVSSHDKKS----KRLSFMAGLGINSTAKSKPKMEVFSSEINAKPGQ 470

Query: 482 PTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRP----ELSESNQN 528
           PTTNIQRAW+ L KLR +LHW HIGIW  D+++++K+ P    E S+ NQN
Sbjct: 471 PTTNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPLVDDEDSDDNQN 521

>SAKL0C02596g Chr3 complement(238404..240608) [2205 bp, 734 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 734

 Score =  516 bits (1329), Expect = e-172,   Method: Compositional matrix adjust.
 Identities = 265/580 (45%), Positives = 363/580 (62%), Gaps = 43/580 (7%)

Query: 6   DESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKYDQLDK 65
           +ESKR S+QL++LSTQL+ES++KQ++LE++L+++++TI  Q  +   Y  L+ + ++  +
Sbjct: 5   EESKRVSMQLSSLSTQLIESVDKQSRLEEQLRKAKKTIASQSESAASYESLREQLEKAQQ 64

Query: 66  NFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADARRGAQ 125
                  + A+LE +   E   R  A+ K+D+LNKEVE+LTASLFDEANNMVADARR   
Sbjct: 65  ELASRSRESAELERKLAAETTARKMAQDKIDQLNKEVEDLTASLFDEANNMVADARREKH 124

Query: 126 EIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNXXXXXXXXXX 185
           +++++N KL E LHEKD +LET+ +QLKNLK VL+ L+++ +++A + RN          
Sbjct: 125 DVEVRNSKLHEQLHEKDALLETLEMQLKNLKKVLYSLEDENSSLAKTKRNSAFLSSDTAT 184

Query: 186 XXXXXXXXXXXNSTTNIDLLSNA---IYTPKVPAVRYDLYLYNEFLKFIAVLPFCESIKH 242
                        T+ +  LS A   +++P + ++RYDL LYNEFLKF+A+LP C SIK 
Sbjct: 185 SSNVSLEKTATGGTS-LGELSGAGGVLFSPVLQSLRYDLGLYNEFLKFVAMLPICRSIKG 243

Query: 243 TTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNENYRFX 302
           TT+ESKLLRRL++DEIQPVLRLDNASGLGW+V+R+LM+LMI+GLVV+EPLSGVNE YR  
Sbjct: 244 TTTESKLLRRLMHDEIQPVLRLDNASGLGWLVRRSLMSLMIDGLVVVEPLSGVNETYRMG 303

Query: 303 XXXXXXXXXXXXDPKLTSKND---------HLFKYPSNSPPIAVHEPCAFCGENRNDVLE 353
                        P+L ++ +         HL+ YP++SPP+A+HE CAFC E+RND+LE
Sbjct: 304 YSS----------PQLHAQQNAHFGQERAAHLYNYPTDSPPVAIHEACAFCSESRNDILE 353

Query: 354 HARMYMLKTQTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLS 413
           H R+Y+LKT  +NED T   TNQ+PLC  CL+KVRQTCEIFAFLRSLK G W+LEKVTL+
Sbjct: 354 HGRLYVLKTLQRNEDGTTETTNQYPLCHYCLLKVRQTCEIFAFLRSLKEGVWHLEKVTLT 413

Query: 414 TIAKGDSKKXXXXXXXXXXXXXXXXXXXXXXXLMKRRSIMAGFGIXXXXXXXXXXXXXXV 473
           +IA G S K                         KR S MAG                  
Sbjct: 414 SIATGGSSKFSEVTKTPHTSAAKEDAKS------KRMSFMAGLS-RPSTTKLMPTVEGAP 466

Query: 474 GVVDQSGLPTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRPELSESNQNGTELE 533
               QSG P TNIQRAW  L KLR+ LHWAHIG+W+ +++V  ++ P + E     TE  
Sbjct: 467 NFAGQSGQPVTNIQRAWAQLCKLRASLHWAHIGVWSIEDSVALRIGPLMPEEK---TE-- 521

Query: 534 DQQILANINNTSEESFTSVRESVEPSDNEDDEPFDFETNE 573
                  +  +S  S    RE   P ++ DDE F  + +E
Sbjct: 522 ------QVEGSSASSMG--REEWVPMESPDDESFALQKDE 553

>Smik_14.65 Chr14 complement(105762..108134) [2373 bp, 790 aa] {ON}
           YNL272C (REAL)
          Length = 790

 Score =  516 bits (1328), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 258/573 (45%), Positives = 364/573 (63%), Gaps = 14/573 (2%)

Query: 3   DSSDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKYDQ 62
           D+S+E+KR S+Q+T+LSTQL+ES++KQ+ LE++L +S +TI  Q+ AI  YN LK  Y+ 
Sbjct: 2   DASEEAKRISLQVTSLSTQLIESVDKQSHLEEQLNKSLKTISSQKEAIVNYNRLKTDYEA 61

Query: 63  LDKNFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADARR 122
           L +       ++ KL  +  +E++LR  AE + D+LNKEVE+LTASLFDEANNMV+DAR+
Sbjct: 62  LKRTVLEKDDEVNKLREDVVKENELRTKAEDENDKLNKEVEDLTASLFDEANNMVSDARK 121

Query: 123 GAQEIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNXXXXXXX 182
               I+I N++L E L EKDT+L+T++LQLKNLK V+H L N+      SNR        
Sbjct: 122 EKYAIEILNKRLTEQLREKDTLLDTLSLQLKNLKKVMHSLDNESVVTNSSNRYSTILNDS 181

Query: 183 XXXXXXXXXXXXXXNSTTNIDLLSNAIYTPKVPAVRYDLYLYNEFLKFIAVLPFCESIKH 242
                         NS+ + D+ S  +Y+P + ++RYD+ LYNEFLKF+A LP C++IK 
Sbjct: 182 ATSSSTSLNKVPTLNSSASQDMYSGIVYSPSISSIRYDVSLYNEFLKFVAALPNCDNIKA 241

Query: 243 TTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNENYRFX 302
           T+SESKL+RRL+NDEIQP+L++DNASG+GW+VK+TL++L+I+GLVV+EPLSGVN  Y+  
Sbjct: 242 TSSESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVMEPLSGVNATYQIG 301

Query: 303 XXXXXXXXXXXXDPKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARMYMLKT 362
                         + T     +FK+P +SPP+AVH  C+FCGE+R+D++EHARMY+LKT
Sbjct: 302 YNSSSPVK------QATPNMPRMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYILKT 355

Query: 363 QTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTIAKGDSKK 422
             K +D T  +TN +PLC  CL+K+RQTCEIFAFLRSLK+GAW+LEK+   +I KGD  K
Sbjct: 356 LHKADDGTEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLEAQSITKGDLGK 415

Query: 423 XXXXXXXXXXXXXXXXXXXXXXXLMKRRSIMAGFGIXXXXXXXXXXXXXXVGVVDQSGLP 482
                                    KR S MAG GI                   + G P
Sbjct: 416 FSEVTKRTKTDGRVSSQDKK----AKRLSFMAGLGINSSSKSKQKMEVFSSEANAKPGQP 471

Query: 483 TTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRPELSESNQNGTELEDQQILANIN 542
           TTNIQRAW+ L KLR +LHW+HIGIW  D+++++K+ P + +  ++  E  D  I   + 
Sbjct: 472 TTNIQRAWLQLCKLRCILHWSHIGIWAVDDSISSKIGPFVGD--EDSDENRDDSISVRLQ 529

Query: 543 NTS--EESFTSVRESVEPSDNEDDEPFDFETNE 573
           + +  ++S      S  P +    + FDFE+ E
Sbjct: 530 DKALWKKSTGKCSSSSSPGEGPKSDTFDFESEE 562

>NCAS0A00580 Chr1 complement(99945..102014) [2070 bp, 689 aa] {ON}
           Anc_1.81 YNL272C
          Length = 689

 Score =  511 bits (1317), Expect = e-171,   Method: Compositional matrix adjust.
 Identities = 275/591 (46%), Positives = 381/591 (64%), Gaps = 41/591 (6%)

Query: 1   MEDSSDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKY 60
           M + S+ESKR S Q+T LSTQL+ESI+KQ++LE+KL  + + I  QQ ++++Y++LKV++
Sbjct: 1   MSEQSEESKRISQQVTALSTQLIESIDKQSKLEEKLNHANKIIASQQPSLDKYSNLKVEF 60

Query: 61  DQL-------DKNFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEA 113
           ++L        K  +  KVKI       + E +LR +AEQ+V++L+KEVE+LTA+LFDEA
Sbjct: 61  EKLKISSEDQQKELDNFKVKI-------RRERELRENAEQEVEKLSKEVEDLTATLFDEA 113

Query: 114 NNMVADARRGAQEIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSN 173
           NNMVADAR+    +++ N KLVE LHEKD +LET+NLQLKNLK VL  ++++  ++  +N
Sbjct: 114 NNMVADARKDKYTVEVLNTKLVEQLHEKDNLLETLNLQLKNLKKVLQTVEDENNSLIGNN 173

Query: 174 R----NXXXXXXXXXXXXXXXXXXXXXNSTTNIDLLSNA-IYTPKVPAVRYDLYLYNEFL 228
           R                          + + NI  ++N  IY+P + ++RYDL LY EFL
Sbjct: 174 RYSIIQPDSATTSSSTTSLEKITTTVSSYSQNISNMANGIIYSPIISSIRYDLPLYEEFL 233

Query: 229 KFIAVLPFCESIKHTTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVV 288
           KFIAV+P C +IK T+S+SKL+RRL+NDEI PVL+LDNASGLGWIV++T+++ M+EGLVV
Sbjct: 234 KFIAVIPHCRTIKDTSSDSKLIRRLVNDEINPVLKLDNASGLGWIVRKTILSTMMEGLVV 293

Query: 289 IEPLSGVNENYRFXXXXXXXXXXXXXDPKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENR 348
           +EPLSGVNE ++                +  S    LFK+P  SPPIA+HEPC+FCGE+R
Sbjct: 294 VEPLSGVNETFQMGNSTQPPNAEASNKNESQSSMPKLFKFPLTSPPIALHEPCSFCGESR 353

Query: 349 NDVLEHARMYMLKTQTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLE 408
           +D++EHARMY+LKTQ K ED T+ +TN FPLC  CL KVRQTCEIFAFLRSLK G WNLE
Sbjct: 354 DDIIEHARMYVLKTQNKQEDGTIMVTNTFPLCHWCLFKVRQTCEIFAFLRSLKTGVWNLE 413

Query: 409 KVTLSTIAKGDSKKXXXXXXXXXXXXXXXXXXXXXXXLMKRRSIMAGF--GIXXXXXXXX 466
           KVT+ +I+  DS +                          RRS    F  G+        
Sbjct: 414 KVTMKSISSKDSSRFSVVTSAIRQTKTED-----------RRSKRMSFIGGLTKNSSAIN 462

Query: 467 XXXXXXVGVVDQSGLPTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRPELSESN 526
                    ++ +GLPTTNIQRAW+ L KLRS+LHWAH+GIW+ D+++T+K+ PE+ + +
Sbjct: 463 TAQVESTTSMEITGLPTTNIQRAWIQLCKLRSILHWAHVGIWSIDDSITSKIGPEIKDPD 522

Query: 527 QNGTELEDQQILANINNTSEESFTSVRESVEP--SDNEDDEPFDFETNEST 575
               +LE   I ANI  T ++    + + VE   S+N   E FDFE++ ST
Sbjct: 523 D---KLEPASIEANIKITKKQ----IEKDVESIISENNQGESFDFESSAST 566

>KAFR0D03960 Chr4 (776847..778841) [1995 bp, 664 aa] {ON} Anc_1.81
           YNL272C
          Length = 664

 Score =  504 bits (1298), Expect = e-168,   Method: Compositional matrix adjust.
 Identities = 266/577 (46%), Positives = 375/577 (64%), Gaps = 26/577 (4%)

Query: 1   MEDSSDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKY 60
           M+D ++E+ R S Q+T+LSTQLMESI ++++LE+KL+  ++  + Q+ +I +Y+ LK  Y
Sbjct: 1   MDDLAEENNRISAQVTSLSTQLMESIQRESELEEKLKHLKKVALSQEGSIAKYDILKADY 60

Query: 61  DQLDKNFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADA 120
           D+L    +    +I  L+   KEE KLR SAE +V  L++EVE+LTASLF EAN+MVADA
Sbjct: 61  DKLKTTVSERNREIQNLQVNLKEESKLRSSAEAEVATLSQEVEDLTASLFAEANDMVADA 120

Query: 121 RRGAQEIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNXXXXX 180
           RR     +I N KLVE L EKDT+L+T++LQLKNLK VL + +++         N     
Sbjct: 121 RREKHITEILNTKLVEQLREKDTLLQTLDLQLKNLKKVLQNFEDE---------NVTNKA 171

Query: 181 XXXXXXXXXXXXXXXXNSTTN--IDLLSNAIYTPKVPAVRYDLYLYNEFLKFIAVLPFCE 238
                            S +N   D  +  +Y+P +  +RYDL LYNEFLKFIAVLP+C+
Sbjct: 172 SSIAPDFLGSEQKSASASLSNEVGDPSNKGVYSPYISTIRYDLALYNEFLKFIAVLPYCK 231

Query: 239 SIKHTTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNEN 298
           ++K T+SESKL+RRLINDEIQP+LR+D+A+G+GW+ K++++ LMI+GLVVIEPLSGVNEN
Sbjct: 232 NLKDTSSESKLMRRLINDEIQPILRIDSANGIGWLAKKSMLTLMIDGLVVIEPLSGVNEN 291

Query: 299 YRFXXXXXXXXXXXXXDPKLTSKND-HLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARM 357
           Y+               P + SK + HLF YP++SPP+AVHEPC+FCGENR+D+LEHARM
Sbjct: 292 YQLGHVSSSDQSNR---PSMESKRESHLFNYPTDSPPVAVHEPCSFCGENRDDILEHARM 348

Query: 358 YMLKTQTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTIAK 417
           ++LKTQ+K+ED ++++TN +PLC  CL KVRQTCEIFAFLRSLK+G WNLEKVTL++IAK
Sbjct: 349 HVLKTQSKSEDGSITVTNSYPLCSWCLTKVRQTCEIFAFLRSLKIGTWNLEKVTLNSIAK 408

Query: 418 GDSKKXXXXXXXXXXXXXXXXXXXXXXXLMKRRSIMAGFGIXXXXXXXXXXXXXXVGVVD 477
           G+S K                        +KR+S M G GI                 + 
Sbjct: 409 GESNKFTEVTRAIKSNKHGKSDEKK----LKRKSFMVGLGI-NASSNLTPQVEVGASTIG 463

Query: 478 QSGLPTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRPELSESNQ--NGTELEDQ 535
            +G PTTNIQRAWV L KLRSMLHW ++GIW+ D +++ K+ P++ + N    GT ++  
Sbjct: 464 NAGQPTTNIQRAWVQLCKLRSMLHWTYMGIWSVDESISLKIGPQVKDDNNEITGTTVDVA 523

Query: 536 QILA----NINNTSEESFTSVRESVEPSDNEDDEPFD 568
            +L     N++N+ +++ ++   +     + D   FD
Sbjct: 524 SVLTGNTENVSNSIKDTVSAPERNAYNQASIDSPQFD 560

>YNL272C Chr14 complement(126805..129084) [2280 bp, 759 aa] {ON}
           SEC2Guanyl-nucleotide exchange factor for the small
           G-protein Sec4p; essential for post-Golgi vesicle
           transport and for autophagy; associates with the
           exocyst, via exocyst subunit Sec15p, on secretory
           vesicles
          Length = 759

 Score =  493 bits (1270), Expect = e-163,   Method: Compositional matrix adjust.
 Identities = 263/577 (45%), Positives = 366/577 (63%), Gaps = 23/577 (3%)

Query: 3   DSSDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKYDQ 62
           D+S+E+KR SIQ+T+LSTQL+ES++KQ+ LE++L +S +TI  Q+ AIE YN LK  Y+ 
Sbjct: 2   DASEEAKRVSIQVTSLSTQLIESVDKQSHLEEQLNKSLKTIASQKAAIENYNQLKEDYNT 61

Query: 63  LDKNFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADARR 122
           L +  +    ++ +L  +  +E++LR  AE++ D+LNKEVE+LTASLFDEANNMVADAR+
Sbjct: 62  LKRELSDRDDEVKRLREDIAKENELRTKAEEEADKLNKEVEDLTASLFDEANNMVADARK 121

Query: 123 GAQEIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNXXXXXXX 182
               I+I N++L E L EKDT+L+T+ LQLKNLK V+H L N+      SNR        
Sbjct: 122 EKYAIEILNKRLTEQLREKDTLLDTLTLQLKNLKKVMHSLDNESTVTNNSNRYSTILSDS 181

Query: 183 XXXXXXXXXXXXXXNSTTNIDLLSNAIYTPKVPAVRYDLYLYNEFLKFIAVLPFCESIKH 242
                          S  + D+ S  +Y+P + ++RYD+ LYNEFLKF+A LP CE+IK 
Sbjct: 182 ATSSSTSLNKVPTSYSLASQDIYSGIVYSPSISSIRYDISLYNEFLKFVAALPRCENIKA 241

Query: 243 TTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNENYRFX 302
           T++ESKL+RRL+NDEIQP+L++DNASG+GW+VK+TL++L+I+GLVV+EPLSGVN  Y+  
Sbjct: 242 TSTESKLIRRLVNDEIQPILKIDNASGIGWLVKKTLLSLIIDGLVVVEPLSGVNATYQIG 301

Query: 303 XXXXXXXXXXXXDPKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARMYMLKT 362
                         + TS    +FK+P +SPP+AVH  C+FCGE+R+D++EHARMY+LKT
Sbjct: 302 YNSSSPAK------QATSNMPKMFKFPLDSPPVAVHAACSFCGESRDDIIEHARMYILKT 355

Query: 363 QTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTIAKGDSKK 422
             K +D    +TN +PLC  CL+K+RQTCEIFAFLRSLK+GAW+LEK+T   I K D +K
Sbjct: 356 LHKTDDGKEQVTNTYPLCHWCLLKLRQTCEIFAFLRSLKVGAWHLEKLTTQNITKEDLEK 415

Query: 423 XXXXXXXXXXXXXXXXXXXXXXXLMKRRSIMAGFGIXXXXXXXXXXXXXXVGVVDQSGLP 482
                                    KR S MAG GI                   + G P
Sbjct: 416 FSEVTKHTKRDGRVSSQDKK----TKRLSFMAGLGINSSTKNKPKMEIFSSETNAKPGQP 471

Query: 483 TTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRPEL---SESNQN---GTELEDQQ 536
           TTNIQRAW+ L KLR +LHW HIGIW  D+++++K+ P +   S+ +QN      L+D+ 
Sbjct: 472 TTNIQRAWLQLCKLRCILHWTHIGIWAVDDSISSKIGPLVEDDSDEDQNDAISVRLQDKA 531

Query: 537 ILANINNTSEESFTSVRESVEPSDNEDDEPFDFETNE 573
           +       ++  F+S   S E S   D   FDFE+ +
Sbjct: 532 LW---KQDAKRPFSS--SSAEESQKSD--AFDFESGD 561

>TBLA0A05430 Chr1 complement(1334141..1336528) [2388 bp, 795 aa]
           {ON} Anc_1.81 YNL272C
          Length = 795

 Score =  490 bits (1261), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 273/617 (44%), Positives = 365/617 (59%), Gaps = 60/617 (9%)

Query: 5   SDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKYDQLD 64
           +DES+R + Q+T LSTQLMESI+KQ+QLEDKL ++ + +  Q+  IE+ + +K     L 
Sbjct: 7   ADESQRVTDQVTLLSTQLMESISKQSQLEDKLNQANKKLAAQKLTIEKNSQIKATGSALQ 66

Query: 65  KNFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADARRGA 124
           KN N  + ++     E  +E +LR  AE +   LNKEVE+LTASLFDEAN+MVADAR+  
Sbjct: 67  KNANDLESQLKIANAELVKERQLREKAEGECTALNKEVEDLTASLFDEANHMVADARKEK 126

Query: 125 QEIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNXXXXXXXXX 184
             ++++N KL+E L EKDT+LET+ LQLKNLK VL + Q++ +N   + RN         
Sbjct: 127 AAVELRNTKLMEQLKEKDTVLETLELQLKNLKKVLQEFQDEDSN---NKRNSMLSEVTIH 183

Query: 185 XXXXXXXXXXXXNSTTNIDLLSNAIYTPKVPAVRYDLYLYNEFLKFIAVLPFCESIKHTT 244
                        STTN +  +N IY+P +  +RYDL LY EFLKF+AVLPF ++IK TT
Sbjct: 184 SGSSQRAGSPTIISTTNSESFANIIYSPNISDIRYDLPLYGEFLKFVAVLPFVKNIKQTT 243

Query: 245 SESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNENY----- 299
           ++SKLLRRL+NDEIQPVLRLDNA GLGW+VKRTL+  M+EGLV++EPLSGVNE Y     
Sbjct: 244 NDSKLLRRLVNDEIQPVLRLDNADGLGWVVKRTLLTQMMEGLVMVEPLSGVNELYTHSRN 303

Query: 300 -RFXXXXXXXXXXXXXDPKLTS-----KNDHLFKYPSNSPPIAVHEPCAFCGENRNDVLE 353
            R                K T+     KN HLF +P+NSPP+AVHEPCAFC E R+D ++
Sbjct: 304 RRSATSNNTTGSTRDISGKDTNGSSNQKNSHLFNFPTNSPPVAVHEPCAFCNEKRDDSVQ 363

Query: 354 HARMYMLKTQTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLS 413
           HAR+++LKTQ+++E   +++TNQFPLCQ C++KVRQT EIFAFLRSL LG W LEK+ ++
Sbjct: 364 HARIHLLKTQSRSETGKITVTNQFPLCQSCVLKVRQTGEIFAFLRSLALGTWKLEKIAIA 423

Query: 414 TIAKGDSKKXXXXXXXXXXXXXXXXXXXXXXXLMKRRSIMAGFGIXXXXXXX---XXXXX 470
            ++K D  K                        +K  ++     +               
Sbjct: 424 NLSKSDPTKIKGSPASPTKDKEKEKKKAKRKSFIKGLNMAQTASVLNPATSNPFFQQTQT 483

Query: 471 XXVG-----VVDQSGLPTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRP-ELSE 524
             VG      VD  G PTTNIQRAW+ L KLR MLHW+H+GIW+ D+++  K  P  +SE
Sbjct: 484 NPVGDTSLTDVDTFGQPTTNIQRAWLQLCKLRCMLHWSHMGIWSLDDSIEAKFAPLSISE 543

Query: 525 SN-----QNGTEL-----------------------EDQQILAN-INNTSEESFTSVRES 555
           SN     QN                            D QIL N I+ T +ESF+  +E+
Sbjct: 544 SNIKDLDQNTDNFTSSQLPSTSPSNNNINSTNTLMHRDTQILKNHIDTTDQESFSLKQET 603

Query: 556 VEPSDNEDDEPFDFETN 572
                   D+ FDFE N
Sbjct: 604 --------DDAFDFENN 612

>NDAI0F04230 Chr6 (1031871..1033976) [2106 bp, 701 aa] {ON} Anc_1.81
           YNL272C
          Length = 701

 Score =  486 bits (1252), Expect = e-161,   Method: Compositional matrix adjust.
 Identities = 251/534 (47%), Positives = 339/534 (63%), Gaps = 18/534 (3%)

Query: 1   MEDSSDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKY 60
           M ++S+ESKR SIQ+++LSTQL+ESI KQ+ LE+KL ++ RTI  Q+ ++EQ + L+ K 
Sbjct: 1   MPETSEESKRISIQVSSLSTQLIESIGKQSDLEEKLNQANRTITSQKKSLEQSHMLEKKS 60

Query: 61  DQLDKNFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADA 120
            +L+++      ++ KL      E KLR SAE +V++L+KEVE+LTA+LFDEANNMVADA
Sbjct: 61  IELEQSLTARTEEVNKLRERLTREIKLRESAEIEVEKLSKEVEDLTATLFDEANNMVADA 120

Query: 121 RRGAQEIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNXXXXX 180
           R+ A   +I N +L+  L EKD +LET+ LQLK+LK VL +++ +      +NR      
Sbjct: 121 RKEAHAKEILNSRLMGQLREKDNLLETLTLQLKSLKKVLQNVETE------NNRYSMILP 174

Query: 181 XXXXXXXXXXXXXXXXNST--TNIDLLSNAIYTPKVPAVRYDLYLYNEFLKFIAVLPFCE 238
                            S+  +   + +  IY+P + ++RYDL LY EFLKFIAV+P C+
Sbjct: 175 DSATISGASLDKVTTRTSSSFSQQPMNNGIIYSPNISSIRYDLSLYEEFLKFIAVIPHCK 234

Query: 239 SIKHTTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNEN 298
           SIK T+S+SKL+RRLI DEI PVL++DNA+GLGW+VK+TL++ M+EGLV++EPLSG+NE 
Sbjct: 235 SIKDTSSDSKLIRRLITDEISPVLKIDNANGLGWLVKKTLLSTMMEGLVIVEPLSGINEM 294

Query: 299 YRFXXXXXXXXXXXXXDPKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARMY 358
           Y+              +     K   +FK+PS+SPP+AV +PCAFCGE RND++EHARMY
Sbjct: 295 YQMGHTTPPLGMNTQEEADAQRKVPKMFKFPSSSPPVAVRDPCAFCGEERNDIIEHARMY 354

Query: 359 MLKTQTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTIAKG 418
           +LKTQT  +D TL I N +PLC  CL K+RQTCEIFAFLRSLK   WNLEKV LS I+K 
Sbjct: 355 LLKTQTTQDDGTLIIANTYPLCHWCLFKIRQTCEIFAFLRSLKTDIWNLEKVPLSAISKY 414

Query: 419 DSKKXXXXXXXXXXXXXX--XXXXXXXXXLMKRRSIMAGFGIXXXXXXXXXX-------- 468
            S K                           KR S MAG G                   
Sbjct: 415 GSSKFSEVTTTNTNGSKKNIAATPKSENKKSKRMSFMAGLGRTHSSKITAARVEPHGNHN 474

Query: 469 XXXXVGVVDQSGLPTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRPEL 522
                  ++  G PTTNIQRAW+ L KLRS+LHWAHIGIW+ D++V+TK+ PE+
Sbjct: 475 NNNTNSPIENIGQPTTNIQRAWLQLCKLRSILHWAHIGIWSVDDSVSTKVGPEV 528

>KLTH0F02354g Chr6 complement(193705..195906) [2202 bp, 733 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 733

 Score =  483 bits (1243), Expect = e-159,   Method: Compositional matrix adjust.
 Identities = 252/574 (43%), Positives = 344/574 (59%), Gaps = 7/574 (1%)

Query: 6   DESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKYDQLDK 65
           +ESKR S+Q+++LSTQL+ESI+KQ+ LE++L ++R+ I  Q+ +++ Y DL+ + +Q + 
Sbjct: 5   EESKRVSVQVSSLSTQLIESIDKQSHLEEQLLQARKVIASQRESLQNYEDLRQQLEQAES 64

Query: 66  NFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADARRGAQ 125
           N    + +  K++ E +     +L+AE ++D LNKEVE+LTASLFDEANNMVADARR   
Sbjct: 65  NLKSERSQNIKIQEELQAARSGKLTAEGEIDRLNKEVEDLTASLFDEANNMVADARRETH 124

Query: 126 EIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNXXXXXXXXXX 185
            + +KN KL E L EK+T+LET+ +QLKNLK VL++L+ +  +   SN+           
Sbjct: 125 SVQVKNSKLAEQLQEKETLLETLEIQLKNLKKVLYNLEEESNDRLKSNQASVAAEDSVAS 184

Query: 186 XXXXXXXXXXXNSTTNIDLLSNAIYTPKVPAVRYDLYLYNEFLKFIAVLPFCESIKHTTS 245
                               S A+++P + ++RYDL LYNEFLKFIA LP C SI+ +TS
Sbjct: 185 SSESALEKTMNALNGTASPPSPALFSPLLKSLRYDLVLYNEFLKFIAALPQCASIRDSTS 244

Query: 246 ESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNENYRFXXXX 305
            SKLLRRLI+DEIQPVLRLDNASG+GW ++R LM+LMI+G +V+EP+SG+NE YR     
Sbjct: 245 YSKLLRRLIHDEIQPVLRLDNASGIGWYLRRNLMSLMIDGSIVVEPVSGINETYRVGHMS 304

Query: 306 XXXXXXXXXDPKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARMYMLKTQTK 365
                             HL+ YP++SPP+A+  PC+FC E+RND+LEH R+Y+LKT  K
Sbjct: 305 SQVEAVPQFQGPEQQSRPHLYNYPADSPPVAIESPCSFCSESRNDILEHGRLYVLKTLQK 364

Query: 366 NEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTIAKGDSKKXXX 425
            E+     ++QFPLC  CL+KVRQTCEIFAFLRSLK GAW+LE VT+S      S +   
Sbjct: 365 MENGITETSSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLEAVTISKTNNAFSVQTNS 424

Query: 426 XXXXXXXXXXXXXXXXXXXXLMKRRSIMAGFGIXXXXXXXXXXXXXXVGVVDQSGLPTTN 485
                                 KR S MAG                     +Q   PTTN
Sbjct: 425 VSNSPTLESPPDKMKPDRKS--KRMSFMAGLS-KTLPLKTSYTVESASPCPEQITTPTTN 481

Query: 486 IQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRPELSESNQNGTELEDQQILANINNTS 545
           IQRAW  L KLRS LHWAHIGIW  ++ V TK+ P ++        +    ++  +   +
Sbjct: 482 IQRAWAQLCKLRSSLHWAHIGIWTLEDVVETKVGPVVAVDRPGNDSIVGDGLVPELGQEA 541

Query: 546 EESFTSVRESVEPSDNEDDEPFDFETNESTIQDA 579
            ESF+   E  E  DNE  E FDFE   ST++ A
Sbjct: 542 RESFSLHNE--EEVDNE--EGFDFEKMNSTLESA 571

>KLLA0C02299g Chr3 complement(194267..196243) [1977 bp, 658 aa] {ON}
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 658

 Score =  470 bits (1209), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 255/568 (44%), Positives = 342/568 (60%), Gaps = 42/568 (7%)

Query: 6   DESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKYDQLDK 65
           +ESKR S+Q+T+LSTQL+ESI+KQ+QLE++L  +++TI  QQ     YN+LK +   L  
Sbjct: 5   EESKRISLQVTSLSTQLIESIDKQSQLEEQLLVAKKTISTQQNIANSYNELKQELQSLKL 64

Query: 66  NFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADARRGAQ 125
            +   K K        K++ ++   AE+KV  LN+E+E+LTASLFDEANNMVADAR+   
Sbjct: 65  QYETDKTKF-------KKQEEICADAEKKVATLNQEIEDLTASLFDEANNMVADARKEQN 117

Query: 126 EIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNXXXXXXXXXX 185
            ++I N KL E L EKD +L+T+++QLKNLKNVL+  +ND      S++N          
Sbjct: 118 AVEILNSKLKEQLKEKDLLLDTLSMQLKNLKNVLYKFEND----FNSSKNVSLSDSATSS 173

Query: 186 XXXXXXXXXXXNSTTNIDL-LSNAIYTPKVPAVRYDLYLYNEFLKFIAVLPFCESIKHTT 244
                       S  +  L     +++P + ++RYD+ LY E+LKF+AVLP CE+++ TT
Sbjct: 174 TTSIDRSTTNLTSVNDNSLSFQGVLFSPLLHSLRYDVPLYTEYLKFLAVLPQCENLQQTT 233

Query: 245 SESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNENYRFXXX 304
           SESKLLRRLIN EI PVLRLDNASG+GW+VKR LMNLM+EGLV IEP+SG+NE YR    
Sbjct: 234 SESKLLRRLINYEISPVLRLDNASGVGWLVKRNLMNLMMEGLVSIEPISGINETYR---- 289

Query: 305 XXXXXXXXXXDPKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARMYMLKTQT 364
                      P++ +K+ HLF  P NSPP+A+ EPCAFCGENRND+LEH R+Y+ KT  
Sbjct: 290 TGYSSPSIPDSPEVENKDSHLFSRPVNSPPVAMVEPCAFCGENRNDILEHGRLYIFKTYQ 349

Query: 365 KNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTIAKGDSKKXX 424
           K E+    +TNQFP+C  CL+K+RQ CEIFAFLRSL+ GAW+LEKV L++I +G      
Sbjct: 350 KLENGKNELTNQFPVCHYCLLKLRQVCEIFAFLRSLRSGAWHLEKVALASIHQGKVNAYS 409

Query: 425 XXXXXXXXXXXXXXXXXXXXXLMKRRSIMAGFGIXXXXXXXXXXXXXXVGVVDQSGLPTT 484
                                  KR SI  G                     D++GLPTT
Sbjct: 410 EVTKASRPKMKS-----------KRLSIFQGL---KQSQSSTPIIENGPQFADKNGLPTT 455

Query: 485 NIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRPELSESNQNGTELEDQQILANINNT 544
           NIQR+W  LS+LR+ L W+HIG+W+ D +V T + P    S     E E+Q +    NN 
Sbjct: 456 NIQRSWARLSQLRASLQWSHIGVWSLDESVATDIAPSTDISKAKSFE-EEQGLGIASNNI 514

Query: 545 SEESFTSVRESVEPSDNEDDEPFDFETN 572
                        P  +E+DE FDFE +
Sbjct: 515 P-----------VPITHEEDETFDFEAD 531

>ZYRO0F16698g Chr6 (1382642..1384981) [2340 bp, 779 aa] {ON} weakly
           similar to uniprot|P17065 Saccharomyces cerevisiae
           YNL272C SEC2 Guanyl-nucleotide exchange factor for the
           small G-protein Sec4p located on cytoplasmic vesicles
           essential for post-Golgi vesicle transport
          Length = 779

 Score =  473 bits (1218), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 240/542 (44%), Positives = 335/542 (61%), Gaps = 33/542 (6%)

Query: 6   DESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKYDQLDK 65
           +ES+R S Q+ +LSTQL+ESI +Q+ LE +L ++ + I     A+++Y  LK  + +L+K
Sbjct: 8   EESRRVSTQIMSLSTQLIESIERQSTLEKELNQANKIIEGHGGAMQEYEKLKKNFAELEK 67

Query: 66  NFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADARRGAQ 125
             +    ++ KL  E +++ + R  A+   D+LN EVEELTASLFDEANNMVADAR+ + 
Sbjct: 68  RESNKDAQLNKLREELRKQKEARTEADSNADKLNHEVEELTASLFDEANNMVADARKASH 127

Query: 126 EIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNXXXXXXXXXX 185
             +++N KLVE LHE+D +LET+NLQL++LK V+  L +D  ++A               
Sbjct: 128 ATELRNAKLVEQLHERDALLETLNLQLRHLKKVIQTLDDD--SMASEQVKTLANASDNAN 185

Query: 186 XXXXXXXXXXXNSTTNIDLLSNAIYTPKVPAVRYDLYLYNEFLKFIAVLPFCESIKHTTS 245
                      +    I+     I++P + AVRYDL LY+EFLKF+AVLP  + IK T S
Sbjct: 186 LAASLSKNLSSSHGRQIEAPLGPIFSPNITAVRYDLGLYHEFLKFLAVLPDYQDIKDTAS 245

Query: 246 ESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNENYRFXXXX 305
           +SKLLRRL+NDEIQPVL+L+NASGLGWI+KRTL+NLMIEGLV +EP+SG+NE +++    
Sbjct: 246 DSKLLRRLVNDEIQPVLKLENASGLGWILKRTLVNLMIEGLVAVEPISGLNEMHQYGYAS 305

Query: 306 XXXXXXXXXDP----------------KLTSKNDH-----------LFKYPSNSPPIAVH 338
                                        T+K +H           LF YPS+SPP+A+ 
Sbjct: 306 PMLNQHSKMGGNNSNSLENSPATTSNTSTTTKRNHSRSSSMTKSLNLFNYPSDSPPVALR 365

Query: 339 EPCAFCGENRNDVLEHARMYMLKTQTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLR 398
           E CA CGE R+D++EHAR+++LKTQ++ +D T+++ N FPLC+ C++K+RQTCEIFAFLR
Sbjct: 366 EKCAICGECRDDLVEHARLHILKTQSRADDGTVTVNNTFPLCKYCVLKIRQTCEIFAFLR 425

Query: 399 SLKLGAWNLEKVTLSTIAKGDSKKXXXXXXXXXXXXXXXXXXXXXXXLMKRRSIMAGFGI 458
           SLKLGAW LEKV+L++++KGDSK+                          R+S MAG   
Sbjct: 426 SLKLGAWKLEKVSLTSVSKGDSKEFSQVSMVNSNEDKPNRDSKKENRKTARKSFMAGMNA 485

Query: 459 XXXXXXXXXXXXXXVGVVDQSGLPTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKL 518
                            V Q+G PTTNIQ AW+ L +LRSMLHW HIGIWN D+ +T+K+
Sbjct: 486 LNSKNTTVTPEVP----VSQAGAPTTNIQWAWIQLCRLRSMLHWTHIGIWNVDDCITSKI 541

Query: 519 RP 520
            P
Sbjct: 542 GP 543

>CAGL0J08228g Chr10 (815653..817911) [2259 bp, 752 aa] {ON} similar
           to uniprot|P17065 Saccharomyces cerevisiae YNL272c SEC2
           protein transport protein
          Length = 752

 Score =  466 bits (1200), Expect = e-153,   Method: Compositional matrix adjust.
 Identities = 242/527 (45%), Positives = 336/527 (63%), Gaps = 28/527 (5%)

Query: 1   MEDSSDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKY 60
           M D  +ES R S+Q++TLSTQL+ESI++Q++LE +L+ ++  I +Q+  + ++  LK K 
Sbjct: 1   MSDPIEESNRISVQVSTLSTQLIESIDRQSELEKRLRDAQIIINKQKHVMHEFETLKQKN 60

Query: 61  DQLDKNFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADA 120
            +L       + KI  L  + +EE   RL+AE++VD+L +EVE+LTASLFDEANNMV+DA
Sbjct: 61  KELSDGQQSFEEKIRALSAQLEEEKSKRLAAEKEVDKLGQEVEDLTASLFDEANNMVSDA 120

Query: 121 RRGAQEIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDP---ANI--AVSNRN 175
           RR   +I+I+N +L E L EKDT+LET+NLQLKNLK VL  + ++    ANI   +S  N
Sbjct: 121 RREKHDIEIQNSRLQETLKEKDTVLETLNLQLKNLKKVLQTVDSESSINANIRSPISTEN 180

Query: 176 XXXXXXXXXXXXXXXXXXXXXNSTTNIDLLSNAIYTPKVPAVRYDLYLYNEFLKFIAVLP 235
                                 S  +I    + +++P V  +RYD  LYNEFLKF+AVLP
Sbjct: 181 -------STTTSASGNKLTRRQSQLSISHNESPLFSPYVTTLRYDQSLYNEFLKFLAVLP 233

Query: 236 FCESIKHTTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGV 295
              S+K T++ESKLL+RL++DEIQPVL++DNASG+GW+V+++L+  M+EG VV+EPLSG+
Sbjct: 234 SSSSLKATSTESKLLKRLVSDEIQPVLKIDNASGIGWLVRKSLLTSMMEGQVVVEPLSGI 293

Query: 296 NENYRFXXXXXXXXXXXXXDPKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENRNDVLEHA 355
           NE Y+              +     +  H+F +P NSPPIAV +PCAFC E R+D++EHA
Sbjct: 294 NEAYQLGYETKEHVSQNEGE-----EMPHMFNFPLNSPPIAVRDPCAFCAEQRDDIIEHA 348

Query: 356 RMYMLKTQTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTI 415
           RMY++KT  K  D + +ITN FPLC  CL+KVRQTCEIFAFLRSLKLG W+LEKVTL+TI
Sbjct: 349 RMYVMKTFNKENDGSTTITNSFPLCHWCLMKVRQTCEIFAFLRSLKLGTWHLEKVTLNTI 408

Query: 416 AKGDSKKXXXXXXXXXXXXXXXXXXXXXXXLMKRRSIMAGFGIXXXXXXXXXXXXXXVGV 475
           +KG+S                            R+S +                      
Sbjct: 409 SKGESLSKFSEVTKSTNGSTSNEEKKS-----NRKSFIPSLPKGSPKKSSPVVETH---- 459

Query: 476 VD--QSGLPTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRP 520
           +D  ++G PT+NIQRAWVHL KLRSMLHWAH+GIWN +++++ K+ P
Sbjct: 460 IDTTKAGQPTSNIQRAWVHLCKLRSMLHWAHVGIWNMEDSISLKMGP 506

>Ecym_1085 Chr1 complement(170657..172774) [2118 bp, 705 aa] {ON}
           similar to Ashbya gossypii AFR670W
          Length = 705

 Score =  461 bits (1185), Expect = e-151,   Method: Compositional matrix adjust.
 Identities = 267/709 (37%), Positives = 392/709 (55%), Gaps = 48/709 (6%)

Query: 1   MEDSSDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKY 60
           M +  +ESKR SIQ+++LSTQL+ESI+KQ++LE+ L ++++ +  Q+ +I Q++ LK + 
Sbjct: 10  MTEQQEESKRISIQVSSLSTQLIESIDKQSRLEEHLNQAKKALSAQKDSISQFDSLKQQL 69

Query: 61  DQLDKNFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADA 120
               K    T+ ++A    E  E  ++R++AE+  ++LNKE+E+LT SLFDEAN+MVA+A
Sbjct: 70  SDTKKQLAYTEEELAVKRRELVEAQEVRVAAERAAEKLNKEIEDLTTSLFDEANSMVANA 129

Query: 121 RRGAQEIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNXXXXX 180
           R+   ++++ N KL E L EKD +L+T+++QL+NLK VL+ ++++   +    ++     
Sbjct: 130 RKEKHDVEVLNSKLQEQLREKDMLLDTLSIQLRNLKEVLYKVEDEHNTLNSYRQSIIMEG 189

Query: 181 XXXXXXXXXXXXXXXXNSTTNIDLLSNAIYTPKVPAVRYDLYLYNEFLKFIAVLPFCESI 240
                               +     N +++P   ++RYD+ LY E+L+F+AVLP C+ I
Sbjct: 190 SNGSNASLDKEALGNPGLIYDHHHHMNLLFSPLAQSLRYDIPLYTEYLRFLAVLPMCKGI 249

Query: 241 KHTTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNENYR 300
           K T  +SK LRRL+ DEIQPVLRLD ASGLGW+V+R LMNLMI+GLVV+EPLSG+NE YR
Sbjct: 250 KDTRHDSKFLRRLVLDEIQPVLRLDAASGLGWLVRRNLMNLMIDGLVVVEPLSGINETYR 309

Query: 301 FXXXXXXXXXXXXXDPKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARMYML 360
                         +      N  +F YPSNSPP+A+ +PCAFC E+RND+LEH R+Y+L
Sbjct: 310 IGYASPQSNSHKVTE----VDNAKMFNYPSNSPPVAIQDPCAFCSESRNDILEHGRLYVL 365

Query: 361 KTQTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTIAKGDS 420
           KT  KNED + +   Q+PLC  CL+KVRQTCEIFAFLRSLK GAWNLE VTLS    G  
Sbjct: 366 KTLQKNEDGSTTSETQYPLCHYCLLKVRQTCEIFAFLRSLKSGAWNLENVTLSCARPGSD 425

Query: 421 KKXXXXXXXXXXXXXXXXXXXXXXXLMKRRSIMAGFGIXXXXXXXXXXXXXXVGVVDQSG 480
           +                          KR S M+G                     ++ G
Sbjct: 426 EFTKVDRNSTTNSASNKEANSTSS---KRLSFMSGLSRTSSSTRMTPRIETVTDFSERKG 482

Query: 481 LPTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRPELSESNQNGTELEDQQILAN 540
           LP+TN+QR+WVHL KLR+ LHW HIG+W  ++++  K+ P +S   +  T      +  N
Sbjct: 483 LPSTNVQRSWVHLCKLRASLHWCHIGVWTLEDSIQLKVAP-MSAQAKVVTSTRSSVVPQN 541

Query: 541 -----INNTSEESFTSVRESVEPSDNEDDEPFDFETNESTIQDAVPANAEVNDGGXXXXX 595
                 +  S E+F   +      D  +DE FDFE  E T+ D +   AEV + G     
Sbjct: 542 WTEDICSPQSGENFFVFQH----EDGLEDEEFDFENGEKTL-DTI--KAEVIEQGIS--- 591

Query: 596 XXNHLGNILDDYDTESIGFENSETEPVLGKENDLTPEEETIEKDESTVGESAEIIDIVQE 655
                              +N E E  L K+  +    E   K +STV  S+    + + 
Sbjct: 592 -------------------KNLENEAALNKKKSVETMAEPTTKPDSTVNSSSRPNVVEKG 632

Query: 656 SEVTANDDELKNEA---EVTEIQETHEIAENLKEEESN---LEIAEDIV 698
           + +      +  E    EV E+QE+ E+ E  +E+E     L I  D++
Sbjct: 633 TNLYEGSHPVPPEQIEDEVDEVQESDEVKEVHEEQEKQKIPLRILNDLL 681

>Kwal_33.13389 s33 complement(197441..199525) [2085 bp, 694 aa] {ON}
           YNL272C (SEC2) - GDP/GTP exchange factor for Sec4p
           [contig 118] FULL
          Length = 694

 Score =  459 bits (1181), Expect = e-150,   Method: Compositional matrix adjust.
 Identities = 247/576 (42%), Positives = 338/576 (58%), Gaps = 20/576 (3%)

Query: 6   DESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKYDQLDK 65
           +ESKR S+Q+++LSTQL+ESI+KQ+ LE++L ++R+ I  Q+ A++ Y  +  + ++ + 
Sbjct: 5   EESKRVSVQVSSLSTQLIESIDKQSHLEEQLLQARKVISSQRDALKSYESVGKRLEETEA 64

Query: 66  NFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADARRGAQ 125
                + + AK +   K       +A+ +V  LNKEVEELTASLFDEANNMVADAR+   
Sbjct: 65  ELESVRAQNAKDKEALKAAQSETEAAKDEVSRLNKEVEELTASLFDEANNMVADARKETH 124

Query: 126 EIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNXXXXXXXXXX 185
            I +KN KL E L EK ++LET+ +QLKNLK VL+DL+ +  +   SNR+          
Sbjct: 125 SIQVKNIKLTEQLQEKSSLLETLEIQLKNLKKVLYDLEEESNSRLQSNRSPVMDTSDNST 184

Query: 186 XXXXXXXXXXXNSTTNIDLL-SNAIYTPKVPAVRYDLYLYNEFLKFIAVLPFCESIKHTT 244
                      ++        +N +++P + ++RYDL LYNEFLKFIA LP   SIK T 
Sbjct: 185 VSSAIALENTMHALNGTARSPNNVLFSPVLKSLRYDLNLYNEFLKFIAALPTSASIKDTA 244

Query: 245 SESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNENYRFXXX 304
           SESKLLRRL++DEIQP+LRLDNASGLGW  KR+LM LM++GLVV+EP+SG+NE YR    
Sbjct: 245 SESKLLRRLVHDEIQPLLRLDNASGLGWYFKRSLMTLMMDGLVVVEPVSGINETYRVSHA 304

Query: 305 XXXXXXXXXXDPKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARMYMLKTQT 364
                              HL+ YP++SPP+A+ +PC+FC E+RND+LEH R+Y+L+T  
Sbjct: 305 SGVENTKLQRPRSEQRIEGHLYNYPADSPPVAIQDPCSFCSESRNDILEHGRLYVLRTLQ 364

Query: 365 KNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTIAKGDSKKXX 424
           K E+ T  + +QFPLC  CL+KVRQTCEIFAFLRSLK GAW+LE VT+   ++  S +  
Sbjct: 365 KTEEGTTEVNSQFPLCHYCLLKVRQTCEIFAFLRSLKSGAWHLESVTVDANSQRSSTEFK 424

Query: 425 XXXXXXXXXXXXXXXXXXXXXLMKRRSIMAGFGIXXXXXXXXXXXXXXVGVVDQSGLPTT 484
                                  KR SIMAG                  G   Q   PTT
Sbjct: 425 SQSKLSTPERGSERKVKSDRK-SKRLSIMAGL-TKSFPSKTSYAIEETPGSNSQVTTPTT 482

Query: 485 NIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRPELSESNQNGTELEDQQILANINNT 544
           NIQ AW  L KLRS LHW HIGIW+  ++V TKL P     +         ++L ++   
Sbjct: 483 NIQIAWAQLCKLRSTLHWTHIGIWSIGDSVETKLGPMTFPDSAEAVASSSNEVLTHL--- 539

Query: 545 SEESFTSVRESVEPSDNEDDEPFDFE--TNESTIQD 578
                    +S+  S+N++   FDFE  TN S + D
Sbjct: 540 ---------QSLASSNNDE---FDFEKTTNSSELVD 563

>AFR670W Chr6 (1668415..1670568) [2154 bp, 717 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YNL272C (SEC2)
          Length = 717

 Score =  452 bits (1164), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 243/582 (41%), Positives = 337/582 (57%), Gaps = 33/582 (5%)

Query: 6   DESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKYDQLDK 65
           +E++R S+Q+++LSTQL+ESI+KQ++LE++LQ +++ +  Q+  ++Q    + +  QL  
Sbjct: 14  EENRRISVQVSSLSTQLIESIDKQSRLEEQLQHAKKALAAQKDVVKQCESARGEAQQLRS 73

Query: 66  NFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADARRGAQ 125
                  ++ +   E +E  K RL+AE  V+ LNKE+E+LT SLFDEAN MV+ AR+   
Sbjct: 74  QLADRDTELERQGEELEEARKARLAAELAVERLNKEIEDLTTSLFDEANRMVSKARKEKH 133

Query: 126 EIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNXXXXXXXXXX 185
            ++  N +L E L EKD +L+T+ +QLKNLK+VL+ ++++      + R+          
Sbjct: 134 VVEQHNARLQEQLREKDMLLDTLTIQLKNLKDVLYKVEDEQ-----NTRSRRQSVMDSVN 188

Query: 186 XXXXXXXXXXXNSTTNIDLLSNAIYTPKVPAVRYDLYLYNEFLKFIAVLPFCESIKHTTS 245
                       S  +  L S  ++TP V ++RYD+ +Y E+L+F+AVLP C+SI+ T  
Sbjct: 189 PSHTSLDVDGYASAFDNMLSSGLLFTPAVQSLRYDIPMYTEYLRFLAVLPMCKSIRDTRH 248

Query: 246 ESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNENYRFXXXX 305
           +SK LRRL++DEIQPVLRLD+A+GLGW+V+R LMNLMIEGLVV+EPLSG+NE YR     
Sbjct: 249 DSKFLRRLVSDEIQPVLRLDSATGLGWLVRRNLMNLMIEGLVVVEPLSGINETYRMGYAS 308

Query: 306 XXXXXXXXXDPKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARMYMLKTQTK 365
                          K   +F YP NSPP+A+  PCAFC E RND+LEH R+Y+LKT  K
Sbjct: 309 PQTHSHSKSSEPAAVK---MFTYPVNSPPVAIEAPCAFCSEARNDILEHGRLYVLKTLQK 365

Query: 366 NEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKVTLSTIAKGDSKKXXX 425
            E   L   NQ+PLC  CL+KVRQTCEIFAFLRSLK G+WNLE VTLS  AK +S     
Sbjct: 366 TETGELLTENQYPLCHFCLLKVRQTCEIFAFLRSLKTGSWNLENVTLS-CAKQESDAFTQ 424

Query: 426 XXXXXXXXXXXXXXXXXXXXLMKRRSIMAGFGIXXXXXXXXXXXXXXVGVVDQSGLPTTN 485
                                 KR S M+                      ++ GLP TN
Sbjct: 425 IPNSVQASPVIHRDENSITSSSKRLSFMSSLSRVSTTSKTTPRIEAVTDFNEKKGLPPTN 484

Query: 486 IQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRPELSESN-----------QNGTELED 534
           +QR+WVHL KLR+ LHW+HIG+W  D+AV TK+ P   E             Q+ T+L  
Sbjct: 485 VQRSWVHLCKLRASLHWSHIGVWTLDDAVQTKVVPLSPEDKISSVSSESISPQDWTKLPS 544

Query: 535 QQILANINNTSEESFTSVRESVEPSDNEDDEPFDFETNESTI 576
            Q + N       SF   +E      +E +E FDFE  E TI
Sbjct: 545 PQSVEN-------SFIFQKE------DEIEEGFDFEHGEDTI 573

>KNAG0F00460 Chr6 complement(64086..66050) [1965 bp, 654 aa] {ON}
           Anc_1.81 YNL272C
          Length = 654

 Score =  436 bits (1122), Expect = e-142,   Method: Compositional matrix adjust.
 Identities = 225/524 (42%), Positives = 314/524 (59%), Gaps = 20/524 (3%)

Query: 3   DSSDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDLKVKYDQ 62
           D++DESKR S+Q+T++STQLMESI  Q+ LE+KL R+ +     +     Y++LK +  +
Sbjct: 14  DTADESKRISLQITSMSTQLMESIQNQSLLEEKLNRANKAAAALKEQTVHYDELKGRVAK 73

Query: 63  LDKNFNVTKVKIAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADARR 122
           L+ +      ++A L++   EE   R ++++ V+EL  EVE+LTASLF EANNMVADAR+
Sbjct: 74  LEASLTNRDEEMAALKSALAEEKSKRAASDKSVEELQSEVEDLTASLFSEANNMVADARK 133

Query: 123 GAQEIDIKNRKLVEMLHEKDTILETMNLQLKNLKNVLHDLQNDPANIAVSNRNXXXXXXX 182
                +I NRKL+E ++EKD  LETM +QLK+L+ +L  +  D  + + + R+       
Sbjct: 134 EKHTTEILNRKLLEAVNEKDNALETMKIQLKHLRKMLEKV--DVGSPSATGRSSMTSADT 191

Query: 183 XXXXXXXXXXXXXXNSTTNIDLLSNAIYTPKVPAVRYDLYLYNEFLKFIAVLPFCESIKH 242
                          S ++   L   +Y+P V +VRYDL LY+EFLKF+  LP C  I+ 
Sbjct: 192 DTNSLKGIVTRSSNQSQSDTAPL--VVYSPSVGSVRYDLSLYSEFLKFLVSLPRCTQIRD 249

Query: 243 TTSESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEGLVVIEPLSGVNENYRFX 302
           T SESKL+RRLINDEI P+LR+D+A G+GW+ K++LMN+M+EG+V+IEP SGVNENY+  
Sbjct: 250 TESESKLVRRLINDEIAPILRIDSAPGIGWMAKKSLMNVMLEGMVIIEPNSGVNENYQHG 309

Query: 303 XXXXXXXXXXXXDPKLTSKNDHLFKYPSNSPPIAVHEPCAFCGENRNDVLEHARMYMLKT 362
                          L     HLF YP++SPPIA  E CA CGE+R+D+ EH R++ +K 
Sbjct: 310 HSSPSISQHS-----LGKSQPHLFSYPADSPPIASFESCALCGESRSDIYEHERLHKMKI 364

Query: 363 QTKNEDNTLSITNQFPLCQMCLIKVRQTCEIFAFLRSLKLGAWNLEKV-TLSTIAKGDSK 421
           Q K +D TL + N +PLC  CL++VRQTCEIF+FLRSLK G W LE + T  +     SK
Sbjct: 365 QQKRDDGTLEVVNLYPLCLWCLLRVRQTCEIFSFLRSLKTGVWGLETIKTRGSPTSAKSK 424

Query: 422 KXXXXXXXXXXXXXXXXXXXXXXXLMKRRSIMAGFGIXXXXXXXXXXXXXXV-----GVV 476
           K                         KR S MAG G+              +        
Sbjct: 425 KFDLNNAPIRRNKTKNSANRT-----KRMSWMAGLGLNTPTSSSSAPNDVSLMEPSTTFT 479

Query: 477 DQSGLPTTNIQRAWVHLSKLRSMLHWAHIGIWNTDNAVTTKLRP 520
           D++GLP TNI+RAW+ L KLRS+LHWAHIGIW+  +A+  K+ P
Sbjct: 480 DKNGLPNTNIKRAWLQLCKLRSILHWAHIGIWSVSDALDLKIGP 523

>YMR120C Chr13 complement(507502..509280) [1779 bp, 592 aa] {ON}
           ADE17Enzyme of 'de novo' purine biosynthesis containing
           both 5-aminoimidazole-4-carboxamide ribonucleotide
           transformylase and inosine monophosphate cyclohydrolase
           activities, isozyme of Ade16p; ade16 ade17 mutants
           require adenine and histidine
          Length = 592

 Score = 38.5 bits (88), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 32/99 (32%), Positives = 48/99 (48%), Gaps = 3/99 (3%)

Query: 599 HLGNILDDYDTESIGFENSETEPVLGKENDLTPEEETIEKDESTVGESAEIIDIVQESEV 658
           H G +  D D++    +    E V     +L P +ET+ K   T+ E+ E IDI     V
Sbjct: 74  HGGILARDIDSDEKDLKEQHIEKVDYVVCNLYPFKETVAKVGVTIPEAVEEIDI---GGV 130

Query: 659 TANDDELKNEAEVTEIQETHEIAENLKEEESNLEIAEDI 697
           T      KN A VT + +  + +E L E  SN EI++D+
Sbjct: 131 TLLRAAAKNHARVTILSDPKDYSEFLSELSSNGEISQDL 169

>YLR285C-A Chr12 complement(708168..708338) [171 bp, 56 aa] {OFF}
           Putative protein of unknown function; identified by
           fungal homology and RT-PCR
          Length = 56

 Score = 33.9 bits (76), Expect = 0.10,   Method: Composition-based stats.
 Identities = 14/25 (56%), Positives = 17/25 (68%), Gaps = 3/25 (12%)

Query: 221 LYLYNE---FLKFIAVLPFCESIKH 242
           LY+YNE   FL+F   LPFCE + H
Sbjct: 10  LYIYNELFNFLRFTVFLPFCEFVPH 34

>NCAS0A04150 Chr1 (841619..843397) [1779 bp, 592 aa] {ON} Anc_2.418
           YLR028C
          Length = 592

 Score = 35.8 bits (81), Expect = 0.48,   Method: Compositional matrix adjust.
 Identities = 26/70 (37%), Positives = 39/70 (55%), Gaps = 3/70 (4%)

Query: 628 DLTPEEETIEKDESTVGESAEIIDIVQESEVTANDDELKNEAEVTEIQETHEIAENLKEE 687
           +L P +ET+ K   TV E+ E IDI     VT      KN A VT + + ++ A  L E 
Sbjct: 103 NLYPFKETVSKIGVTVPEAVEEIDI---GGVTLLRAAAKNHARVTILSDPNDYAAFLNEL 159

Query: 688 ESNLEIAEDI 697
           +SN EI++++
Sbjct: 160 KSNGEISQEL 169

>Smik_13.315 Chr13 complement(490547..492325) [1779 bp, 592 aa] {ON}
           YMR120C (REAL)
          Length = 592

 Score = 35.0 bits (79), Expect = 0.87,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 46/99 (46%), Gaps = 3/99 (3%)

Query: 599 HLGNILDDYDTESIGFENSETEPVLGKENDLTPEEETIEKDESTVGESAEIIDIVQESEV 658
           H G +  D D++    +    E V     +L P +ET+ K   T+ E+ E IDI     V
Sbjct: 74  HGGILARDIDSDEKDLKEQHIEKVDFVVCNLYPFKETVAKVGVTIPEAVEEIDI---GGV 130

Query: 659 TANDDELKNEAEVTEIQETHEIAENLKEEESNLEIAEDI 697
           T      KN   VT + +  + +E L E   N EI++D+
Sbjct: 131 TLLRAAAKNHTRVTILSDPKDYSEFLSELSGNGEISQDL 169

>Skud_13.280 Chr13 complement(481756..483534) [1779 bp, 592 aa] {ON}
           YMR120C (REAL)
          Length = 592

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 30/99 (30%), Positives = 48/99 (48%), Gaps = 3/99 (3%)

Query: 599 HLGNILDDYDTESIGFENSETEPVLGKENDLTPEEETIEKDESTVGESAEIIDIVQESEV 658
           H G +  D D++    +    E V     +L P +ET+ K   T+ E+ E IDI     V
Sbjct: 74  HGGILARDIDSDEKDLKEQHIEKVDFVVCNLYPFKETVAKIGVTIPEAVEEIDI---GGV 130

Query: 659 TANDDELKNEAEVTEIQETHEIAENLKEEESNLEIAEDI 697
           T      KN A VT + +  + +E L E  ++ EI++D+
Sbjct: 131 TLLRAAAKNHARVTILSDPRDYSEFLDELSNSGEISQDL 169

>SAKL0D11396g Chr4 (953470..955686) [2217 bp, 738 aa] {ON} similar
           to uniprot|P46673 Saccharomyces cerevisiae YJR042W NUP85
           Subunit of the Nup84p subcomplex of the nuclear pore
           complex (NPC) required for assembly of the subcomplex
           and also for formation of the nucleocytoplasmic Gsp1p
           concentration gradient that plays a role in nuclear
           trafficking
          Length = 738

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 33/110 (30%), Positives = 55/110 (50%), Gaps = 8/110 (7%)

Query: 1   MEDSSDESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQY-NDLKVK 59
           +ED + E K    +L  +S+Q +  ++     E KL  S    ++  TA  QY + L   
Sbjct: 66  IEDFNREGKALKFKLNPISSQSLGFVSAHVA-ETKLYTSEIQSVDNSTAYSQYVSKLFEI 124

Query: 60  YDQL--DKNFNVTKVKIAKLENESKEEH--KLRLSAEQKVDELNKEVEEL 105
           YD L  D+ F+V  + +  + N S+EEH   + L+ E  V+EL   +E +
Sbjct: 125 YDDLGEDRQFSVPTIGL--ISNSSREEHLQVVNLAMEATVNELEILIESV 172

>KAFR0G03200 Chr7 complement(663726..669335) [5610 bp, 1869 aa] {ON}
            Anc_4.238 YDL058W
          Length = 1869

 Score = 33.9 bits (76), Expect = 2.0,   Method: Compositional matrix adjust.
 Identities = 40/146 (27%), Positives = 73/146 (50%), Gaps = 19/146 (13%)

Query: 18   LSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQ-YNDLKVKYDQLDK---NFNVTKVK 73
            L  +L ES+ + +Q    L++ + T+++++  +E+  ND K++ ++ +K   +F VTK K
Sbjct: 1584 LRQKLEESLKRNSQEYKSLEQLQETLVKEKQELEKSLNDSKIQLNEKEKVIKDFEVTKEK 1643

Query: 74   IAKLENESKEEHKLRLSAEQKVDELNKEVEELTASLFDEANNMVADARRGAQEIDIKNRK 133
            + + EN   E+ K    A Q          E T     E  N +++  + AQ+ +I  +K
Sbjct: 1644 LQETENALSEKEK----AMQDF--------EATKEKLQETENALSEKEKAAQDFEITKKK 1691

Query: 134  LVE---MLHEKDTILETMNLQLKNLK 156
            LVE    L EK   +E + +    LK
Sbjct: 1692 LVETEKALSEKGKAVEDLEITTNKLK 1717

>Suva_13.299 Chr13 complement(487129..488907) [1779 bp, 592 aa] {ON}
           YMR120C (REAL)
          Length = 592

 Score = 33.5 bits (75), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 24/70 (34%), Positives = 37/70 (52%), Gaps = 3/70 (4%)

Query: 628 DLTPEEETIEKDESTVGESAEIIDIVQESEVTANDDELKNEAEVTEIQETHEIAENLKEE 687
           +L P +ET+ K   T+ E+ E IDI     VT      KN   VT + +  + +E L E 
Sbjct: 103 NLYPFKETVAKVGVTIPEAVEEIDI---GGVTLLRAAAKNHTRVTILSDPKDYSEFLGEL 159

Query: 688 ESNLEIAEDI 697
            +N EI++D+
Sbjct: 160 SNNGEISQDL 169

>KLLA0E13025g Chr5 complement(1154244..1156820) [2577 bp, 858 aa]
           {ON} highly similar to uniprot|Q00578 Saccharomyces
           cerevisiae YIL143C SSL2
          Length = 858

 Score = 33.1 bits (74), Expect = 3.6,   Method: Compositional matrix adjust.
 Identities = 18/51 (35%), Positives = 31/51 (60%), Gaps = 5/51 (9%)

Query: 240 IKHT-----TSESKLLRRLINDEIQPVLRLDNASGLGWIVKRTLMNLMIEG 285
           IKH      TS++ +L+ L+ND+I   LR+D  + +   VK+T+ N M++ 
Sbjct: 245 IKHNRYFVETSQADILQMLLNDQIIGNLRIDTDAAVDAAVKKTMANKMVDA 295

>Suva_13.303 Chr13 (492495..495398) [2904 bp, 967 aa] {ON} YMR124W
           (REAL)
          Length = 967

 Score = 32.7 bits (73), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 25/90 (27%), Positives = 47/90 (52%), Gaps = 6/90 (6%)

Query: 7   ESKRFSIQLTTLSTQLMESINKQTQLEDKLQRSRRTIMEQQTAIEQYNDL-KVKYDQLDK 65
           E+K    +LT +ST+L ESI ++T+LE+K++     + E   +   ++D   V +   +K
Sbjct: 843 ENKELMSELTLVSTELAESIKRETELEEKIR-----LYETNNSTPNFDDTSSVSFSDFEK 897

Query: 66  NFNVTKVKIAKLENESKEEHKLRLSAEQKV 95
                  KI +L  +  +E   R  AE+++
Sbjct: 898 ELRKKSSKIVQLIQQLNDERLKRFIAEEQL 927

>TPHA0G02760 Chr7 (588533..590308) [1776 bp, 591 aa] {ON} Anc_2.418
           YLR028C
          Length = 591

 Score = 32.0 bits (71), Expect = 7.0,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 40/74 (54%), Gaps = 3/74 (4%)

Query: 628 DLTPEEETIEKDESTVGESAEIIDIVQESEVTANDDELKNEAEVTEIQETHEIAENLKEE 687
           +L P +ET+ K   T+ E+ E IDI     VT      KN + VT + + ++ A  LK+ 
Sbjct: 103 NLYPFKETVGKIGVTIAEAVEEIDI---GGVTLLRAAAKNHSRVTILSDPNDYALFLKDL 159

Query: 688 ESNLEIAEDIVKTV 701
             + +I++D+  T+
Sbjct: 160 SEDGQISQDLRNTL 173

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.309    0.127    0.344 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 82,033,747
Number of extensions: 3853595
Number of successful extensions: 34442
Number of sequences better than 10.0: 2067
Number of HSP's gapped: 32266
Number of HSP's successfully gapped: 3277
Length of query: 824
Length of database: 53,481,399
Length adjustment: 118
Effective length of query: 706
Effective length of database: 39,950,811
Effective search space: 28205272566
Effective search space used: 28205272566
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.1 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.7 bits)
S2: 70 (31.6 bits)