Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_2000.661.82ON1930190981830.0
TPHA0B044901.82ON1940110324120.0
YNL271C (BNI1)1.82ON1953109324090.0
Skud_14.691.82ON1946109324000.0
Smik_14.661.82ON1952109323980.0
Suva_14.711.82ON1948108923960.0
TDEL0C061901.82ON1879110523740.0
NCAS0A005901.82ON1946110422960.0
CAGL0J08206g1.82ON1898107522770.0
KNAG0F004701.82ON2028111921370.0
KAFR0D039501.82ON195783820650.0
ZYRO0F16676g1.82ON199483919050.0
TBLA0A054401.82ON217062918400.0
NDAI0F042201.82ON202260318060.0
SAKL0C02618g1.82ON198867816990.0
AFR669W1.82ON191859516730.0
Kwal_33.133921.82ON196862616630.0
Ecym_10861.82ON209164716130.0
KLTH0F02376g1.82ON197662515970.0
KLLA0C02321g1.82ON184265215271e-178
SAKL0E15224g5.717ON13354167151e-75
Kpol_416.105.717ON14914347152e-75
AFR301C5.717ON16554746993e-73
NCAS0G001205.717ON13144346882e-72
Ecym_5679na 1ON13064576793e-71
KLTH0E00704g5.717ON13894146803e-71
Smik_9.95.717ON13744316776e-71
Ecym_40045.717ON14544756723e-70
TDEL0F055605.717ON12924826684e-70
CAGL0H06765g5.717ON12944716685e-70
Kwal_55.196205.717ON13894176679e-70
AGL364Cna 1ON12604236613e-69
KNAG0L022505.717ON13674246606e-69
KLLA0F10912g5.717ON12834766562e-68
Skud_9.85.717ON13744306562e-68
YIL159W (BNR1)5.717ON13754376491e-67
NDAI0F001605.717ON13494216453e-67
ZYRO0B16654g5.717ON14244196384e-66
Suva_9.265.717ON13754216331e-65
TPHA0E001205.717ON16424276305e-65
TBLA0E018105.717ON14514916205e-64
KAFR0D021205.717ON13244176018e-62
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_2000.66
         (1930 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 193...  3156   0.0  
TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_...   933   0.0  
YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}...   932   0.0  
Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {...   929   0.0  
Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {...   928   0.0  
Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847...   927   0.0  
TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_...   919   0.0  
NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {...   889   0.0  
CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} simi...   881   0.0  
KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON}     827   0.0  
KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1....   800   0.0  
ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} som...   738   0.0  
TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa]...   713   0.0  
NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON}           700   0.0  
SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] ...   659   0.0  
AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic...   649   0.0  
Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] ...   645   0.0  
Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON...   625   0.0  
KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] ...   619   0.0  
KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] ...   592   e-178
SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa...   280   1e-75
Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] ...   280   2e-75
AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON} ...   273   3e-73
NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717      269   2e-72
Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} simila...   266   3e-71
KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some si...   266   3e-71
Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   265   6e-71
Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to ...   263   3e-70
TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa]...   261   4e-70
CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] ...   261   5e-70
Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W...   261   9e-70
AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON} Sy...   259   3e-69
KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] ...   258   6e-69
KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} som...   257   2e-68
Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)   257   2e-68
YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,...   254   1e-67
NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717     253   3e-67
ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa...   250   4e-66
Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (R...   248   1e-65
TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717 ...   247   5e-65
TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {...   243   5e-64
KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5....   236   8e-62

>Kpol_2000.66 s2000 (137817..142124,142127..143611) [5793 bp, 1930 aa]
            {ON} (137817..142124,142127..143611) [5793 nt, 1931 aa]
          Length = 1930

 Score = 3156 bits (8183), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 1591/1909 (83%), Positives = 1591/1909 (83%)

Query: 22   LLQNLXXXXXXXXXXXXXXXXADISSPKKPIVPKQFTSTELRPLNKKSTLNTQNLSQYVS 81
            LLQNL                ADISSPKKPIVPKQFTSTELRPLNKKSTLNTQNLSQYVS
Sbjct: 22   LLQNLKKITNSSSNSSTSINKADISSPKKPIVPKQFTSTELRPLNKKSTLNTQNLSQYVS 81

Query: 82   GTKIDQDNPNPLPTNNTSHTRAHSSQSATKYSYSRRSSTATGPIKXXXXXXXXXXXXXXX 141
            GTKIDQDNPNPLPTNNTSHTRAHSSQSATKYSYSRRSSTATGPIK               
Sbjct: 82   GTKIDQDNPNPLPTNNTSHTRAHSSQSATKYSYSRRSSTATGPIKLSRQQTTQSLGSSSV 141

Query: 142  XXXXXYTNLLKYIDSDGKINLEMPRDPHEVEALFEDLMYKRNIFQALPQDKQKELMSYDV 201
                 YTNLLKYIDSDGKINLEMPRDPHEVEALFEDLMYKRNIFQALPQDKQKELMSYDV
Sbjct: 142  LSQGSYTNLLKYIDSDGKINLEMPRDPHEVEALFEDLMYKRNIFQALPQDKQKELMSYDV 201

Query: 202  TKKWTLVKQDLQNEIKKLMSKSSSYHPTEXXXXXXXXXXXXXXXXXXXXXXXXXXQDSNS 261
            TKKWTLVKQDLQNEIKKLMSKSSSYHPTE                          QDSNS
Sbjct: 202  TKKWTLVKQDLQNEIKKLMSKSSSYHPTEGSYSSASNSNGNLNSYSSSLRSSATSQDSNS 261

Query: 262  PQTAIFTSNSGTMQXXXXXXXXXXIPVGGKSRPVGSSSTASGTNSMIYQSSENNKSVSSI 321
            PQTAIFTSNSGTMQ          IPVGGKSRPVGSSSTASGTNSMIYQSSENNKSVSSI
Sbjct: 262  PQTAIFTSNSGTMQNNTINLNNGNIPVGGKSRPVGSSSTASGTNSMIYQSSENNKSVSSI 321

Query: 322  ATDRINRPPIHYVKKIIADRLTSEEMNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMNT 381
            ATDRINRPPIHYVKKIIADRLTSEEMNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMNT
Sbjct: 322  ATDRINRPPIHYVKKIIADRLTSEEMNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMNT 381

Query: 382  IYKCAPGSELTPELQEKEHSFFKCFRVLSMLSQGLYEFAKHKLMSDTIANGLFSSRLATR 441
            IYKCAPGSELTPELQEKEHSFFKCFRVLSMLSQGLYEFAKHKLMSDTIANGLFSSRLATR
Sbjct: 382  IYKCAPGSELTPELQEKEHSFFKCFRVLSMLSQGLYEFAKHKLMSDTIANGLFSSRLATR 441

Query: 442  KMATEVLVCMIEKRNNMRFEVVLASLDRYFRQEENLNMVHLSKTLPGEYPQSTPNTKYKI 501
            KMATEVLVCMIEKRNNMRFEVVLASLDRYFRQEENLNMVHLSKTLPGEYPQSTPNTKYKI
Sbjct: 442  KMATEVLVCMIEKRNNMRFEVVLASLDRYFRQEENLNMVHLSKTLPGEYPQSTPNTKYKI 501

Query: 502  IQAWLIALDETLNGRGKMGSLVGASDDYRSAGENAILEYCLWTMVFINHLCSNSSLLNQR 561
            IQAWLIALDETLNGRGKMGSLVGASDDYRSAGENAILEYCLWTMVFINHLCSNSSLLNQR
Sbjct: 502  IQAWLIALDETLNGRGKMGSLVGASDDYRSAGENAILEYCLWTMVFINHLCSNSSLLNQR 561

Query: 562  ILLRTKLENLGALRIMTKLKRLDYEKLTEQIELYDNNKLDDFNTVLETESKNSKVNMQNP 621
            ILLRTKLENLGALRIMTKLKRLDYEKLTEQIELYDNNKLDDFNTVLETESKNSKVNMQNP
Sbjct: 562  ILLRTKLENLGALRIMTKLKRLDYEKLTEQIELYDNNKLDDFNTVLETESKNSKVNMQNP 621

Query: 622  NSLIENLWESCKGSDNEKXXXXXXXXXXXXXXKLMGEKEDPTKLSKQLKLIDSLLTNVNG 681
            NSLIENLWESCKGSDNEK              KLMGEKEDPTKLSKQLKLIDSLLTNVNG
Sbjct: 622  NSLIENLWESCKGSDNEKLLLSLIQHLYLSSSKLMGEKEDPTKLSKQLKLIDSLLTNVNG 681

Query: 682  SMFDEESHMNLAIQRLYDSMQTDEVARRAILESRTLTKKLEEAHAERDYLSNKLSNAENG 741
            SMFDEESHMNLAIQRLYDSMQTDEVARRAILESRTLTKKLEEAHAERDYLSNKLSNAENG
Sbjct: 682  SMFDEESHMNLAIQRLYDSMQTDEVARRAILESRTLTKKLEEAHAERDYLSNKLSNAENG 741

Query: 742  LVGQLESDLKQRDNILEKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXXXMLTILNSRNG 801
            LVGQLESDLKQRDNILEKNQRVM                           MLTILNSRNG
Sbjct: 742  LVGQLESDLKQRDNILEKNQRVMKQLESELEDLKKKHLLEKHEHEVELRKMLTILNSRNG 801

Query: 802  TQNPDVDDVTITLDPNKKLDIQKALELELNKTKKDLSNDSKRFGITVQPNKRLKMLRMQM 861
            TQNPDVDDVTITLDPNKKLDIQKALELELNKTKKDLSNDSKRFGITVQPNKRLKMLRMQM
Sbjct: 802  TQNPDVDDVTITLDPNKKLDIQKALELELNKTKKDLSNDSKRFGITVQPNKRLKMLRMQM 861

Query: 862  EDIENEARQLEMTNFADHKRTNXXXXXXXXXXXXXXXXXXXNTEEFDKENEMKTKKLMQL 921
            EDIENEARQLEMTNFADHKRTN                   NTEEFDKENEMKTKKLMQL
Sbjct: 862  EDIENEARQLEMTNFADHKRTNLKKPVIVKKEKKLRKKKKINTEEFDKENEMKTKKLMQL 921

Query: 922  RKALAAIQSETNDISKFNVEGRVNEMFQDXXXXXXXXXXXXXXXYKDFEIPFXXXXXXXX 981
            RKALAAIQSETNDISKFNVEGRVNEMFQD               YKDFEIPF        
Sbjct: 922  RKALAAIQSETNDISKFNVEGRVNEMFQDKKLKALQRLKQLEAKYKDFEIPFDELQDLDD 981

Query: 982  XXXXXXXXHSTLDPTYLQKKINELDEISDELYLMNYXXXXXXXXXXXXXXXXXXXXXXXX 1041
                    HSTLDPTYLQKKINELDEISDELYLMNY                        
Sbjct: 982  RELDDEQQHSTLDPTYLQKKINELDEISDELYLMNYDSDANNGNTSDSSSSSEADGDGTD 1041

Query: 1042 XMRSVSNAPSKGISEAGSFLESLSQKYGTGQNAISSPTSITSPNERIASQGEKSFMNRLK 1101
             MRSVSNAPSKGISEAGSFLESLSQKYGTGQNAISSPTSITSPNERIASQGEKSFMNRLK
Sbjct: 1042 SMRSVSNAPSKGISEAGSFLESLSQKYGTGQNAISSPTSITSPNERIASQGEKSFMNRLK 1101

Query: 1102 RQTMAAPFLEELTQKXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXXIADILLKDRSKDG 1161
            RQTMAAPFLEELTQK                                IADILLKDRSKDG
Sbjct: 1102 RQTMAAPFLEELTQKVNDTSSIDDNISDLDDVEVDENDNDDDVEDTDIADILLKDRSKDG 1161

Query: 1162 LKSSDEQDDSEAVQAXXXXXXXXXXXXXEMLGATKNXXXXXXXXXXXXXXXXXXXXXXXX 1221
            LKSSDEQDDSEAVQA             EMLGATKN                        
Sbjct: 1162 LKSSDEQDDSEAVQAPPPPPPPPPPPLPEMLGATKNAPGAVPPPPPPPPPDLFGGAPPPP 1221

Query: 1222 XXXXXXXXXXKNSGGTXXXXXXXXMMGKKEPYKSVVDQPSLLQLTNSDRLPRPQKKLKQL 1281
                      KNSGGT        MMGKKEPYKSVVDQPSLLQLTNSDRLPRPQKKLKQL
Sbjct: 1222 PLPPVLGAGGKNSGGTPPPPPPPPMMGKKEPYKSVVDQPSLLQLTNSDRLPRPQKKLKQL 1281

Query: 1282 HWDKLDSTDSSIWSKGMAERFADDLYEKGVLRNLEKAFAAREIKSIGTRKKEDLSKISFL 1341
            HWDKLDSTDSSIWSKGMAERFADDLYEKGVLRNLEKAFAAREIKSIGTRKKEDLSKISFL
Sbjct: 1282 HWDKLDSTDSSIWSKGMAERFADDLYEKGVLRNLEKAFAAREIKSIGTRKKEDLSKISFL 1341

Query: 1342 SHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEFLAKSEIVEVSVNLARNY 1401
            SHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEFLAKSEIVEVSVNLARNY
Sbjct: 1342 SHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEFLAKSEIVEVSVNLARNY 1401

Query: 1402 APYTTDWEGVKSLKMQKFQRRIQMTYRELIKFIYNMVNLQSYWASRMRALKVITSYEREY 1461
            APYTTDWEGVKSLKMQKFQRRIQMTYRELIKFIYNMVNLQSYWASRMRALKVITSYEREY
Sbjct: 1402 APYTTDWEGVKSLKMQKFQRRIQMTYRELIKFIYNMVNLQSYWASRMRALKVITSYEREY 1461

Query: 1462 NELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKD 1521
            NELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKD
Sbjct: 1462 NELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKD 1521

Query: 1522 ATNSMTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERS 1581
            ATNSMTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERS
Sbjct: 1522 ATNSMTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERS 1581

Query: 1582 LEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGX 1641
            LEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAG 
Sbjct: 1582 LEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGD 1641

Query: 1642 XXXXXXXXXXXXXXITEYKKAQSQNLKQEEEERAYEKHKRMIEEQQHKQDLXXXXXXXXX 1701
                          ITEYKKAQSQNLKQEEEERAYEKHKRMIEEQQHKQDL         
Sbjct: 1642 KFAKNSFFKKFADFITEYKKAQSQNLKQEEEERAYEKHKRMIEEQQHKQDLEEERSREVE 1701

Query: 1702 XXXXXXQSDRRAMMDKLLEKLKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDT 1761
                  QSDRRAMMDKLLEKLKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDT
Sbjct: 1702 GEPGEEQSDRRAMMDKLLEKLKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDT 1761

Query: 1762 GDDSIVYSPNTPTQEGPNDIHLASPTPSGKSDLVLASVSPTKESTADGIAEDEFISDRAK 1821
            GDDSIVYSPNTPTQEGPNDIHLASPTPSGKSDLVLASVSPTKESTADGIAEDEFISDRAK
Sbjct: 1762 GDDSIVYSPNTPTQEGPNDIHLASPTPSGKSDLVLASVSPTKESTADGIAEDEFISDRAK 1821

Query: 1822 ALLLELRGSENMKRNSQLEEQKEKLKARRSRRRTQTESISSNKLFFTDEESHSTSPSESK 1881
            ALLLELRGSENMKRNSQLEEQKEKLKARRSRRRTQTESISSNKLFFTDEESHSTSPSESK
Sbjct: 1822 ALLLELRGSENMKRNSQLEEQKEKLKARRSRRRTQTESISSNKLFFTDEESHSTSPSESK 1881

Query: 1882 GTEYEMTTANEEPEEILNARITEEGPHXXXXXXXXXXXXXSIPSKDESL 1930
            GTEYEMTTANEEPEEILNARITEEGPH             SIPSKDESL
Sbjct: 1882 GTEYEMTTANEEPEEILNARITEEGPHEEAPNQEEPNQEESIPSKDESL 1930

>TPHA0B04490 Chr2 (1052780..1058602) [5823 bp, 1940 aa] {ON} Anc_1.82
            YNL271C
          Length = 1940

 Score =  933 bits (2412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 518/1103 (46%), Positives = 691/1103 (62%), Gaps = 61/1103 (5%)

Query: 43   ADISSPKKPIVPKQFTSTELRPLNKKSTLNTQNLSQYVSGT--KIDQD------------ 88
            +DISSPK  ++  + +  +L+PLNK+++LN QNLSQY++G   K   D            
Sbjct: 49   SDISSPKSQLLTNKLSMDDLKPLNKRTSLNNQNLSQYINGKLPKSQSDSSHLGNVKSNHK 108

Query: 89   ---NPNPLPTNNTSHTRAHSSQSATKYSYSRRSSTATGPIKXXXXXXXXXXXXXXXXXXX 145
               N N    ++ +H R+ S QS+ KYSYSRRSS +T   +                   
Sbjct: 109  YEINENIQDGSSPNHNRSASVQSSAKYSYSRRSSNSTAATRLSRQSTNFSGSTPSVFSQG 168

Query: 146  XYTNLLKYIDSDGKINLEMPRDPHEVEALFEDLMYKRNIFQALPQDKQKELMSYDVTKKW 205
             Y NL KY+DS+G++NL+MP D HE+E+LFE+LMYKRNI QAL  DKQ+++M+YD  KKW
Sbjct: 169  SYANLSKYMDSNGRLNLDMPTDTHEIESLFEELMYKRNILQALSPDKQRDIMNYDTKKKW 228

Query: 206  TLVKQDLQNEIK--KLMSKSSSYHPTEXXXXXXXXXXXXXXXXXXXXXXXXXXQDSNSPQ 263
             +VKQDLQNE+K  KL + + +   T                            D+N+  
Sbjct: 229  MIVKQDLQNELKRIKLKNNNINNSDTTIIPSSMPSSNISERSSVNTMDNNLRTIDTNASN 288

Query: 264  TAIFTSNSGTMQXXXXXXXXXXIPVGGKSRPVGSSSTASGTNSMIYQSSENNKSVSSIAT 323
              I      +M                 S    +++  SG N+   +     +S+S  ++
Sbjct: 289  PRIHRKGQKSMS----------------SLSNATTTAPSGVNAEYSKI----RSISE-SS 327

Query: 324  DRINRPPIHYVKKIIADRLTSEEMNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMNTIY 383
            D+ N  PIHYV+KI++D L+  E+NDLWVTLRTEQLDWVDAFLEHQGHIA+AN L+  IY
Sbjct: 328  DKTNIAPIHYVRKILSDTLSKNELNDLWVTLRTEQLDWVDAFLEHQGHIAIANNLIRCIY 387

Query: 384  KCAPGSELTPELQEKEHSFFKCFRVLSMLSQGLYEFAKHKLMSDTIANGLFSSRLATRKM 443
            K APGS L+ EL EKE+ FFKCFRVL+ML QGLYEF KHKLM DT+A GLFS+R++TRKM
Sbjct: 388  KTAPGSNLSDELIEKEYGFFKCFRVLAMLDQGLYEFTKHKLMMDTLAFGLFSTRVSTRKM 447

Query: 444  ATEVLVCMIEKRNNMRFEVVLASLDRYFRQEENLNMVHLSKTLPGEYPQSTPNTKYKIIQ 503
            A E+LV +I K+N  RFE V+ SLDR+FR  ENLNM+ +     G + +++P+T++KI Q
Sbjct: 448  ALEILVYIINKKNTQRFESVIMSLDRFFRLSENLNMLKIITQFGGAFSRTSPDTQFKIFQ 507

Query: 504  AWLIALDETLNGRGKMGSLVGASDDYR-SAGENAILEYCLWTMVFINHLCSNSSLLNQRI 562
            A++I+L+ TLNGRGKMGS VGASDD++ S GENAILEYCLW ++FIN LC+ S  LNQR+
Sbjct: 508  AFVISLESTLNGRGKMGSKVGASDDFKVSGGENAILEYCLWALIFINKLCNFSDELNQRV 567

Query: 563  LLRTKLENLGALRIMTKLKRLDYEKLTEQIELYDNNKLDDFNTVLETESKNSKVNMQNPN 622
            +LRTK ENLG LR+MTKLK +DYEK+T Q+E Y+++KLDDFN++LE +S ++++NMQ+P 
Sbjct: 568  VLRTKFENLGGLRVMTKLKLMDYEKMTVQVENYEDHKLDDFNSLLEMKSSSAQINMQDPT 627

Query: 623  SLIENLWESCKGSDNEKXXXXXXXXXXXXXXKLMGEKEDPTKLSKQLKLIDSLLTNVNGS 682
            SLI +LWE CKG++NEK              KL+ +K +P KLSKQLKL+DSL+TN+  S
Sbjct: 628  SLIGSLWEVCKGTENEKLLLSLMQHLFLSSSKLVDDKREPAKLSKQLKLMDSLMTNITAS 687

Query: 683  MFDEESHMNLAIQRLYDSMQTDEVARRAILESRTLTKKLEEAHAERDYLSNKLSNAENGL 742
              DE++HMNLAIQRLYDSMQTD+VARRAILE+RTL+KKLEE  AE++YL  KLS AENGL
Sbjct: 688  EVDEQTHMNLAIQRLYDSMQTDDVARRAILETRTLSKKLEEVTAEKEYLKEKLSKAENGL 747

Query: 743  VGQLESDLKQRDNILEKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXXXMLTILNSRNGT 802
            VGQLE +L+QRDNIL K+QRV                            +LTI+N+    
Sbjct: 748  VGQLELELEQRDNILTKSQRVTKQLQAELEDLKKKHLLEKHEHEVELRKILTIVNT---- 803

Query: 803  QNPDVDDVTITLDPNKKLDIQKALELELNKTKKDLSNDSKRFGITVQPNKRLKMLRMQME 862
             N D  D ++    +KK +IQKALE EL++TKKDL+ND K+FGI+VQPNKRL+MLR+QME
Sbjct: 804  -NTDA-DASLNNSSDKKHNIQKALETELSRTKKDLNNDVKKFGISVQPNKRLRMLRLQME 861

Query: 863  DIENEARQLEMTNFADHKRTNXXXXXXXXXXXXXXXXXXXNTEEFD---------KENEM 913
            DIE EAR+LEMTNF++H++ +                      +           + N +
Sbjct: 862  DIEKEARELEMTNFSEHQKLSLESPAVLNKTKKETKKKSKKKSKSSKSKEENNRKRANAI 921

Query: 914  KTKKLMQLRKALAAIQSETNDISKFNVEGRVNEMFQDXXXXXXXXXXXXXXXYKDFEIPF 973
            K +KL++LR+ LA IQ+ETND+SKFNV+ RVNE+F++               YK FEI F
Sbjct: 922  KKQKLLELRRDLAMIQAETNDVSKFNVDKRVNELFKEKKHEALNRLQMLEKKYKSFEIDF 981

Query: 974  XXXXXXXXXXXXXXXXHSTLDPTYLQKKINELDEISDELYLMNYXXXXXXXXXXXXXXXX 1033
                            + +LDP ++ KKI ++D I+DEL    +                
Sbjct: 982  -DPNDFKQAQLDSNASYESLDPNFVTKKITDIDRIADELDA--FSGDGTSSYSSSSLSDS 1038

Query: 1034 XXXXXXXXXMRSVSNAPSKGISEAGSFLESLSQKYGTGQNAISSPTSITSPNERIASQGE 1093
                     + ++   P KG+ +  SFLESLS+KYGT QN   +  S  SP  RIAS GE
Sbjct: 1039 EKNYYESNAVPTI--GPQKGLIDGSSFLESLSEKYGTAQNTEGTSLSPLSPQNRIASLGE 1096

Query: 1094 KSFMNRLKRQTMAAPFLEELTQK 1116
            KSFMNR KR+  +  FLEEL+QK
Sbjct: 1097 KSFMNRFKRKPSSMQFLEELSQK 1119

 Score =  769 bits (1986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 402/674 (59%), Positives = 495/674 (73%), Gaps = 48/674 (7%)

Query: 1246 MMGKKEPYKS------VVDQPSLLQLTNSDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMA 1299
             MG  + Y+S      + + PSL       + PRPQKKLKQLHWDKLD ++ SIWS  MA
Sbjct: 1237 FMGLNKMYRSGDGSQILNESPSLYS-----KYPRPQKKLKQLHWDKLDDSEGSIWSSAMA 1291

Query: 1300 ERFADDLYEKGVLRNLEKAFAAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSL 1359
            E+FADDLYEKGVL NLEKAFAAREIKS+  +KKEDL KISFLS DISQQFGINLHM+GSL
Sbjct: 1292 EQFADDLYEKGVLHNLEKAFAAREIKSLANKKKEDLDKISFLSRDISQQFGINLHMFGSL 1351

Query: 1360 AVPELIEKVLKCDRNLINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQKF 1419
             V EL+ K+LKC+R+++NTPSVIEFL+K EI +VS+NLARNYAPY TDWEGVK ++  K 
Sbjct: 1352 TVDELVIKILKCNRDVMNTPSVIEFLSKPEITDVSINLARNYAPYITDWEGVKHVEDAKA 1411

Query: 1420 -QRRIQMTYRELIKFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAV 1478
             ++ +    R    ++  MVNLQSYW SRMRA+KVITSYE+EY ELVTKLR++D AV A+
Sbjct: 1412 PEKSVDGLQRADQIYVQLMVNLQSYWPSRMRAIKVITSYEKEYTELVTKLRRIDSAVSAI 1471

Query: 1479 QRSENLKNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRD 1538
            Q+S+NL N+FNVILAVGNYMND+SKQAQGFKL+TLQRLTFIKD+TNSMTFLNYVEKI+R+
Sbjct: 1472 QKSDNLTNLFNVILAVGNYMNDSSKQAQGFKLNTLQRLTFIKDSTNSMTFLNYVEKIIRE 1531

Query: 1539 NYPSFNDFIDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDK 1598
            NYP FN FI++LEPVLDVVK+SVEQL++DCNEF+QSI+NVERSLEIGNLSDSSKFHP DK
Sbjct: 1532 NYPEFNGFIEELEPVLDVVKISVEQLVNDCNEFTQSIMNVERSLEIGNLSDSSKFHPLDK 1591

Query: 1599 VLTKVLPVLPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITE 1658
            V+TKVLPVLPEA KKS LLTDEVKLT MEFEALM+K+GED+G               I E
Sbjct: 1592 VITKVLPVLPEATKKSDLLTDEVKLTFMEFEALMQKFGEDSGDKFAQNSFFKKFADFINE 1651

Query: 1659 YKKAQSQNLKQEEEERAYEKHKRMIEEQQHK---QDLXXXXXXXXXXXXXXXQSDRRAMM 1715
            YKKA++QNLK EEE R YE+HK+M+EEQQ K   Q+                + D R  M
Sbjct: 1652 YKKARAQNLKAEEEVRKYERHKQMVEEQQRKAKEQEKNYMETGVSDSESAEAKGDNRGHM 1711

Query: 1716 DKLLEKLKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDTGDDSIVYSPNT--- 1772
            DKLL +LKNAGP ++DPSSARKRA++RKKLL++K+ T+ IL D++ GD SI+YSP T   
Sbjct: 1712 DKLLAQLKNAGPARSDPSSARKRAVMRKKLLSEKDSTSVILDDLNAGDGSIIYSPTTDKV 1771

Query: 1773 -PTQEGPNDIHLASPTPSGKSDL------------------------VLASVSPTKESTA 1807
              T  G +++ L SPTP  K +L                          A    T +  +
Sbjct: 1772 VDTSLGEDEMILKSPTPKSKDNLETDNNSDKSRNDTLTVDDVEQNTDTNAETDITDDGNS 1831

Query: 1808 DGIAEDEFISDRAKALLLELRGSEN-MKRNSQLEEQKEKLKARRSRRRT----QTESISS 1862
            +G  EDE I+DRAKALL+ELRGS+   K+NS L++Q+EKL++RR+RRR     ++ S  S
Sbjct: 1832 NGDGEDEVITDRAKALLMELRGSQTPSKKNSHLDDQREKLRSRRNRRRQTFGEESNSTPS 1891

Query: 1863 NKLFFTDEESHSTS 1876
            N+L F  +E+  T+
Sbjct: 1892 NRLTFVSDENSPTA 1905

>YNL271C Chr14 complement(129522..135383) [5862 bp, 1953 aa] {ON}
            BNI1Formin, nucleates the formation of linear actin
            filaments, involved in cell processes such as budding and
            mitotic spindle orientation which require the formation
            of polarized actin cables, functionally redundant with
            BNR1
          Length = 1953

 Score =  932 bits (2409), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 532/1093 (48%), Positives = 679/1093 (62%), Gaps = 43/1093 (3%)

Query: 53   VPKQFTSTELRPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTNNTSHTRAHSSQSATKY 112
             P + TSTE RPLNKKSTLNTQNLSQY++G K+  D P      ++ H R+HS QS  KY
Sbjct: 73   APSRSTSTEARPLNKKSTLNTQNLSQYMNG-KLSGDVPV-----SSQHARSHSMQS--KY 124

Query: 113  SYSRRSSTATGPIKXXXXXXXXXXXXXXXXXXXXYTNLLKYIDSDGKINLEMPRDPHEVE 172
            SYS+R+S+     K                     TNL K+   DGKI LEMP DP+EVE
Sbjct: 125  SYSKRNSSQASN-KLTRQHTGQSHSASSLLSQGSLTNLSKFTTPDGKIYLEMPSDPYEVE 183

Query: 173  ALFEDLMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQNEIKKLMSKSSSYHPTEXX 232
             LFED+MYKRNIFQ+L +DKQ+ LM Y + KKW +VKQDLQNE+KK+ + ++S       
Sbjct: 184  VLFEDIMYKRNIFQSLSEDKQEALMGYSIEKKWLIVKQDLQNELKKMRANTTSSSTASRT 243

Query: 233  XXXXXXXXXXXXXXXXXXXXXXXXQDSNSPQTAIFTSNSGTMQXXXXXXXXXXIPVGGKS 292
                                      ++SP + ++   S ++               GK 
Sbjct: 244  SMASDHHPILTANSSLSSPKSVLMTSASSPTSTVY---SNSLNHSTTLSSVGTSTSKGKK 300

Query: 293  RPVGSSSTASGTNSMIYQSSENNKSVSSIATDRINRPPIHYVKKIIADRLTSEEMNDLWV 352
               GS       N++    +ENN S S++  DR NRPPIHYV++I+AD+LTS+EM DLWV
Sbjct: 301  LVSGSLKKQPSLNNIYRGGAENNTSASTLPGDRTNRPPIHYVQRILADKLTSDEMKDLWV 360

Query: 353  TLRTEQLDWVDAFLEHQGHIAMANVLMNTIYKCAPGSELTPELQEKEHSFFKCFRVLSML 412
            TLRTEQLDWVDAF++HQGHIAMANVLMN+IYK AP   LT EL EKE+SFFKCFRVLSML
Sbjct: 361  TLRTEQLDWVDAFIDHQGHIAMANVLMNSIYKTAPRENLTKELLEKENSFFKCFRVLSML 420

Query: 413  SQGLYEFAKHKLMSDTIANGLFSSRLATRKMATEVLVCMIEKRNNMRFEVVLASLDRYFR 472
            SQGLYEF+ H+LM+DT+A GLFS++LATRKMATE+ VCM+EK+N  RFE VL SLD+ FR
Sbjct: 421  SQGLYEFSTHRLMTDTVAEGLFSTKLATRKMATEIFVCMLEKKNKSRFEAVLTSLDKKFR 480

Query: 473  QEENLNMVHLSKTLPGEYPQSTPNTKYKIIQAWLIALDETLNGRGKMGSLVGASDDYR-S 531
              +NL+M+   K +P  +   T  +  KIIQAWL A+++TL+GRGKMGSLVGASD+++  
Sbjct: 481  IGQNLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFKNG 540

Query: 532  AGENAILEYCLWTMVFINHLCSNSSLLNQRILLRTKLENLGALRIMTKLKRLDYEKLTEQ 591
             GENAILEYC WTMVFINHLCS S  +NQR+LLRTKLEN G LRIM K+K LDY+K+ +Q
Sbjct: 541  GGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGILRIMNKIKLLDYDKVIDQ 600

Query: 592  IELYDNNKLDDFNTVLETESKNSKVNMQNPNSLIENLWESCKGSDNEKXXXXXXXXXXXX 651
            IELYDNNKLDDFN  LE  +K   V++ +P SL++NLW+ CKG++NEK            
Sbjct: 601  IELYDNNKLDDFNVKLEANNKAFNVDLHDPLSLLKNLWDICKGTENEKLLVSLVQHLFLS 660

Query: 652  XXKLMGEKEDPTKLSKQLKLIDSLLTNVN-GSMFDEESHMNLAIQRLYDSMQTDEVARRA 710
              KL+ E ++ +KL+KQLKL+DSL+TNV+  S  DEE++MN+AIQRLYD+MQTDEVARRA
Sbjct: 661  SSKLIEENQNSSKLTKQLKLMDSLVTNVSVASTSDEETNMNMAIQRLYDAMQTDEVARRA 720

Query: 711  ILESRTLTKKLEEAHAERDYLSNKLSNAENGLVGQLESDLKQRDNILEKNQRVMXXXXXX 770
            ILESR LTKKLEE  AERD LS KLS AE+GLVGQLE +L +RD IL KNQRVM      
Sbjct: 721  ILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHERDRILAKNQRVMQQLEAE 780

Query: 771  XXXXXXXXXXXXXXXXXXXXXMLTILNSR---NGTQNPDVDDVTITLDPNKKLDIQKALE 827
                                 MLTILNSR   +  +N     +  +L+ ++K +IQK L+
Sbjct: 781  LEELKKKHLLEKHQQEVELRKMLTILNSRPEESFNKNEGTRGMNSSLNSSEKANIQKVLQ 840

Query: 828  LELNKTKKDLSNDSKRFGITVQPNKRLKMLRMQMEDIENEARQLEMTNFADHKRTNXXXX 887
              L++ KKD  +DSK+FG+T+QPNKRLKMLRMQME+IENEARQLEMTNFA+ ++ +    
Sbjct: 841  DGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEK-DRLEP 899

Query: 888  XXXXXXXXXXXXXXXNTEEFDKENEMKTKKLMQLRKALAAIQSETNDISKFNVEGRVNEM 947
                           + +   K  E    KL  LR+ALA IQ E+NDISKFNVE RVNE+
Sbjct: 900  PIHIKKPKVKKMKNKDRKPLVKPQEADVNKLNDLRRALAEIQMESNDISKFNVEERVNEL 959

Query: 948  FQDXXXXXXXXXXXXXXXYKDFEIPFXX-------XXXXXXXXXXXXXXHSTLDPTYLQK 1000
            F +               YK F I F                       +++LDP   QK
Sbjct: 960  FNEKKSLALKRLKELETKYKGFGIDFNVDEIMDSPKKNTGDVETEEDANYASLDPKTYQK 1019

Query: 1001 KINELDEISDELYLMNYXXXXXXXXXXXXXXXXX------------XXXXXXXXMRSVSN 1048
            K++E++ I+D+L  +                                       +RS  +
Sbjct: 1020 KLDEINRITDQLLDIQTQTEHEIQVEEDGESDLSSSSSDDESEEIYQDASPTQELRSEHS 1079

Query: 1049 APSKGISEAGSFLESLSQKYGTGQNAISSPTSITSPNER----IASQGEKSFMNRLKRQT 1104
              S G S  GSFL++LSQKYGTGQN  +S     + N      + S+ EK+FMNRL++ T
Sbjct: 1080 ELSSG-SGPGSFLDALSQKYGTGQNVTASAAFGENNNGSGIGPLHSKVEKTFMNRLRKST 1138

Query: 1105 M-AAPFLEELTQK 1116
            + +AP+LEELTQK
Sbjct: 1139 VSSAPYLEELTQK 1151

 Score =  751 bits (1938), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 387/629 (61%), Positives = 464/629 (73%), Gaps = 24/629 (3%)

Query: 1254 KSVVDQPSLLQLTN-SDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKGVL 1312
            KS V  P L Q  +  ++ PRP KKLKQLHW+KLD TD+SIW  G AE+FADDLYEKGVL
Sbjct: 1333 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDCTDNSIWGTGKAEKFADDLYEKGVL 1392

Query: 1313 RNLEKAFAAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCD 1372
             +LEKAFAAREIKS+ +++KEDL KI+FLS DISQQFGINLHMY SL+V +L++K+L CD
Sbjct: 1393 ADLEKAFAAREIKSLASKRKEDLQKITFLSRDISQQFGINLHMYSSLSVADLVKKILNCD 1452

Query: 1373 RNLINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQK--------FQRRIQ 1424
            R+ + TPSV+EFL+KSEI+EVSVNLARNYAPY+TDWEGV++L+  K         QR  Q
Sbjct: 1453 RDFLQTPSVVEFLSKSEIIEVSVNLARNYAPYSTDWEGVRNLEDAKPPEKDPNDLQRADQ 1512

Query: 1425 MTYRELIKFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENL 1484
            +       ++  MVNL+SYW SRMRAL V+TSYEREYNEL+ KLRKVDKAV A+Q S+NL
Sbjct: 1513 I-------YLQLMVNLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVSALQESDNL 1565

Query: 1485 KNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRDNYPSFN 1544
            +NVFNVILAVGN+MNDTSKQAQGFKLSTLQRLTFIKD TNSMTFLNYVEKIVR NYPSFN
Sbjct: 1566 RNVFNVILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIVRLNYPSFN 1625

Query: 1545 DFIDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVL 1604
            DF+ +LEPVLDVVK+S+EQL++DC +FSQSIVNVERS+EIGNLSDSSKFHP DKVL K L
Sbjct: 1626 DFLSELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTL 1685

Query: 1605 PVLPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQS 1664
            PVLPEA KK  LL DEVKLTIMEFE+LM  YGED+G               I EYKKAQ+
Sbjct: 1686 PVLPEARKKGDLLEDEVKLTIMEFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQA 1745

Query: 1665 QNLKQEEEERAYEKHKRMIEEQQHK-----QDLXXXXXXXXXXXXXXXQSDRRAMMDKLL 1719
            QNL  EEEER Y KHK+++EEQQ +     +                   DRRA+MDKLL
Sbjct: 1746 QNLAAEEEERLYIKHKKIVEEQQKRAQEKEKQKENSNSPSSEGNEEDEAEDRRAVMDKLL 1805

Query: 1720 EKLKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDTGDDSIVYSPNTPTQEGPN 1779
            E+LKNAGP K+DPSSARKRALVRKK L++K+    +L D+DT + SI+YSP         
Sbjct: 1806 EQLKNAGPAKSDPSSARKRALVRKKYLSEKDNAPQLLNDLDTEEGSILYSPEAMDPTADT 1865

Query: 1780 DIHLASPTPSGKSDLVLASVSPTKESTADGIAEDEFISDRAKALLLELRGSEN-MKRNSQ 1838
             IH  SPTP     ++  S      S    + + E ISDRA+ LL ELRGS+  +K+NS 
Sbjct: 1866 VIHAESPTPLATRGVMNTSEDLPSPSKTSALEDQEEISDRARMLLKELRGSDTPVKQNSI 1925

Query: 1839 LEEQKEKLKARRSRRRTQTESISSNKLFF 1867
            L+E  EKL+AR  + R+  E+ + N+L F
Sbjct: 1926 LDEHLEKLRAR--KERSIGEASTGNRLSF 1952

>Skud_14.69 Chr14 complement(118022..123862) [5841 bp, 1946 aa] {ON}
            YNL271C (REAL)
          Length = 1946

 Score =  929 bits (2400), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/1093 (48%), Positives = 680/1093 (62%), Gaps = 45/1093 (4%)

Query: 54   PKQFTSTELRPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTNNTSHTRAHSSQSATKYS 113
            P + TS E RPLNKKSTLNTQNLSQY+SG K+  D P      ++ H R+HS QS  KYS
Sbjct: 73   PSRTTSIEARPLNKKSTLNTQNLSQYMSG-KMSADVPI-----SSQHARSHSVQS--KYS 124

Query: 114  YSRRSSTATGPIKXXXXXXXXXXXXXXXXXXXXYTNLLKYIDSDGKINLEMPRDPHEVEA 173
            YS+R+S+     K                     TNL K+   DGKI+LEMP DP+EVE 
Sbjct: 125  YSKRNSSQASN-KLTRQHTGQSHSASSLLSQGSLTNLSKFTTPDGKIHLEMPSDPYEVEI 183

Query: 174  LFEDLMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQNEIKKLMSKSSSYHPTEXXX 233
            LFED+MYKRNIFQ+L  DKQ+ LM Y   KKW +VKQDLQNE+KK+ + ++S        
Sbjct: 184  LFEDIMYKRNIFQSLSGDKQEALMGYSTEKKWLIVKQDLQNELKKMRANTTSSSAASRTS 243

Query: 234  XXXXXXXXXXXXXXXXXXXXXXXQDSNSPQTAIFTSNSGTMQXXXXXXXXXXIPVGGKSR 293
                                     ++SP + ++++N   +                K  
Sbjct: 244  VASDHLPILTANSSLSSPKSILMTSASSPTSTVYSNN---LNHSTTLSSAGTSTSKSKKI 300

Query: 294  PVGSSSTASGTNSMIYQSSENNKSVSSIATDRINRPPIHYVKKIIADRLTSEEMNDLWVT 353
              GS       N++    SENN S S++  DR NRPPIHYV++I+AD+LT++EM DLWVT
Sbjct: 301  VTGSLKKQPSLNNIYRGGSENNISASTLPGDRTNRPPIHYVQRILADKLTTDEMKDLWVT 360

Query: 354  LRTEQLDWVDAFLEHQGHIAMANVLMNTIYKCAPGSELTPELQEKEHSFFKCFRVLSMLS 413
            LRTEQLDWVDAF+EHQGHIAMANVLMN++YK AP   LT EL EKE+SFFKCFRVLSMLS
Sbjct: 361  LRTEQLDWVDAFIEHQGHIAMANVLMNSMYKTAPRDNLTKELLEKENSFFKCFRVLSMLS 420

Query: 414  QGLYEFAKHKLMSDTIANGLFSSRLATRKMATEVLVCMIEKRNNMRFEVVLASLDRYFRQ 473
            QGLYEF+ H+LM+DT+A GLFS++LAT+KMATE+ VCM+EK+N  RFE VL +LD+ FR 
Sbjct: 421  QGLYEFSTHRLMTDTVAEGLFSTKLATKKMATEIFVCMLEKKNKSRFEAVLTALDKKFRI 480

Query: 474  EENLNMVHLSKTLPGEYPQSTPNTKYKIIQAWLIALDETLNGRGKMGSLVGASDDYR-SA 532
             +NL+M+   K +P  +   T  +  KIIQAWL A+++TL+GRGKMGSLVGASDD++   
Sbjct: 481  GQNLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDDFKNGG 540

Query: 533  GENAILEYCLWTMVFINHLCSNSSLLNQRILLRTKLENLGALRIMTKLKRLDYEKLTEQI 592
            GENAILEYC WTMVFINHLCS S  +NQR+LLRTKLEN G LRIM K+K LDY+K+ +QI
Sbjct: 541  GENAILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDKVIDQI 600

Query: 593  ELYDNNKLDDFNTVLETESKNSKVNMQNPNSLIENLWESCKGSDNEKXXXXXXXXXXXXX 652
            +LYDNNKLDDFN  LE  ++   V++Q+P SL++NLW  CKG++NEK             
Sbjct: 601  DLYDNNKLDDFNVKLEANNEAFNVDLQDPLSLLKNLWGICKGTENEKLLVSLVQHLFLSS 660

Query: 653  XKLMGEKEDPTKLSKQLKLIDSLLTNVN-GSMFDEESHMNLAIQRLYDSMQTDEVARRAI 711
             KL+ E ++ +KL+KQLKL+DSL+TNV+  S  DEES++N+AIQRLYD+MQTDEVARRAI
Sbjct: 661  SKLIEENQNSSKLTKQLKLMDSLVTNVSIASAADEESNLNMAIQRLYDAMQTDEVARRAI 720

Query: 712  LESRTLTKKLEEAHAERDYLSNKLSNAENGLVGQLESDLKQRDNILEKNQRVMXXXXXXX 771
            LESR LTKKLEE  AERD LS KLS AE+GLVGQLE +L +RD+IL KNQRVM       
Sbjct: 721  LESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHERDHILAKNQRVMQQLESEL 780

Query: 772  XXXXXXXXXXXXXXXXXXXXMLTILNSRNGTQNPDVDDVTITLDP----NKKLDIQKALE 827
                                MLTILNSR   ++ D+++ T  +DP    ++K +IQK L+
Sbjct: 781  EELKKKHLLEKHQQEVELRKMLTILNSR-PEESSDINEGTRNIDPSLNFSEKANIQKVLQ 839

Query: 828  LELNKTKKDLSNDSKRFGITVQPNKRLKMLRMQMEDIENEARQLEMTNFADHKRTNXXXX 887
              L++ KKD  +DSK+FG+T+QPNKRLKMLRMQME+IENEARQLEMTNFA+ ++      
Sbjct: 840  DGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEK-ERLEP 898

Query: 888  XXXXXXXXXXXXXXXNTEEFDKENEMKTKKLMQLRKALAAIQSETNDISKFNVEGRVNEM 947
                           +     +  E    KL  LR+ALA IQ E+N+ISKFNVE RVNE+
Sbjct: 899  PIQIKKPKLKKNKHKDKNFLARAQEADMNKLNDLRRALADIQMESNNISKFNVEERVNEL 958

Query: 948  FQDXXXXXXXXXXXXXXXYKDFEIPFXXXXXXXXXXXXXX-------XXHSTLDPTYLQK 1000
            F +               YK F I F                       +S+LDP   QK
Sbjct: 959  FNEKKSLALKRLKELETKYKGFGIDFNVEKIMESPKKLSVADEREGDARYSSLDPKAYQK 1018

Query: 1001 KINELDEISDELYLM------------NYXXXXXXXXXXXXXXXXXXXXXXXXXMRSVSN 1048
            K++E++ I+DEL  +            N                          +RS ++
Sbjct: 1019 KLDEINRITDELLDLQTQTKQETKEEENGKSSFSSSSSDADDDEVYQDASPTHEIRSENS 1078

Query: 1049 APSKGISEAGSFLESLSQKYGTGQNAISSP----TSITSPNERIASQGEKSFMNRLKRQT 1104
              S G S  GSFL++LSQKYGTGQN  +S     +   S      S+ EK+FMNRLKR T
Sbjct: 1079 ELSAG-SGPGSFLDALSQKYGTGQNVTASAGLRDSGYVSGLGHTPSKVEKTFMNRLKRST 1137

Query: 1105 M-AAPFLEELTQK 1116
            + +AP+LEELTQK
Sbjct: 1138 VNSAPYLEELTQK 1150

 Score =  753 bits (1943), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 391/629 (62%), Positives = 467/629 (74%), Gaps = 24/629 (3%)

Query: 1254 KSVVDQPSLLQLTN-SDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKGVL 1312
            KS V  P L Q  +  ++ PRP KKLKQLHW+KLDSTD+SIW  G AE+FADDLYEKGVL
Sbjct: 1326 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGSGKAEKFADDLYEKGVL 1385

Query: 1313 RNLEKAFAAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCD 1372
             +LEKAFAAREIKS+ T++KEDL KI+FLS DISQQFGINLHMY SL+VP+L++KVL CD
Sbjct: 1386 ADLEKAFAAREIKSLATKRKEDLQKITFLSRDISQQFGINLHMYSSLSVPDLVKKVLNCD 1445

Query: 1373 RNLINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQK--------FQRRIQ 1424
            R+ + TPSV+EFL+K+EI+EVSVNLARNYAPY+TDWEGV++L   K         QR  Q
Sbjct: 1446 RDFLQTPSVVEFLSKTEIIEVSVNLARNYAPYSTDWEGVRNLDDAKPPEKDPNDLQRADQ 1505

Query: 1425 MTYRELIKFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENL 1484
            +       ++  M+NL+SYW SRMRAL V+TSYEREYNEL+ KLRKVDKAVGA+Q S+NL
Sbjct: 1506 V-------YLQLMINLESYWGSRMRALTVVTSYEREYNELLAKLRKVDKAVGALQGSDNL 1558

Query: 1485 KNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRDNYPSFN 1544
            +NVFNVILAVGN+MNDTSKQAQGFKLSTLQRLTFIKD TNSMTFLNYVEKI+R NYP+FN
Sbjct: 1559 RNVFNVILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTTNSMTFLNYVEKIIRLNYPNFN 1618

Query: 1545 DFIDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVL 1604
            DF+ +LEPVLDVVK+S+EQL++DC +FSQSIVNVERS+EIGNLSDSSKFHP DKVL K L
Sbjct: 1619 DFLKELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTL 1678

Query: 1605 PVLPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQS 1664
            PVLPEA +K  LL DEVKLTIMEFE+LM+ YGED+G               I EYKKAQ+
Sbjct: 1679 PVLPEARRKGDLLKDEVKLTIMEFESLMQTYGEDSGDKFAKISFFKKFADFINEYKKAQA 1738

Query: 1665 QNLKQEEEERAYEKHKRMIEEQQHKQDLXXXXXXXXXX-----XXXXXQSDRRAMMDKLL 1719
            QNL  EEEER YEKHK+++EEQQ K                         DRR +MDKLL
Sbjct: 1739 QNLAGEEEERLYEKHKKLVEEQQKKAQEKEKQKERSASPSPEGNEEDEAEDRRDVMDKLL 1798

Query: 1720 EKLKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDTGDDSIVYSPNTPTQEGPN 1779
            E+LKNAGP K DPSSARKRALVRKK L+DK+    +L D+D  + SI+YSP   T +   
Sbjct: 1799 EQLKNAGPAKTDPSSARKRALVRKKYLSDKDSAPQLLNDLDNEEGSILYSPEATTPDTYT 1858

Query: 1780 DIHLASPTPSGKSDLVLASVSPTKESTADGIAEDEFISDRAKALLLELRGSE-NMKRNSQ 1838
             +H  SPTP     L+         S A  + + E ISDRA+ LL ELRGSE ++K+NS 
Sbjct: 1859 AVHAESPTPLATRGLMNTPEDLPSPSKAPALEDQEEISDRARMLLKELRGSEISVKQNST 1918

Query: 1839 LEEQKEKLKARRSRRRTQTESISSNKLFF 1867
            L+E  EKL+AR+ R  ++T   + NKL F
Sbjct: 1919 LDEHLEKLRARKERASSETN--TGNKLSF 1945

>Smik_14.66 Chr14 complement(108587..114445) [5859 bp, 1952 aa] {ON}
            YNL271C (REAL)
          Length = 1952

 Score =  928 bits (2398), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/1093 (48%), Positives = 682/1093 (62%), Gaps = 49/1093 (4%)

Query: 54   PKQFTSTELRPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTNNTSHTRAHSSQSATKYS 113
            P +  STE RPLNKKSTLNTQNLSQY++G KI  D P      ++ H R+HS QS  KYS
Sbjct: 75   PSRSISTEARPLNKKSTLNTQNLSQYMNG-KISADVPV-----SSQHARSHSMQS--KYS 126

Query: 114  YSRRSSTATGPIKXXXXXXXXXXXXXXXXXXXXYTNLLKYIDSDGKINLEMPRDPHEVEA 173
            YS+R+S+     K                     TNL K+   DGKI+LEMP DP+EVE 
Sbjct: 127  YSKRNSSQASN-KLTRQHTGQSHSVSSLLSQGSLTNLSKFTTPDGKIHLEMPSDPYEVEV 185

Query: 174  LFEDLMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQNEIKKLMSKSSSYHPTEXXX 233
            LFED+MYKRNIFQ+L  DKQ+ LMSY   KKW +VKQDLQNE+KKL + ++S        
Sbjct: 186  LFEDIMYKRNIFQSLSGDKQEALMSYSTEKKWLIVKQDLQNELKKLRANTTSSSTASRTS 245

Query: 234  XXXXXXXXXXXXXXXXXXXXXXXQDSNSPQTAIFTS---NSGTMQXXXXXXXXXXIPVGG 290
                                     ++SP + ++++   +S T+             +GG
Sbjct: 246  IASDHHPILTANSSLSSPKSVLMTSASSPTSTVYSNSLNHSTTLSSVGTSTSKSKKLMGG 305

Query: 291  --KSRPVGSSSTASGTNSMIYQSSENNKSVSSIATDRINRPPIHYVKKIIADRLTSEEMN 348
              K +P          N++    SENN S S++  DR NRPPIHYV++I+AD+LT++EM 
Sbjct: 306  SLKKQP--------SLNNIYRGGSENNTSASTLPGDRTNRPPIHYVQRILADKLTTDEMK 357

Query: 349  DLWVTLRTEQLDWVDAFLEHQGHIAMANVLMNTIYKCAPGSELTPELQEKEHSFFKCFRV 408
            DLWVTLRTEQLDWVDAF++HQGHIAMANVLMN+IYK AP   LT EL EKE+SFFKCFRV
Sbjct: 358  DLWVTLRTEQLDWVDAFIDHQGHIAMANVLMNSIYKTAPRDSLTKELLEKENSFFKCFRV 417

Query: 409  LSMLSQGLYEFAKHKLMSDTIANGLFSSRLATRKMATEVLVCMIEKRNNMRFEVVLASLD 468
            LSMLSQGLYEF+ H+LM+DT+A GLFS+RLATRKMATE+ VCM+EK+N  RFE VL +LD
Sbjct: 418  LSMLSQGLYEFSTHRLMTDTVAEGLFSTRLATRKMATEIFVCMLEKKNKSRFEAVLTALD 477

Query: 469  RYFRQEENLNMVHLSKTLPGEYPQSTPNTKYKIIQAWLIALDETLNGRGKMGSLVGASDD 528
            + FR  +NL+M+   K +P  +   T  +  KIIQAWL A+++TL+GRGKMGSLVGASD+
Sbjct: 478  KKFRIGQNLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDE 537

Query: 529  YR-SAGENAILEYCLWTMVFINHLCSNSSLLNQRILLRTKLENLGALRIMTKLKRLDYEK 587
            ++   GENAILEYC WTMVFINHLCS S  +NQR+LLRTKLEN G LRIM K+K LDY+K
Sbjct: 538  FKNGGGENAILEYCQWTMVFINHLCSCSDNINQRMLLRTKLENCGVLRIMNKIKLLDYDK 597

Query: 588  LTEQIELYDNNKLDDFNTVLETESKNSKVNMQNPNSLIENLWESCKGSDNEKXXXXXXXX 647
            + +QIELYDNNKLDDFN  LE  +K   V++Q+P SL++NLW+ CKG++NEK        
Sbjct: 598  VMDQIELYDNNKLDDFNVRLEANNKAFNVDLQDPLSLLKNLWDICKGTENEKLLVSLVQH 657

Query: 648  XXXXXXKLMGEKEDPTKLSKQLKLIDSLLTNVN-GSMFDEESHMNLAIQRLYDSMQTDEV 706
                  KL+ E ++P+KL+KQLK++DSL+T+V+  S  DEES+MN+AIQRLYD+MQTDEV
Sbjct: 658  LFLSSSKLIEENQNPSKLTKQLKVMDSLVTSVSIASTSDEESNMNMAIQRLYDAMQTDEV 717

Query: 707  ARRAILESRTLTKKLEEAHAERDYLSNKLSNAENGLVGQLESDLKQRDNILEKNQRVMXX 766
            ARRAILESR LTKKLEE  AERD LS KLS AE+GLVGQLE +L  RD IL KNQRVM  
Sbjct: 718  ARRAILESRALTKKLEEIQAERDSLSEKLSKAEHGLVGQLEDELHGRDRILAKNQRVMQQ 777

Query: 767  XXXXXXXXXXXXXXXXXXXXXXXXXMLTILNSR---NGTQNPDVDDVTITLDPNKKLDIQ 823
                                     MLTILNSR   N + N  +     +L+ ++K +IQ
Sbjct: 778  LEAELEELKKKHLLEKHQQEVELRKMLTILNSRPEENSSINEGIRGKNSSLNSSEKANIQ 837

Query: 824  KALELELNKTKKDLSNDSKRFGITVQPNKRLKMLRMQMEDIENEARQLEMTNFADHKRTN 883
            K L+  L++ KKD  +DSK+FG+T+QPNKRLKMLRMQME+IENEARQLEMTNFA+ ++ +
Sbjct: 838  KVLQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEK-D 896

Query: 884  XXXXXXXXXXXXXXXXXXXNTEEFDKENEMKTKKLMQLRKALAAIQSETNDISKFNVEGR 943
                               + +   +  E+   KL  LR+ALA IQ E+NDISKFNVE R
Sbjct: 897  HLEPPIQIKKPKLKKIKHKDKKLISRPQEVDMNKLNDLRRALAEIQMESNDISKFNVEER 956

Query: 944  VNEMFQDXXXXXXXXXXXXXXXYKDFEIPFXX-------XXXXXXXXXXXXXXHSTLDPT 996
            VNE+F +               YK F I F                       +S+LDP 
Sbjct: 957  VNELFNEKKSLALKRLKELETKYKGFGIDFNVEEIMESPKKNSANERKEDGANYSSLDPR 1016

Query: 997  YLQKKINELDEISDELYLMNYXXXXXXXXXXXXXXXXXXXXXX--------XXXMRSVSN 1048
              Q K++E++ I+D+L  +                                   +RS  N
Sbjct: 1017 TYQNKLDEINRITDQLLDLQAQTKQDDGGVSSLSSSSSSAEGEDVYQDAFPAQEVRS-EN 1075

Query: 1049 APSKGISEAGSFLESLSQKYGTGQNAISS----PTSITSPNERIASQGEKSFMNRLKRQT 1104
            +     S +GSFL++LSQKYGTGQN   S     +   S    + S+ EK+FMN+L++ T
Sbjct: 1076 SELSVESGSGSFLDALSQKYGTGQNNTVSVGLRDSDYVSVIGHMPSKVEKTFMNKLRKST 1135

Query: 1105 M-AAPFLEELTQK 1116
              +AP+LEELTQK
Sbjct: 1136 ASSAPYLEELTQK 1148

 Score =  762 bits (1967), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 397/632 (62%), Positives = 472/632 (74%), Gaps = 30/632 (4%)

Query: 1254 KSVVDQPSLLQLTN-SDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKGVL 1312
            KS V  P L Q  +  ++ PRP KKLKQLHW+KLDSTD+SIW  G AE+FADDLYEKGVL
Sbjct: 1332 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKLDSTDNSIWGTGKAEKFADDLYEKGVL 1391

Query: 1313 RNLEKAFAAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCD 1372
             +LEKAFAAREIKS+ T++KEDL KI+FLS DISQQFGINLHMY SL+V +L++K+L CD
Sbjct: 1392 ADLEKAFAAREIKSLATKRKEDLKKITFLSRDISQQFGINLHMYSSLSVTDLVKKILNCD 1451

Query: 1373 RNLINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQK--------FQRRIQ 1424
            R+ + TPSV+EFL+K EI+EVSVNLARNYAPY+TDWEGVK+LK  K         QR  Q
Sbjct: 1452 RDFLQTPSVVEFLSKPEIIEVSVNLARNYAPYSTDWEGVKNLKDAKPPEKDPNDLQRADQ 1511

Query: 1425 MTYRELIKFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENL 1484
            +       ++  MVNL+SYW SRMRAL V+TSYE+EYNEL+TKLRKVDKAVGA+Q S+NL
Sbjct: 1512 I-------YLQLMVNLESYWGSRMRALIVVTSYEKEYNELLTKLRKVDKAVGALQESDNL 1564

Query: 1485 KNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRDNYPSFN 1544
            +NVFNVILAVGN+MNDTSKQAQGFKLSTLQRLTFIKD  NSMTFLNYVEKI+R NYPSFN
Sbjct: 1565 RNVFNVILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFN 1624

Query: 1545 DFIDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVL 1604
            DF+ +LEPVLDVVK+S+EQL++DC +FSQSIVNVERS+EIGNLSDSSKFHP DK+L K L
Sbjct: 1625 DFLKELEPVLDVVKVSIEQLVNDCRDFSQSIVNVERSVEIGNLSDSSKFHPLDKILIKTL 1684

Query: 1605 PVLPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQS 1664
            PVLPEA KK  LL DEVKLTIMEFE+LM  YGED+G               I EYKKAQS
Sbjct: 1685 PVLPEARKKGDLLEDEVKLTIMEFESLMHTYGEDSGDKFAKISFFKKFADFINEYKKAQS 1744

Query: 1665 QNLKQEEEERAYEKHKRMIEEQQHK-----QDLXXXXXXXXXXXXXXXQSDRRAMMDKLL 1719
            QNL  EEEER YEKHK+++EEQQ +     +                   DRRA+MDKLL
Sbjct: 1745 QNLAAEEEERIYEKHKKIVEEQQKRAQEREKQKENSNSSSSEGNEEDEAEDRRAVMDKLL 1804

Query: 1720 EKLKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDTGDDSIVYSPNTPTQEGPN 1779
            E+LKNAGPGK+DPSSARKRALVRK+ L+DK+ +  +L D+D  + SI+YSP     +   
Sbjct: 1805 EQLKNAGPGKSDPSSARKRALVRKRYLSDKDNSQQLLNDLDNEEGSILYSPEALDPDADA 1864

Query: 1780 DIHLASPTP---SGKSDLVLASVSPTKESTADGIAEDEFISDRAKALLLELRGSEN-MKR 1835
             IH  SPTP    G  ++     SP+K ST   + + E ISDRAK LL ELRGS+  +K+
Sbjct: 1865 VIHAESPTPLTTRGTLNIPEDLPSPSKAST---LEDQEEISDRAKMLLKELRGSDTPVKQ 1921

Query: 1836 NSQLEEQKEKLKARRSRRRTQTESISSNKLFF 1867
            NS L+E  EKL+AR  + RT  E  + NKL F
Sbjct: 1922 NSILDEHLEKLRAR--KERTIGEGSAGNKLSF 1951

>Suva_14.71 Chr14 complement(124082..126073,126104..129958) [5847 bp,
            1948 aa] {ON} YNL271C (REAL)
          Length = 1948

 Score =  927 bits (2396), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 534/1089 (49%), Positives = 669/1089 (61%), Gaps = 39/1089 (3%)

Query: 54   PKQFTSTELRPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTNNTSHTRAHSSQSATKYS 113
            P + TSTE RPLNKK+TLNTQNLSQY++G KI  D P      ++ H R+HS QS  KYS
Sbjct: 74   PSRSTSTEARPLNKKATLNTQNLSQYMNG-KISTDAPT-----SSQHARSHSVQS--KYS 125

Query: 114  YSRRSSTATGPIKXXXXXXXXXXXXXXXXXXXXYTNLLKYIDSDGKINLEMPRDPHEVEA 173
            YS+R+S+     K                     TNL K+   DGKI+LEMP DP+EVE 
Sbjct: 126  YSKRTSSQASN-KLTRQHTGQSHSATSLLSLGSLTNLSKFTTPDGKIHLEMPSDPYEVEV 184

Query: 174  LFEDLMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQNEIKKLMSKSSSYHPTEXXX 233
            LFED+MYKRNIFQ+L  DKQ+ELMSY   KKW +VKQDLQNE+KK+ + ++S        
Sbjct: 185  LFEDIMYKRNIFQSLSGDKQEELMSYSTEKKWLIVKQDLQNELKKIRANTTSSSAASRTS 244

Query: 234  XXXXXXXXXXXXXXXXXXXXXXXQDSNSPQTAIFTSNSGTM-QXXXXXXXXXXIPVG--G 290
                                     ++SP + ++   S T+             P G   
Sbjct: 245  IASDQHPILTANSTLSSPKSALMTSASSPTSTVY---SNTLNHSTTLSSVGTSTPKGHNN 301

Query: 291  KSRPVGSSSTASGTNSMIYQSSENNKSVSSIATDRINRPPIHYVKKIIADRLTSEEMNDL 350
            K    G        NS+     E N S S++  DR NRPPIHYV++I+AD+LT++EM DL
Sbjct: 302  KKTIAGGLKKQPSLNSIYRGGPEINTSASTLPGDRTNRPPIHYVQRILADKLTTDEMKDL 361

Query: 351  WVTLRTEQLDWVDAFLEHQGHIAMANVLMNTIYKCAPGSELTPELQEKEHSFFKCFRVLS 410
            WVTLRTEQLDWVDAF++HQGHIAMANVLMN+IYK AP   LT EL EKE+SFFKCFRVLS
Sbjct: 362  WVTLRTEQLDWVDAFIDHQGHIAMANVLMNSIYKTAPREHLTKELLEKENSFFKCFRVLS 421

Query: 411  MLSQGLYEFAKHKLMSDTIANGLFSSRLATRKMATEVLVCMIEKRNNMRFEVVLASLDRY 470
            MLSQGLYEF+ H+LM+DT+A GLFS++L TRKMATE+ VCM+EK+N  RFE VL +LD+ 
Sbjct: 422  MLSQGLYEFSTHRLMTDTVAEGLFSTKLVTRKMATEIFVCMLEKKNKNRFEAVLTALDKK 481

Query: 471  FRQEENLNMVHLSKTLPGEYPQSTPNTKYKIIQAWLIALDETLNGRGKMGSLVGASDDYR 530
            FR  +NL+M+   K +P  +   T  +  KIIQAWL A+++TL+GRGKMGSLVGASD+++
Sbjct: 482  FRIGQNLHMIQNFKKMPQYFSHLTLESHLKIIQAWLFAVEQTLDGRGKMGSLVGASDEFK 541

Query: 531  -SAGENAILEYCLWTMVFINHLCSNSSLLNQRILLRTKLENLGALRIMTKLKRLDYEKLT 589
               GENAILEYC WTMVFINHLCS S  +NQR+LLRTKLEN G LRIM K+K LDY+K+ 
Sbjct: 542  NGGGENAILEYCQWTMVFINHLCSCSDNVNQRMLLRTKLENCGILRIMNKIKLLDYDKVI 601

Query: 590  EQIELYDNNKLDDFNTVLETESKNSKVNMQNPNSLIENLWESCKGSDNEKXXXXXXXXXX 649
            +QIELYDNNKLDDFN  LE  +K   V++++P SL++NLWE CKG+DNEK          
Sbjct: 602  DQIELYDNNKLDDFNVKLEASNKAFNVDLKDPLSLLKNLWEICKGTDNEKLLVSLVQHLF 661

Query: 650  XXXXKLMGEKEDPTKLSKQLKLIDSLLTNVN-GSMFDEESHMNLAIQRLYDSMQTDEVAR 708
                KL+ E ++P+KLSKQLKL+DSL+TNV+  S  DEES+MN+AIQRLYD+MQTDEVAR
Sbjct: 662  LSSSKLIEENQNPSKLSKQLKLMDSLVTNVSVASTADEESNMNMAIQRLYDAMQTDEVAR 721

Query: 709  RAILESRTLTKKLEEAHAERDYLSNKLSNAENGLVGQLESDLKQRDNILEKNQRVMXXXX 768
            RAILESRTLTKKLEE  AERD LS KL  AE+GLVGQLE++L  RD IL KNQRVM    
Sbjct: 722  RAILESRTLTKKLEEIQAERDSLSEKLGKAEHGLVGQLENELHGRDRILAKNQRVMQQLE 781

Query: 769  XXXXXXXXXXXXXXXXXXXXXXXMLTILNSR---NGTQNPDVDDVTITLDPNKKLDIQKA 825
                                   MLTILNSR   +   +    D+  +L+ ++K +IQK 
Sbjct: 782  SELEELKKKHLLEKHQQEVELRKMLTILNSRPEESSDLSKGTKDINPSLNSSEKANIQKV 841

Query: 826  LELELNKTKKDLSNDSKRFGITVQPNKRLKMLRMQMEDIENEARQLEMTNFADHKRTNXX 885
            L+  L++ KKD  +DSK+FG+T+QPNKRLKMLRMQME+IENEARQLEMTNFA+ ++    
Sbjct: 842  LQDGLSRAKKDYKDDSKKFGMTLQPNKRLKMLRMQMENIENEARQLEMTNFAEFEKERLE 901

Query: 886  XXXXXXXXXXXXXXXXXNTEEFDKENEMKTKKLMQLRKALAAIQSETNDISKFNVEGRVN 945
                                   K       KL  LR+ALA IQ E+NDISKFNVE RVN
Sbjct: 902  PPIEIKKPKIKHKKHKIKKSSV-KTQGADMNKLNDLRRALAEIQMESNDISKFNVEERVN 960

Query: 946  EMFQDXXXXXXXXXXXXXXXYKDFEIPFXXXX-----XXXXXXXXXXXXHSTLDPTYLQK 1000
            E+F +               YK F I F                     + +LDP   Q 
Sbjct: 961  ELFNEKKSLALKRLKELETKYKGFGIDFNVEEFIETPKKFSVDEENDAAYPSLDPKAYQS 1020

Query: 1001 KINELDEISDELYLMNYXXXXXXXXXXXXXXXXXXXXXXXXXMRSVSNA-PSK------- 1052
            K++E++ I+DEL  +                                +A PS+       
Sbjct: 1021 KLDEINRITDELLDLQTQVKQETEEDEDEETKSSSSSSDADDDEIYQDASPSQERRGEYS 1080

Query: 1053 ---GISEAGSFLESLSQKYGTGQNAISSPT-SITSPNERIASQGEKSFMNRLKRQTM-AA 1107
                 S  GSFL++LSQKYGTGQN  +S        +  + S  EKSF+NRL++ T  +A
Sbjct: 1081 ELSAGSGPGSFLDALSQKYGTGQNVTASAGLRDNRGSGHMPSNVEKSFINRLRKSTASSA 1140

Query: 1108 PFLEELTQK 1116
            P+LEELTQK
Sbjct: 1141 PYLEELTQK 1149

 Score =  753 bits (1944), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/627 (60%), Positives = 466/627 (74%), Gaps = 22/627 (3%)

Query: 1254 KSVVDQPSLLQLTN-SDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKGVL 1312
            KS V  P L Q  +  ++ PRP KKLKQLHW+K+DSTD+SIW  G AE+FADDLYEKGVL
Sbjct: 1330 KSAVTSPLLPQSPSLFEKYPRPHKKLKQLHWEKIDSTDNSIWGSGKAEKFADDLYEKGVL 1389

Query: 1313 RNLEKAFAAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCD 1372
             +LEKAFAAREIKS+ T++KEDL K++FLS DISQQFGINLHMY SL+V +L++K+LKCD
Sbjct: 1390 ADLEKAFAAREIKSLATKRKEDLQKVTFLSRDISQQFGINLHMYSSLSVADLVKKILKCD 1449

Query: 1373 RNLINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQK--------FQRRIQ 1424
            R+ + TPSV+EFL+K EI EVSVNLARNYAPY+TDWEG++ L+  K         QR  Q
Sbjct: 1450 RDFLQTPSVVEFLSKPEITEVSVNLARNYAPYSTDWEGIRDLEDAKPPEKDPNDLQRADQ 1509

Query: 1425 MTYRELIKFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENL 1484
            +       ++  MVNL+ YW SRMRAL V+TSYE+EYNEL+ KLRKVD+AVGA+Q S+NL
Sbjct: 1510 I-------YLQLMVNLEQYWGSRMRALTVVTSYEKEYNELLAKLRKVDRAVGALQESDNL 1562

Query: 1485 KNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRDNYPSFN 1544
            +NVFNVILAVGN+MNDTSKQAQGFKLSTLQRLTFIKD  NSMTFLNYVEKI+R NYPSFN
Sbjct: 1563 RNVFNVILAVGNFMNDTSKQAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIRLNYPSFN 1622

Query: 1545 DFIDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVL 1604
            DF+ +LEPVLDVVK+S+EQL++DC +FSQSIVNVERS+EIGNLSDSSKFHP DKVL K L
Sbjct: 1623 DFLKELEPVLDVVKVSIEQLVNDCKDFSQSIVNVERSVEIGNLSDSSKFHPLDKVLIKTL 1682

Query: 1605 PVLPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQS 1664
            PVLPEA +K  LL DEVKLTIMEFE+LM+ YGED+G               + EYK+AQS
Sbjct: 1683 PVLPEARRKGDLLEDEVKLTIMEFESLMQTYGEDSGDKFAKISFFKKFADFVNEYKRAQS 1742

Query: 1665 QNLKQEEEERAYEKHKRMIEEQQHK---QDLXXXXXXXXXXXXXXXQSDRRAMMDKLLEK 1721
            QNL  EEEER YEKHK+M+EEQQ +   ++                  DRRA+MDKLLE+
Sbjct: 1743 QNLAAEEEERLYEKHKKMVEEQQKRAQDKEKHREHSALPEGNEEEETEDRRAVMDKLLEQ 1802

Query: 1722 LKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDTGDDSIVYSPNTPTQEGPNDI 1781
            LKNAGP K+DPSSARKRALVRKK ++DK+ +A +L D++  + SI+YSP   T +    I
Sbjct: 1803 LKNAGPAKSDPSSARKRALVRKKYISDKDNSAQVLNDLNDEEGSILYSPEATTPDTDTVI 1862

Query: 1782 HLASPTPSGKSDLVLASVSPTKESTADGIAEDEFISDRAKALLLELRGSEN-MKRNSQLE 1840
            H  SPTP      +         S A  + + E I+DRA+ LL ELRGS+  +K+NS L+
Sbjct: 1863 HAESPTPLATRGFMNTPEDLPSPSKASALEDQEEITDRARMLLKELRGSDAPVKQNSILD 1922

Query: 1841 EQKEKLKARRSRRRTQTESISSNKLFF 1867
            E  EKL+AR+ R   +T   + NKL F
Sbjct: 1923 EHLEKLRARKERANGETN--TGNKLSF 1947

>TDEL0C06190 Chr3 (1122358..1127997) [5640 bp, 1879 aa] {ON} Anc_1.82
            YNL271C
          Length = 1879

 Score =  919 bits (2374), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 523/1105 (47%), Positives = 676/1105 (61%), Gaps = 85/1105 (7%)

Query: 43   ADISSPKKPIVPKQFT-STELRPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTNNTSHT 101
            +DISSP+K  VP + + + +LRPLNKKST+NTQNLS Y++G    + +   L +N   H+
Sbjct: 49   SDISSPRKVSVPSRVSNANDLRPLNKKSTMNTQNLSHYMNG----KSSAESLSSN---HS 101

Query: 102  RAHSSQSATKYSYSRRSST--ATGPIKXXXXX--XXXXXXXXXXXXXXXYTNLLKYIDSD 157
            R+ S QS+TKY+YSRRSS+  +T  +                       ++NL  ++  D
Sbjct: 102  RSPSVQSSTKYTYSRRSSSHLSTPGVNSTLTREPTNQSLSSSSVLSQDSFSNLAIFMTPD 161

Query: 158  GKINLEMPRDPHEVEALFEDLMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQNEIK 217
            GKI L+MP   HEVE LFED+MYKRNI Q L  DKQKELM YDV KKW +VKQDLQN+ K
Sbjct: 162  GKIKLDMP-SSHEVENLFEDMMYKRNILQNLSPDKQKELMDYDVDKKWLIVKQDLQNDFK 220

Query: 218  KLMSKSSSYHPTEXXXXXXXXXXXXXXXXXXXXXXXXXXQDSNSPQTAIFTSNSGTMQXX 277
            KL++K     P                             +S         +N+G+    
Sbjct: 221  KLLAKGV---PAAHAAISSSNSDSLPSSLKVSSPRSSMTYESIQQAIKFNKTNNGS---- 273

Query: 278  XXXXXXXXIPVGGKSRPVGSSSTASGTNSMIYQSSENNKSVSSIATDRINRPPIHYVKKI 337
                               SS  AS   S + Q S+ N S S++ T++INRPPIHYVK+I
Sbjct: 274  -------------------SSGPASNNKSKLQQLSDKNSSTSTLTTEKINRPPIHYVKRI 314

Query: 338  IADRLTSEEMNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMNTIYKCAPGSELTPELQE 397
            IAD+LT  EMNDLWVTLRTEQLDWVD FLEHQGHIAMANVL  +IYK  P + L+ +L E
Sbjct: 315  IADKLTGNEMNDLWVTLRTEQLDWVDGFLEHQGHIAMANVLTTSIYKTDPETPLSYDLLE 374

Query: 398  KEHSFFKCFRVLSMLSQGLYEFAKHKLMSDTIANGLFSSRLATRKMATEVLVCMIEKRNN 457
            KEH+FF+CFRVLS+L+QGLYE ++H +M++T+ANGLFS RLATRKMATE+ VCM+EK+N 
Sbjct: 375  KEHAFFRCFRVLSVLTQGLYELSRHNIMAETVANGLFSVRLATRKMATEIFVCMLEKKNK 434

Query: 458  MRFEVVLASLDRYFRQEENLNMVHLSKTLPGEYPQSTPNTKYKIIQAWLIALDETLNGRG 517
            +RFE VL +LD+ F+  ENL+M+H  K  P  +   T ++++KI+Q+WL A++++L GRG
Sbjct: 435  VRFEAVLNALDKKFKIGENLHMLHYMKNSPQHFSHFTRDSQFKIVQSWLFAVEQSLEGRG 494

Query: 518  KMGSLVGASDDYR-SAGENAILEYCLWTMVFINHLCSNSSLLNQRILLRTKLENLGALRI 576
            KMGSLVGAS+D++ S GENAILEY  WTMVFINH C+ + ++NQRILLRT+LEN G LRI
Sbjct: 495  KMGSLVGASEDFKASGGENAILEYSQWTMVFINHFCNGTDVINQRILLRTRLENAGGLRI 554

Query: 577  MTKLKRLDYEKLTEQIELYDNNKLDDFNTVLETESKNSKVNMQNPNSLIENLWESCKGSD 636
            M + K LDY+K+ E +E Y+N KLDD N+VLET +  S ++M +  SL++ L++ CKG++
Sbjct: 555  MNQFKLLDYDKVMELVEAYENLKLDDLNSVLETGAHASDIDMNDSASLLKKLFDYCKGTE 614

Query: 637  NEKXXXXXXXXXXXXXXKLMGEKEDPTKLSKQLKLIDSLLTNVNGSMFDEESHMNLAIQR 696
            +EK              +LM + +DPTKLSKQL+L+DSL+TNV+ S  DE S +N+AIQR
Sbjct: 615  SEKLLNSLVKHLFLSTSRLMEDNQDPTKLSKQLRLMDSLVTNVSVSAVDESSSINMAIQR 674

Query: 697  LYDSMQTDEVARRAILESRTLTKKLEEAHAERDYLSNKLSNAENGLVGQLESDLKQRDNI 756
            LYDSMQTDEVARRAILESRTLTKKLEEA AERD+LS KLS   NGLVGQLE +++QRD+I
Sbjct: 675  LYDSMQTDEVARRAILESRTLTKKLEEAQAERDFLSQKLSKTGNGLVGQLEKEVQQRDDI 734

Query: 757  LEKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXXXMLTILNSR-----------NGTQNP 805
            LEKNQRV                            MLTILNSR           +    P
Sbjct: 735  LEKNQRVTLQLQDELEELKKKHLLEKHEHEVELRKMLTILNSRPEGDLSRKGSVHSKAQP 794

Query: 806  DVDDVTITLDPNKKLDIQKALELELNKTKKDLSNDSKRFGITVQPNKRLKMLRMQMEDIE 865
             +      LDP+KK  IQ+AL+  L KTKKDLS DSKRFGITVQPNKRLKMLR+QMEDIE
Sbjct: 795  GI------LDPDKKSTIQQALQDGLLKTKKDLSVDSKRFGITVQPNKRLKMLRLQMEDIE 848

Query: 866  NEARQLEMTNFADHKRTNXXXXXXXXXXXXXXXXXXXNTEEFDKENEMKTK-----KLMQ 920
             EAR+LEMTNFADH +                     ++    KENE++ K     KL +
Sbjct: 849  QEARELEMTNFADHNKA-----------VLQAPVKVESSNYVRKENELRAKELKANKLSE 897

Query: 921  LRKALAAIQSETNDISKFNVEGRVNEMFQDXXXXXXXXXXXXXXXYKDFEI------PFX 974
            LRKALA IQ E+N +SKFNVE RVNE+F+                YK++ I      P  
Sbjct: 898  LRKALADIQKESNGVSKFNVEERVNELFKQKKLSALDRLNDLENMYKEYGIDLSTHFPIQ 957

Query: 975  XXXXXXXXXXXXXXXHSTLDPTYLQKKINELDEISDELYLMNYXXXXXXXXXXXXXXXXX 1034
                            STLDP   Q K++E+D IS EL  M                   
Sbjct: 958  DEPQESAESEKNAEGPSTLDPRAYQAKLDEIDRISKELIEM--KSELKNDKALRRHESPS 1015

Query: 1035 XXXXXXXXMRSVSNAPSKGISEAG--SFLESLSQKYGTGQNAISSPTS-ITSPNERIASQ 1091
                    ++   +  ++ +  +G  SFLESLSQKYGTG+NA +  T+ I + +ER    
Sbjct: 1016 KQDTDDDEIQDTGSMVNEDLQSSGTSSFLESLSQKYGTGKNATNMLTNDILNSSER-KGH 1074

Query: 1092 GEKSFMNRLKRQTMAAPFLEELTQK 1116
              +SFM R+K+ +    +LEEL  K
Sbjct: 1075 SRQSFMERMKKPSGVPAYLEELPLK 1099

 Score =  748 bits (1932), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 390/674 (57%), Positives = 487/674 (72%), Gaps = 46/674 (6%)

Query: 1246 MMGKKEPYKSVVDQPSLLQ---LTNSDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERF 1302
            ++G+K  Y++ V  P L Q   L +S   PR +KKLKQLHW+KLD+TD+SIWS G AE+F
Sbjct: 1228 LLGQKMAYRTAVPSPLLPQSPSLFSS--YPRARKKLKQLHWEKLDATDNSIWSSGKAEKF 1285

Query: 1303 ADDLYEKGVLRNLEKAFAAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVP 1362
            A DLYEKGVL +LEKAFAAREIKS+ T+K+EDL KI+FLS D+SQQFGINLHMY  L+V 
Sbjct: 1286 AGDLYEKGVLEDLEKAFAAREIKSLATKKREDLDKITFLSRDVSQQFGINLHMYSQLSVE 1345

Query: 1363 ELIEKVLKCDRNLINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQKFQRR 1422
            EL+ K+LKC+R+ ++TPSV+EFL+K EI+EVS NLARNY+PY+TDW+GV  ++  K   +
Sbjct: 1346 ELVTKILKCERDFMDTPSVLEFLSKPEIIEVSTNLARNYSPYSTDWDGVSKVEDAKSPEK 1405

Query: 1423 ----IQMTYRELIKFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAV 1478
                +Q   +  ++ IYN   LQ YW SRMRAL+VITSYEREY+ELVTKLRKVDKAV  +
Sbjct: 1406 DPAELQRADQLYLQLIYN---LQPYWGSRMRALRVITSYEREYSELVTKLRKVDKAVAVI 1462

Query: 1479 QRSENLKNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRD 1538
            Q+S NL+NVFNVILAVGNYMND++KQAQGFKLSTLQRLTFIKDA NSMTFLNYVEKIVRD
Sbjct: 1463 QKSTNLRNVFNVILAVGNYMNDSAKQAQGFKLSTLQRLTFIKDANNSMTFLNYVEKIVRD 1522

Query: 1539 NYPSFNDFIDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDK 1598
            NYPSFNDF++DL+PVLDVVK+S+EQLISDC EFSQSI NVERS++IGNL+DSSKFHP DK
Sbjct: 1523 NYPSFNDFLEDLQPVLDVVKISIEQLISDCKEFSQSITNVERSIDIGNLNDSSKFHPLDK 1582

Query: 1599 VLTKVLPVLPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITE 1658
            VL KVLPVLPEA+K+  LL +EVKL+IMEFE+LM++YGED+                I E
Sbjct: 1583 VLVKVLPVLPEASKRVELLDEEVKLSIMEFESLMQRYGEDSADKFAKNSFFKKFADFINE 1642

Query: 1659 YKKAQSQNLKQEEEERAYEKHKRMIEEQQHKQDLXXXXXXXXXXXXXXXQSDRRAMMDKL 1718
            YK+AQ+QNLK EEEER Y+ HK+M+EEQQ + +                  DRRAMMDKL
Sbjct: 1643 YKRAQAQNLKAEEEERLYQTHKKMVEEQQKRAEEKERSENATEEDASEENEDRRAMMDKL 1702

Query: 1719 LEKLKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDTGDDSIVYSPNTPTQEGP 1778
            LE+LKNAGP KADP SARKRA++RKK+L D E  + +L  I   DDS++YSP    QEG 
Sbjct: 1703 LEQLKNAGPVKADPLSARKRAMIRKKMLNDSEAVSDVLDSIQQEDDSMIYSPE--KQEGI 1760

Query: 1779 NDIHLASPTPSGKSDLVLASVSPTKESTADGIAEDEFISDRAKALLLELRGSEN-MKRNS 1837
             +       P+G S     S SP+K   A+   ++E I+DRAKALL+ LRG E+  KRN+
Sbjct: 1761 TN-------PTGDS-----SQSPSK-GAANNQQDEEEITDRAKALLMGLRGGESPSKRNN 1807

Query: 1838 QLEEQKEKLKARRSRRRTQTESISSNKLFFTDE----------------ESHSTSPSESK 1881
             L   KEKL+AR  RR+T T+        F +E                +S+S + + +K
Sbjct: 1808 VLNGHKEKLRAR--RRKTNTDMSPEGSFLFNEEVRGTISSADTDYSNEQQSNSEANTLTK 1865

Query: 1882 GTEYEMTTANEEPE 1895
                 +T  N++PE
Sbjct: 1866 SIRSTLTEENDDPE 1879

>NCAS0A00590 Chr1 complement(102748..108588) [5841 bp, 1946 aa] {ON}
            Anc_1.82
          Length = 1946

 Score =  889 bits (2296), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 516/1104 (46%), Positives = 670/1104 (60%), Gaps = 73/1104 (6%)

Query: 46   SSPKKPIVPKQFTST-------ELRPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTNNT 98
            SSP+    P++ ++T        L+PLNKK++LNTQNLSQY++    D+ +P        
Sbjct: 47   SSPRTSYSPERDSTTTRESHTNSLKPLNKKTSLNTQNLSQYIN----DKHSP-------- 94

Query: 99   SHTRAHSSQSATKYSYSRRSSTAT-GPIKXXXXXXXXXXXXXXXXXXXXYTNLLKYIDSD 157
             HTR+ S QS++KYSYSRRSS+ T G                       +TNL K+I  D
Sbjct: 95   QHTRSASVQSSSKYSYSRRSSSQTLGSTLNQIARQHTNQSSASILSQGSFTNLSKFIAPD 154

Query: 158  GKINLEMPRDPHEVEALFEDLMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQNEIK 217
            GKINLEMPRDP+EVE LFED+M KRNI Q+LP DKQ ELMSYD+ KKW +VKQDLQNE+K
Sbjct: 155  GKINLEMPRDPNEVEVLFEDIMLKRNILQSLPTDKQNELMSYDLEKKWLIVKQDLQNEMK 214

Query: 218  KLMSKSSSYHPTEXXXXXXXXXXXXXXXXXXXXXXXXXXQDSNSPQTAIFTSNSGTMQXX 277
            K+  K++S +                              + NSP T   + +       
Sbjct: 215  KMRLKTNSTNTNNNNNNNRSSMSPENSSTI----------NLNSPATMQMSPHHHIGSNS 264

Query: 278  XXXXXXXXIPVGGKSRPVGSSSTASGTNSMIYQSSENNKSVSSIATDRINRPPIHYVKKI 337
                     P+    RP G  S     N+ +Y+ S  N S SS++ D+ NRPPIHYVK+I
Sbjct: 265  NSSINSHHTPITISKRPTGPISNPI-PNADMYKLSMRNTSSSSMS-DKTNRPPIHYVKRI 322

Query: 338  IADRLTSEEMNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMNTIYKCAPGSELTPELQE 397
            IAD +TSEEM DLWVTLRTEQ+DWVDAF+EHQGHIAMAN+LM ++YK +      P+L E
Sbjct: 323  IADTITSEEMKDLWVTLRTEQIDWVDAFIEHQGHIAMANILMKSLYKTSSDGTPNPQLLE 382

Query: 398  KEHSFFKCFRVLSMLSQGLYEFAKHKLMSDTIANGLFSSRLATRKMATEVLVCMIEKRNN 457
            KE++FFKCFRVLSMLSQGL EF +H++MS T+A GLFS  L+TR+MATE+ VCM+EK+N 
Sbjct: 383  KENAFFKCFRVLSMLSQGLREFTRHEIMSQTVARGLFSITLSTRRMATEIFVCMLEKKNP 442

Query: 458  MRFEVVLASLDRYFRQEENLNMVHLSKTLPGEYPQSTPNTKYKIIQAWLIALDETLNGRG 517
             RF+V+L +LD+ F+   N +M    K  P  +   T +++ K+ QAWL A++ TL+GRG
Sbjct: 443  ERFKVILNALDQKFKIGYNAHMTQNIKMFPDYFTHLTLDSQLKVTQAWLFAVEHTLDGRG 502

Query: 518  KMGSLVGASDDYR-SAGENAILEYCLWTMVFINHLCSNSSLLNQRILLRTKLENLGALRI 576
            KMGSLVGASDD++ S GENAILEYC W+M+FINHLCS SS +NQR+LLRTKLEN G LRI
Sbjct: 503  KMGSLVGASDDFKNSGGENAILEYCQWSMIFINHLCSCSSNINQRMLLRTKLENCGILRI 562

Query: 577  MTKLKRLDYEKLTEQIELYDNNKLDDFNTVLETESKNSKVNMQNPNSLIENLWESCKGSD 636
            M K+K LDY+K+ EQI+LY+NNKLDD NT+LE+ +KN+ +N+Q+P S++ NLW++CKG++
Sbjct: 563  MNKVKTLDYDKVIEQIDLYENNKLDDLNTLLESNNKNANINLQDPTSMLRNLWDACKGTE 622

Query: 637  NEKXXXXXXXXXXXXXXKLMGEKEDPTKLSKQLKLIDSLLTNVNGSMFDEESHMNLAIQR 696
            NEK              + + EK+DP KLS+QLKL+DSL+TNV+ S  D+E+ MN+AIQR
Sbjct: 623  NEKLLISLMQHLFLSSSQFIEEKKDPVKLSRQLKLLDSLVTNVSVSSTDQEASMNMAIQR 682

Query: 697  LYDSMQTDEVARRAILESRTLTKKLEEAHAERDYLSNKLSNAENGLVGQLESDLKQRDNI 756
            LYD+MQTDEVARR+ILESRTLTKKLEE  AERD LS KL NAE+GLVGQL+ +L QRD I
Sbjct: 683  LYDAMQTDEVARRSILESRTLTKKLEEVQAERDLLSQKLKNAEHGLVGQLQDELAQRDRI 742

Query: 757  LEKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXXXMLTILNSR------NGTQNPDVDDV 810
            L KNQRVM                           MLTILN+R      NGT        
Sbjct: 743  LSKNQRVMEQLQGELEELKKKHLLEKHEQEVELRKMLTILNARPEIVEGNGTSKKTKAKN 802

Query: 811  TITLDPNKKLDIQKALELELNKTKKDLSNDSKRFGITVQPNKRLKMLRMQMEDIENEARQ 870
               LDP+KK  IQ+AL+  L++TKKD S D++ FG+T+QPNKRLK+LRMQMEDIENEAR+
Sbjct: 803  PSALDPSKKQSIQQALQDGLSRTKKDYSVDARNFGMTIQPNKRLKLLRMQMEDIENEARE 862

Query: 871  LEMTNFADHKRTNXXXXXXXXXXXXXXXXXXXNTEEFDKENEMKTKKLMQLRKALAAIQS 930
            LEMTNF ++++                       +E D        KL  LR+ LA IQ 
Sbjct: 863  LEMTNFTEYEK-----RKLEAPSKIKKPKKVATKKEIDP----SINKLNDLRQTLAEIQM 913

Query: 931  ETNDISKFNVEGRVNEMFQDXXXXXXXXXXXXXXXYKDFEIPFX------XXXXXXXXXX 984
            E+NDISKFNV+ RVNE+F                 YKDF I F                 
Sbjct: 914  ESNDISKFNVDERVNELFNQKRITALKRLQDLETKYKDFGIDFNIDELVDSASKDENGNN 973

Query: 985  XXXXXHSTLDPTYLQKKINELDEISDELYLMNYXXXXXXXXXXXXXXXXXXXXXXXXXM- 1043
                 +S+LDP   Q+K++EL+ ++DEL  +                             
Sbjct: 974  QQSGDYSSLDPKAYQRKLDELNRLTDELLRVKNKVNASDNNLSSRRPSASSSSESASSSS 1033

Query: 1044 ----------RSVSNAPSKGISEA-GSFLESLSQKYGTGQNAISSPTSITSPNERIASQG 1092
                      R  + +   G S   GSFLE+L+QKY TGQ +        SP ++     
Sbjct: 1034 DSDDGESLIERQDTQSNFSGTSAGPGSFLEALTQKYATGQKS-------ASPRDQSTRMK 1086

Query: 1093 EKSFMNRLKRQTMAAPFLEELTQK 1116
            +  F+NR+K+  +A PFL+ELT K
Sbjct: 1087 DNIFINRIKQTNVAPPFLDELTDK 1110

 Score =  759 bits (1959), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 403/640 (62%), Positives = 483/640 (75%), Gaps = 39/640 (6%)

Query: 1252 PYKSVVDQPSLLQLTN-SDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKG 1310
            P K V+  P L Q  +  +  PRPQKKLKQLHW+KLD+TD+SIW    AE+FADDLYEKG
Sbjct: 1271 PRKKVIASPLLPQSASLFENYPRPQKKLKQLHWEKLDATDNSIWKTNKAEKFADDLYEKG 1330

Query: 1311 VLRNLEKAFAAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLK 1370
            VL +LEKAFAAREIKS+ ++KKEDL KISFLS DISQQFGINLHMY +L V ++++K+LK
Sbjct: 1331 VLTDLEKAFAAREIKSLASKKKEDLDKISFLSRDISQQFGINLHMYANLPVDDVVKKILK 1390

Query: 1371 CDRNLINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQK--------FQRR 1422
            CDR+ ++TPSVIEFL+K EIVEVSVNLARNYAPY+TDWEGVKS++  K         QR 
Sbjct: 1391 CDRDFLHTPSVIEFLSKPEIVEVSVNLARNYAPYSTDWEGVKSVEDAKAPEKDPNELQRA 1450

Query: 1423 IQMTYRELIKFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSE 1482
             Q+ Y +LI      +NLQSYW SRMRAL VIT++++EYNEL+TKLRKVDKAV ++Q SE
Sbjct: 1451 DQL-YLQLI------INLQSYWGSRMRALTVITTFDKEYNELLTKLRKVDKAVSSLQESE 1503

Query: 1483 NLKNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRDNYPS 1542
            NLKNVFNVILAVGNYMNDTSKQAQGFKL+TLQRLTFIKD+TNSMTFLNYVEKIVR NYPS
Sbjct: 1504 NLKNVFNVILAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNSMTFLNYVEKIVRSNYPS 1563

Query: 1543 FNDFIDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTK 1602
            FNDF+ +LEPVLDVVK+S+EQL+SDC EFSQSIVNVERS+E GNLSDSSKFHP D+VL K
Sbjct: 1564 FNDFLTELEPVLDVVKISIEQLVSDCKEFSQSIVNVERSVEFGNLSDSSKFHPQDRVLAK 1623

Query: 1603 VLPVLPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKA 1662
            VLP+LP+A KK  LL DEVKLTIMEF  LM+ YGED+                ITEYKKA
Sbjct: 1624 VLPILPDARKKGELLGDEVKLTIMEFLRLMQIYGEDSEDKFAKNSFFKKFADFITEYKKA 1683

Query: 1663 QSQNLKQEEEERAYEKHKRMIEEQQHK---QDLXXXXXXXXXXXXXXXQSDRRAMMDKLL 1719
            Q+QN+K EEEE+ YE+HK+M+E+QQ K   Q+                  DRRAMMDKLL
Sbjct: 1684 QNQNIKAEEEEQVYERHKKMVEDQQKKLQEQENGSNGSENGEEGSGDDSGDRRAMMDKLL 1743

Query: 1720 EKLKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDTGDDSIVYSPNTPTQEGP- 1778
            ++LKNAGP K DPSSARKRALVRKKL+T  E TA +L+DI+T DDSI+YSP     EG  
Sbjct: 1744 DQLKNAGPSKTDPSSARKRALVRKKLMT--ESTA-LLKDIETEDDSIIYSP-----EGKN 1795

Query: 1779 ---NDIHLASPTPSGKSDL----VLASVSPTKESTADGIAEDEFISDRAKALLLELRGSE 1831
               N + L +P    + D+    +  S+SP++ ST     +DE ++DRAKALL+ELRGS 
Sbjct: 1796 PFVNPVDLDTPHDESEMDVSSSPIQRSLSPSRNSTLLSDDQDE-VTDRAKALLMELRGSN 1854

Query: 1832 N-MKRNSQLEEQKEKLKARRSRRRTQTESISSNKLFFTDE 1870
               KRNS L+E KEKL+AR  RR+T ++  S  +L F  E
Sbjct: 1855 TPSKRNSLLDEHKEKLRAR--RRKTNSDLHSGTRLQFVGE 1892

>CAGL0J08206g Chr10 (809506..815202) [5697 bp, 1898 aa] {ON} similar
            to uniprot|P41832 Saccharomyces cerevisiae YNL271c BNI1
            regulator of budding
          Length = 1898

 Score =  881 bits (2277), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 508/1075 (47%), Positives = 666/1075 (61%), Gaps = 64/1075 (5%)

Query: 63   RPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTNNTSHTRAHSSQSATKYSYSRRSS--- 119
            RPLNKKSTLN+QNLSQYV+  K         P + ++H R  S+QS  KYSYSRRSS   
Sbjct: 75   RPLNKKSTLNSQNLSQYVNNGKALS------PESGSNHHRTDSTQSGFKYSYSRRSSGQV 128

Query: 120  ----TATGPIKXXXXXXXXXXXXXXXXXXXXYTNLLKYIDSDGKINLEMPRDPHEVEALF 175
                ++ G I                      TNL +++  DGKINL MP DP+EVE+LF
Sbjct: 129  SMAPSSMGNINLTRHNTNTSFSSASVLSHGSITNLSRFMTPDGKINLTMPSDPYEVESLF 188

Query: 176  EDLMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQNEIKKLMSKSSSYHPT-----E 230
            ED+MYKRNI Q+LPQ+KQ ELMSY + KKW +VKQDLQNE K++ + +     T     +
Sbjct: 189  EDIMYKRNILQSLPQEKQNELMSYSIEKKWLIVKQDLQNEFKRIKASNKGDSRTGMSMPD 248

Query: 231  XXXXXXXXXXXXXXXXXXXXXXXXXXQDSNSPQTAIFTSNSGTMQXXXXXXXXXXIPVGG 290
                                        S +P T    S SG             IP+  
Sbjct: 249  LGSDPSNSVSPPGPISSSGSSIFSSDVTSTAPSTY---SRSG----------KKNIPI-- 293

Query: 291  KSRPVGSSSTASGTNSMIYQSSENNKSVSSIATDRINRPPIHYVKKIIADRLTSEEMNDL 350
             S+P+ ++ST       +Y  +E N S S+I +D+ NRPPIHYVKKI+ D+L+ +EM DL
Sbjct: 294  -SKPIAATSTE------LYHIAERNTSSSTIQSDKANRPPIHYVKKIVDDKLSKDEMKDL 346

Query: 351  WVTLRTEQLDWVDAFLEHQGHIAMANVLMNTIYKCAPGSELTPELQEKEHSFFKCFRVLS 410
            WVTLRTEQLDWVDAFLE+QGHIAMAN+LM +IYK  P  +++  L +KE++FFKCFRVL+
Sbjct: 347  WVTLRTEQLDWVDAFLENQGHIAMANILMKSIYKTTPKDKVSEPLLDKENAFFKCFRVLA 406

Query: 411  MLSQGLYEFAKHKLMSDTIANGLFSSRLATRKMATEVLVCMIEKRNNMRFEVVLASLDRY 470
            +LSQGL+EF  H LM+DTIA GLFS RLATRKMATE+ V ++EK+N  RFE VL+SLD+ 
Sbjct: 407  VLSQGLHEFTIHSLMTDTIAQGLFSGRLATRKMATEIFVFLLEKKNKKRFESVLSSLDKN 466

Query: 471  FRQEENLNMVHLSKTLPGEYPQSTPNTKYKIIQAWLIALDETLNGRGKMGSLVGASDDYR 530
            F   +N +M    K LP  +   T N+  K+IQAWL A+++TL+GRGKMGSLVGAS+DY+
Sbjct: 467  FIIGQNSHMNESYKKLPQYFTHLTSNSNLKVIQAWLFAVEQTLDGRGKMGSLVGASEDYK 526

Query: 531  SAG-ENAILEYCLWTMVFINHLCSNSSLLNQRILLRTKLENLGALRIMTKLKRLDYEKLT 589
            +AG ENAILEYC WTMVFINHLCS+S  +NQR LLR KLEN G LRIM K+K LDYEK+ 
Sbjct: 527  NAGGENAILEYCQWTMVFINHLCSSSENINQRTLLRRKLENCGILRIMNKIKLLDYEKVI 586

Query: 590  EQIELYDNNKLDDFNTVLETESKNSKVNMQNPNSLIENLWESCKGSDNEKXXXXXXXXXX 649
            +QIELY+NNKLDDFN +LE+  KN  V++Q+P SL++NL ++CKG++NEK          
Sbjct: 587  DQIELYENNKLDDFNALLESNKKNINVDLQDPVSLMKNLLDACKGTENEKTLVSLVQHIF 646

Query: 650  XXXXKLMGEKEDPTKLSKQLKLIDSLLTNVNGSMFDEESHMNLAIQRLYDSMQTDEVARR 709
                KL+ EK+DP K++KQLKL+DSL+TNV+ +  +E S++N+AIQRLYDSMQTDEVARR
Sbjct: 647  LPTSKLLDEKQDPNKVTKQLKLMDSLVTNVSVTSTEEGSNVNMAIQRLYDSMQTDEVARR 706

Query: 710  AILESRTLTKKLEEAHAERDYLSNKLSNAENGLVGQLESDLKQRDNILEKNQRVMXXXXX 769
            AILESRTLTKKLEE  AERD L  KLS AE+GLVGQLE ++K+RD IL KNQRVM     
Sbjct: 707  AILESRTLTKKLEEMEAERDMLVEKLSKAEHGLVGQLEMEVKERDRILAKNQRVMKQLES 766

Query: 770  XXXXXXXXXXXXXXXXXXXXXXMLTILNSRNGTQNPDVDDVTITLDPNKKLDIQKALELE 829
                                  MLTILNSR          +  +++ ++K D+Q+AL+  
Sbjct: 767  ELEELKKKHLLEKHEQEVELRKMLTILNSRPAKTKEQKKKIG-SIEASEKEDLQRALQSG 825

Query: 830  LNKTKKDLSNDSKRFGITVQPNKRLKMLRMQMEDIENEARQLEMTNFADHKRTNXXXXXX 889
            L K KKD  +DSK+FG+T+QPN+RLK+LRMQME IENEAR+LEMTNFA++++        
Sbjct: 826  LQKAKKDFKDDSKKFGMTIQPNQRLKVLRMQMESIENEARKLEMTNFAEYEKKGLKPPAN 885

Query: 890  XXXXXXXXXXXXXNTEEFDKENEMKTKKLMQLRKALAAIQSETNDISKFNVEGRVNEMFQ 949
                            E +K  E + +KL +LR  L  IQ E+ND+SKFNV+ RVNE+F 
Sbjct: 886  VQKKSKP-------ISELNK--EQRIQKLNELRDKLRRIQMESNDVSKFNVDERVNELFN 936

Query: 950  DXXXXXXXXXXXXXXXYKDFEIPFXXXXXXXXXXXXXXXXHSTLDPTYLQKKINELDEIS 1009
            D               YK F I F                +S+LDP   Q K++E+ +IS
Sbjct: 937  DKKRTALQRLKELETKYKGFGIDFKVEDFTHESTDSSNEGYSSLDPKVYQDKLDEITKIS 996

Query: 1010 DELYLM-NYXXXXXXXXXXXXXXXXXXXXXXXXXMRSVS-----NAPSKGISE--AGSFL 1061
            +EL    N                            +++     N  S  +S+  +GSFL
Sbjct: 997  EELLQQKNELETTQTSSSESNSDSESSSDSDDSMEDALTNNKDINGTSSNVSDLASGSFL 1056

Query: 1062 ESLSQKYGTGQNAISSPTSITSPNERIASQGEKSFMNRLKRQTMAAPFLEELTQK 1116
            ++L+QKYGTGQ   + P  I SP    +++ EKSF++R+KR +    ++EEL++K
Sbjct: 1057 DTLTQKYGTGQ---AEP--IQSPVGHYSNRNEKSFVDRMKRNSRVPSYVEELSKK 1106

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 393/643 (61%), Positives = 474/643 (73%), Gaps = 27/643 (4%)

Query: 1247 MGKKEPYKSVVDQPSLLQLTN-SDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADD 1305
            M  K+  K VV  P L Q  +  +  PRPQKKLKQLHW+K++STD+SIW    AE+FADD
Sbjct: 1233 MMTKDSKKKVVSSPLLPQSPSLFENYPRPQKKLKQLHWEKVESTDNSIWGSQKAEKFADD 1292

Query: 1306 LYEKGVLRNLEKAFAAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELI 1365
            LYEKGVL  LEKAFAAREIKS+ TRKKEDL KISFLSHDISQQFGINLHMY +L V + +
Sbjct: 1293 LYEKGVLSELEKAFAAREIKSLATRKKEDLQKISFLSHDISQQFGINLHMYSNLTVNQFV 1352

Query: 1366 EKVLKCDRNLINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQK------- 1418
            EKVLKC+R+ +NTPSVIEFL+K EIVEVS NLARNYAPY+TDWEG+K ++  K       
Sbjct: 1353 EKVLKCERDFMNTPSVIEFLSKQEIVEVSTNLARNYAPYSTDWEGIKKIEDAKAPEKDPN 1412

Query: 1419 -FQRRIQMTYRELIKFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGA 1477
              QR  Q+       ++  MVNLQSYWASRMRA+++ITSYEREYNEL+ KL +VDKAVG+
Sbjct: 1413 ELQRADQI-------YLQLMVNLQSYWASRMRAIRMITSYEREYNELLAKLHRVDKAVGS 1465

Query: 1478 VQRSENLKNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVR 1537
            +Q S+NLKN+FNVILAVGN+MND++KQA+GFKLSTLQRLTFIKDA NSMTFLNYVEKIVR
Sbjct: 1466 LQGSDNLKNIFNVILAVGNFMNDSAKQAKGFKLSTLQRLTFIKDADNSMTFLNYVEKIVR 1525

Query: 1538 DNYPSFNDFIDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSD 1597
             NYP FN+F+ +LEPVL+VVK+S+EQL++DCN+F Q I NVERS+EIGNLSDSSKFHP D
Sbjct: 1526 SNYPEFNNFLIELEPVLEVVKVSIEQLVNDCNDFVQGINNVERSIEIGNLSDSSKFHPLD 1585

Query: 1598 KVLTKVLPVLPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXIT 1657
            KVL KVLP L EA KK  LL DE+KLTIMEFE +M+ YGED G               I 
Sbjct: 1586 KVLLKVLPNLSEARKKGELLADEMKLTIMEFEQIMQTYGEDYGDKFAKISFFQKFADFIA 1645

Query: 1658 EYKKAQSQNLKQEEEERAYEKHKRMIEEQQHKQD-----LXXXXXXXXXXXXXXXQSDRR 1712
            EYKKAQ+QN+K EEEE AYE+HK+M+EEQQ K       L                 DRR
Sbjct: 1646 EYKKAQAQNIKVEEEEAAYERHKKMVEEQQRKAQEDASKLNENSSQTGNSDEEEESEDRR 1705

Query: 1713 AMMDKLLEKLKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDTGDDSIVYSPNT 1772
            A+MDKLLE+LKNAG  K DP+SARKRAL+RKK+ + +E  +  L ++  G DS++YSP+ 
Sbjct: 1706 AVMDKLLEQLKNAGQVKTDPTSARKRALLRKKIHSSEESESSPLAEMQVGGDSLIYSPDA 1765

Query: 1773 PTQEGPNDIHLASPTPSGKSDLVLASV-SPTKESTADGIAEDEFISDRAKALLLELRGSE 1831
              Q    +IH+ASPTP  K D  L +  +   ES    I EDE I DRAK LL+ELRGS+
Sbjct: 1766 KEQIEL-EIHMASPTPKTKEDGKLGTGENSNGESPLKKINEDEEIGDRAKTLLMELRGSD 1824

Query: 1832 N-MKRNSQLEEQKEKLKARRSRRRTQTESI-SSNKLFFTDEES 1872
              M RN+ L+E KE+L+AR  R+RT +  I SSN+L F DE+S
Sbjct: 1825 ALMDRNTALDEHKERLRAR--RKRTDSNKIPSSNRLKFVDEKS 1865

>KNAG0F00470 Chr6 complement(66506..72592) [6087 bp, 2028 aa] {ON} 
          Length = 2028

 Score =  827 bits (2137), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 483/1119 (43%), Positives = 654/1119 (58%), Gaps = 93/1119 (8%)

Query: 48   PKKPIVPKQFTSTELRPLNKKSTLNTQNLSQYVSG-TKIDQDNPNPLPTNNTSHTRAHSS 106
            P+ P VPK        PL+KK+T+N+QNLS Y SG +    D    + +   +H+R  S 
Sbjct: 145  PEAPGVPK--------PLSKKATMNSQNLSHYTSGVSATSSDGDGGMASPEYTHSRTQSG 196

Query: 107  QSATKYSY---SRRSSTATGPIKXXXXXXXXXXXXXXXXXXXXYTNLLKYIDSDGKINLE 163
            Q+ +++SY   SRRSS+     K                    Y   +     DGK+ LE
Sbjct: 197  QT-SRFSYTSPSRRSSSDAKLAKYHTAQSSQNSIASQGSLSTLYNRFIS--PEDGKLRLE 253

Query: 164  MPRDPHEVEALFEDLMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQNEIKKLMSKS 223
            MP DP EVE L+ED+MYKRNI Q LP DKQ ELM+YDV KKW +VKQDLQNE KKL +K+
Sbjct: 254  MPDDPAEVELLYEDIMYKRNILQNLPTDKQLELMNYDVKKKWLIVKQDLQNERKKLKTKT 313

Query: 224  SSYHPTEXXXXXXXXXXXXXXXXXXXXXXXXXXQDSNSPQTAIFTSNSGTMQXXXXXXXX 283
            SS+  T                           QD++S  +A         Q        
Sbjct: 314  SSHQQT------------------VQSAPFMNLQDTSS--SASLPGQGFHDQQSVVSETS 353

Query: 284  XXIPVGGKSRPVGSSSTAS--------------GTNSMIYQSS----ENNKSVSSIATDR 325
              +P    +  + SS+T S                   +Y ++     +  S S++A+D+
Sbjct: 354  SRVPTTNDAASILSSATPSLRHPSRRKQQYTLTNKQHTVYPANGTAERHASSSSTLASDK 413

Query: 326  INRPPIHYVKKIIADRLTSEEMNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMNTIYKC 385
             NR PIHYVKKIIAD+L+ +E+NDLWVTLRTEQLDWVDAFL++QGHIAMANVLM ++YK 
Sbjct: 414  TNRLPIHYVKKIIADQLSQDELNDLWVTLRTEQLDWVDAFLDNQGHIAMANVLMKSLYKT 473

Query: 386  APGSELTPELQEKEHSFFKCFRVLSMLSQGLYEFAKHKLMSDTIANGLFSSRLATRKMAT 445
            +P   L+  L +KE S+FKCF+VLSML+QGL EF  H+L++DTIA GLFSSRL TRKMAT
Sbjct: 474  SPNVSLSGPLLDKEQSYFKCFKVLSMLAQGLREFTDHRLITDTIARGLFSSRLPTRKMAT 533

Query: 446  EVLVCMIEKRNNMRFEVVLASLDRYFRQEENLNMVHLSKTLPGEYPQSTPNTKYKIIQAW 505
            E+ VCM+E +N  RF+ V+ SLD+ F+   N +MV+  + +P  +      +  K++QAW
Sbjct: 534  EIFVCMLETKNQTRFDAVITSLDQNFQIGSNAHMVNNLQKMPDYFIHLNLQSTLKVVQAW 593

Query: 506  LIALDETLNGRGKMGSLVGASDDY-RSAGENAILEYCLWTMVFINHLCSNSSLLNQRILL 564
            L A+D+TL+GRGKMGSLVGASD++ R  GEN++LEYC WT+VF+N  C +S+ LNQR+LL
Sbjct: 594  LFAIDQTLDGRGKMGSLVGASDEFKRIDGENSVLEYCQWTLVFVNKFCQSSNNLNQRMLL 653

Query: 565  RTKLENLGALRIMTKLKRLDYEKLTEQIELYDNNKLDDFNTVLETESKNSKVNMQNPNSL 624
            RTKLEN G LRIM K+K LDYEK+ +QIE Y+  KLDDFN++LE+++K++ ++MQNP SL
Sbjct: 654  RTKLENAGFLRIMNKMKLLDYEKIRDQIEFYEAGKLDDFNSLLESQNKHANIDMQNPLSL 713

Query: 625  IENLWESCKGSDNEKXXXXXXXXXXXXXXKLMGEKEDPTKLSKQLKLIDSLLTNVNGS-- 682
            ++NLW++C+G+D+E               +L+   +DPT+L+KQLKLIDSL+TNV  S  
Sbjct: 714  LQNLWDACRGTDSENLLVSLVQHLFLSSTRLIQNNKDPTQLAKQLKLIDSLVTNVGSSVS 773

Query: 683  -MFDEESHMNLAIQRLYDSMQTDEVARRAILESRTLTKKLEEAHAERDYLSNKLSNAENG 741
             + DEE+ M++ IQRL+DSMQTDEVARRAI+ESRTLTKK+EE  AE+D L +KLS AE G
Sbjct: 774  AVADEETTMSMTIQRLFDSMQTDEVARRAIIESRTLTKKMEELQAEKDRLGDKLSKAEGG 833

Query: 742  LVGQLESDLKQRDNILEKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXXXMLTILNSR-- 799
            LVG+L+ D+++RD IL KNQRV                            MLTI+NS+  
Sbjct: 834  LVGELQRDIRERDAILAKNQRVNKQLENELEELKRKTLMEKHEHEVELRKMLTIINSKAS 893

Query: 800  -NGTQNPDVDDVTITLDPNKK--------LDIQKALELELNKTKKDLSNDSKRFGITVQP 850
             N  QNP    V  + DP  K          IQK L+  L +TKKD +ND+K+FG+TVQP
Sbjct: 894  PNLAQNPSA-SVLKSHDPKNKESLLSEQQSKIQKVLQDGLTRTKKDFTNDAKKFGMTVQP 952

Query: 851  NKRLKMLRMQMEDIENEARQLEMTNFADHKRTNXXXXXXXXXXXXXXXXXXXNTEEFDKE 910
            NKRL++LRM++EDIENEARQLEMTNFAD ++ N                    T + DK+
Sbjct: 953  NKRLQLLRMKVEDIENEARQLEMTNFADIEK-NATPVILTKGTKKKKSKKKLKTAQPDKK 1011

Query: 911  ------NE-MKTKKLMQLRKALAAIQSETNDISKFNVEGRVNEMFQDXXXXXXXXXXXXX 963
                  NE  K + L +LR AL AIQSE+NDISKFNVE  VNE+F +             
Sbjct: 1012 QRANQRNENQKIEALNKLRMALTAIQSESNDISKFNVEEHVNELFTERKFKALQRLRDLE 1071

Query: 964  XXYKDFEIPFXXXXXXXXXXXXXXXXHS--TLDPTYLQKKINELDEISDELYLMNYXXXX 1021
              +      F                    +LDP     K++E++ ++++L  ++     
Sbjct: 1072 SKFNGLNTNFNIDDIIASTEKALTATDDGYSLDPRRADNKLDEIERLTNDLSKLHDSMKE 1131

Query: 1022 XXXXXXXXXXXXXXXXXXXXXMRSVSNAPSKGISE----AGSFLESLSQKYGTGQNAISS 1077
                                   +  +     +SE    +GSFL SLSQKY TGQ   +S
Sbjct: 1132 QEQATLQSDNSSESSDSESVESDNEGSTVQSDVSEPTVGSGSFLASLSQKYETGQKQPNS 1191

Query: 1078 PTSITSPNERIASQGEKSFMNRLKRQTMAAPFLEELTQK 1116
            P ++           +K+FM RLKR + A  +L+EL++K
Sbjct: 1192 PVTV----------NQKAFMTRLKRSSGAPLYLQELSKK 1220

 Score =  724 bits (1869), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/680 (57%), Positives = 495/680 (72%), Gaps = 41/680 (6%)

Query: 1255 SVVDQPSLLQLTNSDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKGVLRN 1314
            S +  P   Q +  ++ PRPQKKLKQLHW+KLDST++SIWS   AE+FADDLYEKGVL N
Sbjct: 1360 SPIPSPLFSQSSIFEKYPRPQKKLKQLHWEKLDSTNNSIWSASKAEKFADDLYEKGVLSN 1419

Query: 1315 LEKAFAAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRN 1374
            LEKAFAARE+KS+ ++K +D SKI+FL+ D+SQQFGINLHM+G+L+V EL+ K+LKCDR 
Sbjct: 1420 LEKAFAAREVKSLSSKKGDD-SKITFLTRDVSQQFGINLHMFGNLSVEELVTKILKCDRE 1478

Query: 1375 LINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQK--------FQRRIQMT 1426
            ++N+PSVIEFL+K E+VEVSVNLARNY+PY+TDWEGVK ++  K         QR  Q+ 
Sbjct: 1479 VLNSPSVIEFLSKQEVVEVSVNLARNYSPYSTDWEGVKRIEDAKAPEKDPNELQRADQL- 1537

Query: 1427 YRELIKFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKN 1486
                  ++  MVNLQ YW+SRMRALKVIT+YEREY EL+ KLRKVDKAVG++Q+SENLKN
Sbjct: 1538 ------YMSLMVNLQPYWSSRMRALKVITTYEREYAELLEKLRKVDKAVGSLQQSENLKN 1591

Query: 1487 VFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRDNYPSFNDF 1546
            V NVILAVGNYMNDTSKQAQGFKL+TLQRLTFIKD TNSMTFLNYVEKIVR NYP+FNDF
Sbjct: 1592 VLNVILAVGNYMNDTSKQAQGFKLATLQRLTFIKDTTNSMTFLNYVEKIVRKNYPTFNDF 1651

Query: 1547 IDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPV 1606
            +++L+PVLDVVK+S++QL+SDC EFS S+VNVERS+EIGNLSDSSKFHPSD+VL KVLPV
Sbjct: 1652 LNELQPVLDVVKISIDQLVSDCQEFSGSVVNVERSIEIGNLSDSSKFHPSDRVLVKVLPV 1711

Query: 1607 LPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQN 1666
            LPEA KK+ LLTDEVKLT++EF  LM+ YGED+                I EYKKAQ QN
Sbjct: 1712 LPEARKKADLLTDEVKLTMLEFNNLMQTYGEDSADKFAKNSFFKKFADFIQEYKKAQVQN 1771

Query: 1667 LKQEEEERAYEKHKRMIEEQQHKQDLXXXXXXXXXXXXXXXQS---------DRRAMMDK 1717
            +  EEEE+ YE+HK+++EEQQ + +                +          DRRA+MDK
Sbjct: 1772 VAAEEEEQQYERHKKIVEEQQRQGEEARKRLESASPDATNGEDTTAVDDETKDRRAIMDK 1831

Query: 1718 LLEKLKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDTGDDSIVYSPNTPTQEG 1777
            LLE+LKNAG  KADPSSARKRAL R+KLL DK+  + +L DIDT DDS+VYSP+T  Q  
Sbjct: 1832 LLEQLKNAGTVKADPSSARKRALARRKLLGDKDAASALLHDIDTDDDSLVYSPDTKRQSV 1891

Query: 1778 PNDIHLASPTPSGKSDLVLASVSPTKE-STADGIAEDEFISDRAKALLLELRGSEN--MK 1834
             + I   SPTP  K    L   +PTKE S+     +DE ++DRAKALL+ELRG ++  MK
Sbjct: 1892 GHLIG-GSPTPGDK----LLGSTPTKELSSPTAGQDDEDVTDRAKALLMELRGGQSSPMK 1946

Query: 1835 RNSQLEEQKEKLKARRSRRR-TQTESI-SSNKLFF------TDEESHSTSPSESKGTEYE 1886
            +N+ L+EQ+E++++RR R     TE +   NKL F      T E +H      +KG   +
Sbjct: 1947 KNAFLDEQRERIRSRRRRNELAGTEPLRGGNKLSFFEAETETSETAHDADNDTTKGQTAD 2006

Query: 1887 MTTANEEPEEILNARITEEG 1906
             +   +  +++ N  I E+ 
Sbjct: 2007 ASDNLDSNDQLENPSIIEDA 2026

>KAFR0D03950 Chr4 (770599..776472) [5874 bp, 1957 aa] {ON} Anc_1.82
            YNL271C
          Length = 1957

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 427/838 (50%), Positives = 551/838 (65%), Gaps = 18/838 (2%)

Query: 294  PVGSSSTASGTNSMIYQSSENNKSVSSIATDRINRPPIHYVKKIIADRLTSEEMNDLWVT 353
            P+ S  T   T+  +YQ +E+N S S++++D+ NRPP  YV+KIIAD+L+ +EM DLWVT
Sbjct: 281  PMTSPQTKKPTSHELYQLTESNASTSTLSSDKTNRPPNRYVEKIIADKLSPDEMRDLWVT 340

Query: 354  LRTEQLDWVDAFLEHQGHIAMANVLMNTIYKCAPGSELTPELQEKEHSFFKCFRVLSMLS 413
            LRTEQLDWVD+FLE+QGHIAMAN+LM  IYK  P   L+ +L EKE+SFFKCF+VLSMLS
Sbjct: 341  LRTEQLDWVDSFLENQGHIAMANILMKQIYKTTPKDHLSSKLLEKENSFFKCFKVLSMLS 400

Query: 414  QGLYEFAKHKLMSDTIANGLFSSRLATRKMATEVLVCMIEKRNNMRFEVVLASLDRYFRQ 473
            QG+YEF+KHKLM+DTIA GLFS+RL TRKMA E+ VCM+EKRN  RFE +L SLD+ FR 
Sbjct: 401  QGIYEFSKHKLMTDTIARGLFSTRLGTRKMAIEIFVCMLEKRNKSRFEAILNSLDQNFRI 460

Query: 474  EENLNMVHLSKTLPGEYPQSTPNTKYKIIQAWLIALDETLNGRGKMGSLVGASDDYR-SA 532
              N +M    K LP  +   TP++  K++QAWL +++ T++GRGKMGSLVGAS D + S 
Sbjct: 461  GSNFHMFQNLKKLPQYFIHLTPDSHLKVLQAWLFSIENTIDGRGKMGSLVGASTDLKNSG 520

Query: 533  GENAILEYCLWTMVFINHLCSNSSLLNQRILLRTKLENLGALRIMTKLKRLDYEKLTEQI 592
            GENAILEYCLWTMVF+N LC+ S+++ QR+LLRTKLEN G LRIM K+K L+YEK+ ++I
Sbjct: 521  GENAILEYCLWTMVFVNMLCNASTIIQQRMLLRTKLENSGFLRIMNKIKLLNYEKVIDEI 580

Query: 593  ELYDNNKLDDFNTVLETESKNSKVNMQNPNSLIENLWESCKGSDNEKXXXXXXXXXXXXX 652
            E Y+NNKLDDFN +LE+++KNS VN+Q+P SL+ NLW+SCKG++NEK             
Sbjct: 581  ESYENNKLDDFNLMLESKNKNSNVNLQDPVSLLNNLWQSCKGTENEKLLISLIQHLFLSS 640

Query: 653  XKLMGEKEDPTKLSKQLKLIDSLLTNV-NGSMFDEESHMNLAIQRLYDSMQTDEVARRAI 711
             +L+ E +DPTKLSKQLKL+DSL+TNV + S  DEES MN+AIQRLYDSMQTDEVARRAI
Sbjct: 641  SRLIEEVDDPTKLSKQLKLMDSLVTNVSSSSTADEESTMNMAIQRLYDSMQTDEVARRAI 700

Query: 712  LESRTLTKKLEEAHAERDYLSNKLSNAENGLVGQLESDLKQRDNILEKNQRVMXXXXXXX 771
            LESRTLTKKLEE  AE+D L  KLS AENGLVGQLE+DL +RD IL KNQRV        
Sbjct: 701  LESRTLTKKLEELQAEKDLLHEKLSKAENGLVGQLENDLNERDQILAKNQRVTQQLQSEL 760

Query: 772  XXXXXXXXXXXXXXXXXXXXMLTILNSR----NGTQNPDVDDVTIT-LDPNKKLDIQKAL 826
                                MLTILN+R    +G +  D D   I+ L+  K  +IQK L
Sbjct: 761  EELKKKHLLEKHEHEVELRKMLTILNTRSSTNDGAKTIDKDKDNISKLNLQKHENIQKVL 820

Query: 827  ELELNKTKKDLSNDSKRFGITVQPNKRLKMLRMQMEDIENEARQLEMTNFADHKRTNXXX 886
            +  L + K D + D+K+FG+TVQPNKRLKMLRMQMEDIENEARQLEMTNF + +R     
Sbjct: 821  QDGLIRAKNDFTIDAKKFGMTVQPNKRLKMLRMQMEDIENEARQLEMTNFTEFERKKLEP 880

Query: 887  XXXXXXXXXXXXXXXXNTEEFDKENEMKTK--KLMQLRKALAAIQSETNDISKFNVEGRV 944
                                  + N+ K++  KL  LR+ALA IQ+E+N+ISKFN+E RV
Sbjct: 881  PVEVTKPKHRHKKHKIEKINQQESNDQKSRINKLNDLREALAEIQTESNNISKFNLEERV 940

Query: 945  NEMFQDXXXXXXXXXXXXXXXYKDFEIPFXXXXXXXXXXXXXXXXHST------LDPTYL 998
            NE+F +               YKDF I F                 ST      LDP   
Sbjct: 941  NELFNEKKLKALQRLKELETKYKDFGINFEMKDFLENKPNDGTKEGSTEEEYESLDPKIY 1000

Query: 999  QKKINELDEISDELYLMNYXXXXXXXXXXXXXXXXXXXXXXXXXMRSVSNAPSKGISEAG 1058
            +KK++++D ++++L  +                           +   S++     S   
Sbjct: 1001 EKKLDDIDRLTEQLLNLQKTQELREESSSSYSSSESDEENDDDEIFVASSSSKPAGSGTR 1060

Query: 1059 SFLESLSQKYGTGQNAISSPTSITSPNERIASQGEKSFMNRLKRQTMAAPFLEELTQK 1116
            SFLE+LS+KYGTGQ  ++      +PN RI +Q EK F++R++R + AAPFL+ELT+K
Sbjct: 1061 SFLETLSEKYGTGQKNVA---MTATPNSRIVTQSEKQFLDRMRRSSTAAPFLQELTEK 1115

 Score =  731 bits (1886), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 394/659 (59%), Positives = 483/659 (73%), Gaps = 40/659 (6%)

Query: 1246 MMGKKEPYKSVV--DQPSLLQLTNSDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFA 1303
            +MG K    S +    PSL +     R PR QKK+KQLHW+K+++TD+SIW+ G AERFA
Sbjct: 1281 LMGGKSVSSSPLLPQSPSLFE-----RYPRSQKKMKQLHWEKIETTDNSIWTTGKAERFA 1335

Query: 1304 DDLYEKGVLRNLEKAFAAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPE 1363
            DDL+EKGV  NLEKAFAARE+KS+ +++K+DL KI+FLS DISQQFGINLHMY SL+V +
Sbjct: 1336 DDLFEKGVFSNLEKAFAAREVKSLASKRKDDLDKITFLSRDISQQFGINLHMYSSLSVED 1395

Query: 1364 LIEKVLKCDRNLINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQK----- 1418
            L+ K+LKCDR+ ++TPSVIEFL+K EI EVSVNLARNY+PYTTDWEG+KS++  K     
Sbjct: 1396 LVTKILKCDRDFLHTPSVIEFLSKPEITEVSVNLARNYSPYTTDWEGLKSIEDAKPPEKD 1455

Query: 1419 ---FQRRIQMTYRELIKFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAV 1475
                QR  Q+ Y +L      MVNLQ YWASRMRALK+IT+YE+EYNEL+ KLRKVDKAV
Sbjct: 1456 PNDLQRADQI-YLQL------MVNLQPYWASRMRALKIITTYEKEYNELLLKLRKVDKAV 1508

Query: 1476 GAVQRSENLKNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKI 1535
            G++Q SENL+NVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKD+TNSMTFLNYVEKI
Sbjct: 1509 GSLQESENLRNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDSTNSMTFLNYVEKI 1568

Query: 1536 VRDNYPSFNDFIDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHP 1595
            +R NYPSFN F+ +LEPVL+VVK+S+EQL +DC EF QS+ NVERS+EIGNLSDSSKFHP
Sbjct: 1569 IRMNYPSFNSFLQELEPVLEVVKISIEQLANDCKEFFQSVTNVERSIEIGNLSDSSKFHP 1628

Query: 1596 SDKVLTKVLPVLPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXX 1655
             D+VL KVLP LP+  KK  LL DEV LT+MEF+ LM+ YGED                 
Sbjct: 1629 LDRVLAKVLPTLPDVRKKGDLLNDEVNLTLMEFDGLMQVYGEDTSDKFARNSFFKKFADF 1688

Query: 1656 ITEYKKAQSQNLKQEEEERAYEKHKRMIEEQQHK---QDLXXXXXXXXXXXXXXXQSDRR 1712
            I EY+KAQ QN+K EEEE AYE+HKRM+EEQQ K   ++                ++DRR
Sbjct: 1689 INEYRKAQEQNIKVEEEEEAYERHKRMVEEQQRKAERKEAKNQNNIDENEDDDQERTDRR 1748

Query: 1713 AMMDKLLEKLKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDTGDDSIVYSP-N 1771
              MDKLLE+LKN GP +ADPSSARKRAL RKK+LTDKE T +++ D++T  DSI+YSP N
Sbjct: 1749 GTMDKLLEQLKNVGPSRADPSSARKRALARKKMLTDKEGTVNMMHDLETESDSIIYSPDN 1808

Query: 1772 TPTQEGPNDIHLASPTPSGKSDLVLASVSPTKESTADGIAEDEFISDRAKALLLELRGSE 1831
                  P   + AS      ++L     SP+K    D ++E+E IS+RAK LL+ LRG+ 
Sbjct: 1809 KAIGSTPFGANGASSHKQNSNEL-----SPSK-GFRDDLSEEE-ISERAKTLLMGLRGTA 1861

Query: 1832 N-MKRNSQLEEQKEKLKARRSRRRTQTESIS-SNKLFF--TDEESHSTSPSE-SKGTEY 1885
            +  KRNS L+E KEKL+AR  RRRT  +  S SNKL F  T+E+  S  P+E S+  EY
Sbjct: 1862 SPSKRNSMLDEHKEKLRAR--RRRTNNDLPSGSNKLKFYDTNEKDISNEPTEKSEQDEY 1918

 Score =  123 bits (309), Expect = 3e-27,   Method: Compositional matrix adjust.
 Identities = 75/161 (46%), Positives = 94/161 (58%), Gaps = 12/161 (7%)

Query: 59  STELRPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTNNTSHTRAHSSQSATKYSYSRRS 118
           +T  +PLNKKSTLNTQNLSQY+   +    N      +  S +R  S+Q +T  S  R S
Sbjct: 79  TTTNKPLNKKSTLNTQNLSQYMDHARSSSTNSAS--ASKYSSSRRSSTQVSTSESLRRLS 136

Query: 119 STATGPIKXXXXXXXXXXXXXXXXXXXXYTNLLKYIDSDGKINLEMPRDPHEVEALFEDL 178
              TG                       Y N  K+I  DGK NLEMPRDP E+E LFE++
Sbjct: 137 RQHTG----------QSSSASIHSQNSSYINFSKFITPDGKTNLEMPRDPKEIENLFEEI 186

Query: 179 MYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQNEIKKL 219
           MYKRNI Q L  +KQ+ELM+YDV KKW +VKQD+QNE K++
Sbjct: 187 MYKRNILQNLSVEKQRELMNYDVRKKWLIVKQDIQNEFKRI 227

>ZYRO0F16676g Chr6 (1376370..1382354) [5985 bp, 1994 aa] {ON} some
            similarities with uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1994

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 399/839 (47%), Positives = 530/839 (63%), Gaps = 35/839 (4%)

Query: 293  RPVGSSSTASGTNSMIYQSSENNKSVSSIATDRINRPPIHYVKKIIADRLTSEEMNDLWV 352
            R + +++++   NS +Y ++  N S +++ T++INRPP +YVKKIIAD LT +E+NDLWV
Sbjct: 274  RHMKTNASSKSLNSNLYSNANANSSNTTVNTEKINRPPTYYVKKIIADDLTIDELNDLWV 333

Query: 353  TLRTEQLDWVDAFLEHQGHIAMANVLMNTIYKCAPGSELTPELQEKEHSFFKCFRVLSML 412
            TLRTEQLDWVDAFLEHQGHIAMANVLM ++YK     +LT +  E+E S+FKCFRVL ML
Sbjct: 334  TLRTEQLDWVDAFLEHQGHIAMANVLMKSLYKTTQEVKLTEKSLEREASYFKCFRVLVML 393

Query: 413  SQGLYEFAKHKLMSDTIANGLFSSRLATRKMATEVLVCMIEKRNNMRFEVVLASLDRYFR 472
            +QGLYEF KH +M++T+A  LFS RL TRKMATE+ VCM+EK+N  RF+V+L +LD+ F 
Sbjct: 394  AQGLYEFTKHAIMAETVAYALFSIRLPTRKMATEIFVCMLEKKNKSRFDVILTALDKKFM 453

Query: 473  QEENLNMVHLSKTLPGEYPQSTPNTKYKIIQAWLIALDETLNGRGKMGSLVGASDDYRSA 532
              ENL+M+   K  P ++     ++++KI+QAWL  L+  L GRGKMGSLVGAS++ R+A
Sbjct: 454  IGENLHMMQFVKNSPQQFIHLKRDSQFKIVQAWLTGLETALQGRGKMGSLVGASEEVRAA 513

Query: 533  G-ENAILEYCLWTMVFINHLCSNSSLLNQRILLRTKLENLGALRIMTKLKRLDYEKLTEQ 591
            G EN+ILEY  WTMVFINHLC  + ++NQR+LLRT+LEN GALRIM + K LDY+K+T Q
Sbjct: 514  GGENSILEYSQWTMVFINHLCMGTDVVNQRVLLRTRLENAGALRIMNRFKLLDYDKITAQ 573

Query: 592  IELYDNNKLDDFNTVLETESKNSKVNMQNPNSLIENLWESCKGSDNEKXXXXXXXXXXXX 651
            IE Y+N KLDD N +LE+E +N++VNMQ+P  +++ +W+ CKG++NEK            
Sbjct: 574  IEYYENGKLDDINNLLESEGRNTQVNMQDPMMMLQTMWDYCKGTENEKTFISLIKHLFLS 633

Query: 652  XXKLMGEKEDPTKLSKQLKLIDSLLTNVNGSMFDEESHMNLAIQRLYDSMQTDEVARRAI 711
              K+  ++ DP+KL+KQLKL+DSL+ NV+ S  DEES +N+AIQRLYD+MQTDEVARRAI
Sbjct: 634  SSKVADDRGDPSKLAKQLKLMDSLVANVSVSAVDEESSVNVAIQRLYDAMQTDEVARRAI 693

Query: 712  LESRTLTKKLEEAHAERDYLSNKLSNAENGLVGQLESDLKQRDNILEKNQRVMXXXXXXX 771
            LESR LTK+LEE  AERD+L  KL++  +G+VG+LE +LKQRD+IL KNQRV        
Sbjct: 694  LESRQLTKELEEIQAERDFLRQKLNSTGDGIVGRLEEELKQRDDILAKNQRVNRHLQAEL 753

Query: 772  XXXXXXXXXXXXXXXXXXXXMLTILNSR----NGTQNPDVDDVTITLDPNKKLDIQKALE 827
                                MLTILN+R    N  ++  V      LDP+++  IQKAL+
Sbjct: 754  EELKKKHLLEKHEHEVELRKMLTILNARPDDENLAKSTKVTKSVNGLDPDRQTSIQKALQ 813

Query: 828  LELNKTKKDLSNDSKRFGITVQPNKRLKMLRMQMEDIENEARQLEMTNFADHKRTNXXXX 887
              L +T+KDLS DSKRFGITVQPNKRL+MLRM+ME IE EAR+LEMTNFA+H+       
Sbjct: 814  DGLQRTRKDLSVDSKRFGITVQPNKRLRMLRMKMEGIEQEARELEMTNFAEHEEKQLEEP 873

Query: 888  XXXXXXXXXXXXXXXNTEEFDKENEMKTKKLMQLRKALAAIQSETNDISKFNVEGRVNEM 947
                                  + +   +KL +LRK L+ IQ ETN+++KFNVE RV E+
Sbjct: 874  VGTGT-----------------KKKAGVRKLSELRKQLSDIQKETNEVTKFNVEERVKEL 916

Query: 948  FQDXXXXXXXXXXXXXXXYKDFEIPFXXXXXXXXXXXXXXXXHSTLDPTYL---QKKINE 1004
            F                 YK F I F                   +D   L   Q+K++E
Sbjct: 917  FNQKRLKALKRLKELETTYKGFGIDFNANALLESKGGDIHWNDDEIDGQDLQGAQEKMDE 976

Query: 1005 LDEISDELYLM-------NYXXXXXXXXXXXXXXXXXXXXXXXXXMRSVSNAPSKGISEA 1057
            +D I++EL  M       N                            S  +  S G S A
Sbjct: 977  MDRIANELTAMKMKVEIQNQQQHTDSSSTESSSEDDDGATGSRTDTASEFSQKSFG-SGA 1035

Query: 1058 GSFLESLSQKYGTGQNAISSPTSITSPNERIASQGEKSFMNRLKRQTMAAPFLEELTQK 1116
            GSFLE+LSQKYG GQN   S +      +R +S    SF NR+K+   A P+ +ELT+K
Sbjct: 1036 GSFLEALSQKYGAGQNTTISNSPFPGV-DRKSSNHRTSFANRMKKSN-ATPYFDELTRK 1092

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 389/657 (59%), Positives = 485/657 (73%), Gaps = 33/657 (5%)

Query: 1248 GKKEPYKSVVDQPSLLQLTNS--DRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADD 1305
            G+K+ Y+S  D  + L+ T +  D  P+P KKLKQLHW+KLD+T+ SIWS G+AE+FA D
Sbjct: 1236 GQKKMYRS--DMSNYLEETPTFRDNYPQPHKKLKQLHWEKLDATEDSIWSSGVAEKFAGD 1293

Query: 1306 LYEKGVLRNLEKAFAAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELI 1365
            LYEKGVL  LEKAFAAREIK++ T+KKEDL KI+FLSHD SQQFGINLHMY  ++V +L+
Sbjct: 1294 LYEKGVLAGLEKAFAAREIKNLATKKKEDLKKITFLSHDFSQQFGINLHMYSHMSVNDLV 1353

Query: 1366 EKVLKCDRNLINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQK------- 1418
             K+LKCDR+ + TPSVIEFL+KSEI EVSVNLARN++PY+TDW+G+KSL+  K       
Sbjct: 1354 IKILKCDRDFMQTPSVIEFLSKSEITEVSVNLARNFSPYSTDWDGIKSLEDAKPPEKDPN 1413

Query: 1419 -FQRRIQMTYRELIKFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGA 1477
              QR  Q+ Y +LI       NLQ+YW SRMRA+KVITSY++EY ELVTKLRKVDKAVGA
Sbjct: 1414 DLQRADQI-YLQLI------FNLQAYWGSRMRAIKVITSYDKEYLELVTKLRKVDKAVGA 1466

Query: 1478 VQRSENLKNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVR 1537
            + +SENL N+FNVILAVGN+MNDT+K+AQGFKLSTLQRLTFIKD  NSMTFLNYVEKI+R
Sbjct: 1467 ILKSENLSNIFNVILAVGNFMNDTAKRAQGFKLSTLQRLTFIKDTNNSMTFLNYVEKIIR 1526

Query: 1538 DNYPSFNDFIDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSD 1597
             NYPSFNDF+ +LEPVL+V K+S++QL++DCNE+ Q++ NVERS+EIGNLSDSSKFHP D
Sbjct: 1527 GNYPSFNDFLKELEPVLNVTKISIDQLVNDCNEYCQAVTNVERSIEIGNLSDSSKFHPLD 1586

Query: 1598 KVLTKVLPVLPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXIT 1657
            +VL KVLPVLPEA KK  LL DEV+L+IMEFE LM+KYGED G               + 
Sbjct: 1587 RVLIKVLPVLPEARKKCDLLDDEVRLSIMEFENLMQKYGEDTGDKFAKNSFFKKFADFVQ 1646

Query: 1658 EYKKAQSQNLKQEEEERAYEKHKRMIEEQQHKQDLXXX----XXXXXXXXXXXXQSDRRA 1713
            EYKKAQ+QNLK EEEER YE+HK+M+EEQQ ++                       DRRA
Sbjct: 1647 EYKKAQNQNLKVEEEERVYERHKKMVEEQQRREQTPSKNRDYVVNEDEDIADDDDQDRRA 1706

Query: 1714 MMDKLLEKLKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDTGDDSIVYSPNTP 1773
            MMDKLL++LKNAGP  +DPSSARKRAL+R+KL  DK+  AH++ D+D+ +DSIVYSPN  
Sbjct: 1707 MMDKLLDQLKNAGPTTSDPSSARKRALMRRKLQADKDAAAHLISDLDSNEDSIVYSPNA- 1765

Query: 1774 TQEGPNDIHLASPTPSGKSD----LVLASV-SPTKES-TAD--GIAEDEFISDRAKALLL 1825
            +Q+   +   ASPT    S+     VL+ + SP K S  AD     E+E ISD+AK LL+
Sbjct: 1766 SQDQSANAEEASPTVHKGSNKNNKPVLSDLESPIKASRNADRNNENEEEEISDKAKNLLM 1825

Query: 1826 ELRG-SENMKRNSQLEEQKEKLKARRSRRRTQTESISSNKLFFTDEESHSTSPSESK 1881
            EL G     +R   L   KE+L+ARR R +   E ISSNKL F D+E+   +P++S+
Sbjct: 1826 ELSGNGAPTRREELLNGHKERLRARRRRTQGHGELISSNKLAFLDDETPPVTPTDSE 1882

 Score =  112 bits (279), Expect = 1e-23,   Method: Compositional matrix adjust.
 Identities = 73/199 (36%), Positives = 110/199 (55%), Gaps = 39/199 (19%)

Query: 43  ADISSPKKPIVPKQFT-STELRPLNKKSTLN-----TQNLSQYVSGTK----------ID 86
            DISSPKK  VP + T + +LRPLN     +     ++  SQ  +G+K          I 
Sbjct: 59  GDISSPKKVSVPSRVTNANDLRPLNHHYNHHHNHHHSRTPSQQSTGSKYTYPKRTSSSIT 118

Query: 87  QDNPNPLPTNNTSH-----TRAHSSQSATKYSYSRRSSTATGPIKXXXXXXXXXXXXXXX 141
             NP+ LP+++ +      T    S+  T +S++   S+A   +                
Sbjct: 119 GGNPS-LPSSSATPIPAPVTPGQLSRQQTNHSHANSQSSAASVL---------------- 161

Query: 142 XXXXXYTNLLKYIDSDGKINLEMPRDPHEVEALFEDLMYKRNIFQALPQDKQKELMSYDV 201
                 TNL +++  DGK+ L+MP+D HEVE+LFED+MYKRNI Q LP +KQ+EL +YD+
Sbjct: 162 -SQGSLTNLGRFMRPDGKVRLDMPQDYHEVESLFEDIMYKRNIMQTLPPEKQQELRNYDI 220

Query: 202 TKKWTLVKQDLQNEIKKLM 220
            KKW +V+QDL +++KK+M
Sbjct: 221 DKKWLIVRQDLSSDLKKMM 239

>TBLA0A05440 Chr1 complement(1337261..1343773) [6513 bp, 2170 aa] {ON}
            Anc_1.82 YNL271C
          Length = 2170

 Score =  713 bits (1840), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 374/629 (59%), Positives = 461/629 (73%), Gaps = 44/629 (6%)

Query: 1269 DRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKGVLRNLEKAFAAREIKSIG 1328
            ++ PR QKKLKQLHW+KLD TD+SIW  G AE FADDL+EKGVL+ LE AFAAREIKS+ 
Sbjct: 1437 EKYPRSQKKLKQLHWEKLDDTDNSIWVNGKAEEFADDLFEKGVLKRLESAFAAREIKSLA 1496

Query: 1329 TRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEFLAKS 1388
            ++KKED +KI++LS DISQQFGINLHM+ +L V +LIEK+++CDR+++NTPSVI+FL+K 
Sbjct: 1497 SKKKEDSTKITYLSRDISQQFGINLHMFSNLTVDQLIEKIIRCDRSILNTPSVIDFLSKQ 1556

Query: 1389 EIVEVSVNLARNYAPYTTDWEGVKSLKMQK--------FQRRIQMTYRELIKFIYNMVNL 1440
            EIVEVSVNLAR+YAPY+TDWEGVK +K  K         QR  Q+ Y +L      MVNL
Sbjct: 1557 EIVEVSVNLARSYAPYSTDWEGVKDVKDAKPPEKDPNELQRADQI-YLQL------MVNL 1609

Query: 1441 QSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMND 1500
            QSYW SRM ALKV+TSYE++++EL+ KLR+VD AVG++Q+SENLKNVFNVILAVGN+MND
Sbjct: 1610 QSYWGSRMIALKVVTSYEKDFDELIRKLRRVDLAVGSIQKSENLKNVFNVILAVGNFMND 1669

Query: 1501 TSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLS 1560
             SKQAQGFKL+TLQRLTFIKD+TN+MTFLNYVE I+R NYP FNDF+++L+PVLDVVK+S
Sbjct: 1670 ASKQAQGFKLATLQRLTFIKDSTNNMTFLNYVESIIRQNYPEFNDFLNELQPVLDVVKVS 1729

Query: 1561 VEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDE 1620
            +EQL+ DC EFSQ I+NV RS+EIG LSDSSKFHP DKVL KVLPVLPEA KK+ LL+DE
Sbjct: 1730 IEQLVRDCKEFSQGIINVGRSVEIGKLSDSSKFHPQDKVLIKVLPVLPEATKKADLLSDE 1789

Query: 1621 VKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEEEERAYEKHK 1680
            VKL+IMEFE LM+ +GED+                I EYK+AQ QNLK EEEER YE HK
Sbjct: 1790 VKLSIMEFENLMQVFGEDSKDKFAKNSFFKKFADFINEYKRAQEQNLKVEEEERIYENHK 1849

Query: 1681 RMIEEQQH-----KQDLXXXXXXXXXXXXXXXQSDRRAMMDKLLEKLKNAGPGKADPSSA 1735
            + IEEQQ      K+                   DRR +MDKLLE+LKN GP K DP+SA
Sbjct: 1850 KRIEEQQKRLEDSKKKSHSDDTSNTDGTEEEEDEDRRDVMDKLLEQLKNVGPVKTDPTSA 1909

Query: 1736 RKRALVRKKLLTDKEVTAHILQDIDTGDDSIVYSPNTPTQEGPNDI---HLASPTPSGKS 1792
            RKRA+VRKKL  +KE  + IL++ +TG+DSIVYSP T ++  P  +   +L SPTP  KS
Sbjct: 1910 RKRAMVRKKLQNEKETASQILKEFETGEDSIVYSP-TDSKITPKKVSNEYLQSPTPGEKS 1968

Query: 1793 DLV-------------LASVSPTKESTADGIAEDEFISDRAKALLLELRGSEN-MKRNSQ 1838
             L                    T +S+ D +  D+ I DRAK+LL ELRGS+   ++NS 
Sbjct: 1969 SLADMTSTPNPTTITTTTDGKVTNDSSNDDL--DQEIVDRAKSLLFELRGSQTPTRKNSV 2026

Query: 1839 LEEQKEKLKARRSRRRTQTESISSNKLFF 1867
            LEE+KEKL+ARR      T  ++SNKL F
Sbjct: 2027 LEERKEKLRARRR----NTSDLTSNKLKF 2051

 Score =  699 bits (1803), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/855 (48%), Positives = 525/855 (61%), Gaps = 59/855 (6%)

Query: 314  NNKSVSSIATDRINRPPIHYVKKIIADRLTSEEMNDLWVTLRTEQLDWVDAFLEHQGHIA 373
            NNK+ S+++ DR NR P  Y+K+I+ DRL+ +EMNDLWVTLRTEQL WV+ FLE QGHIA
Sbjct: 407  NNKA-SALSPDRTNRLPNDYIKEILNDRLSVDEMNDLWVTLRTEQLTWVNTFLEDQGHIA 465

Query: 374  MANVLMNTIYKC-APGSELTPELQEKEHSFFKCFRVLSMLSQGLYEFAKHKLMSDTIANG 432
            MAN LM +IY+     + L+  L +KE++FFKCFRVLSMLSQGL EF KHKLM+DT+  G
Sbjct: 466  MANSLMKSIYRINTMQNSLSTYLIDKEYNFFKCFRVLSMLSQGLTEFIKHKLMTDTLVQG 525

Query: 433  LFSSRLATRKMATEVLVCMIEKRNNMRFEVVLASLDRYFRQEENLNMVHLSKTLPGEYP- 491
            LFS+RLATRK+ATE+ V M++K N+    ++L + D+ F   ENLNMV+L K +P +Y  
Sbjct: 526  LFSTRLATRKIATEIFVLMLQKINDDGLNILLTTFDKTFSINENLNMVYLLKNVPDKYHY 585

Query: 492  -QSTPNTKYKIIQAWLIALDETLNGRGKMGSLVGASDDYR-SAGENAILEYCLWTMVFIN 549
              ST  T+ K++ +WL A++ TL+GRGKMGSLVGAS D++ + GENAILEYC WTMV IN
Sbjct: 586  LNSTNTTQIKVLVSWLYAVESTLDGRGKMGSLVGASQDFKITGGENAILEYCQWTMVLIN 645

Query: 550  HLCSNSSLLNQRILLRTKLENLGALRIMTKLKRLDYEKLTEQIELYDNNKLDDFNTVLET 609
             LC+ S+++NQR+LLRTKLEN+G++RIM KLK+LDYEK+TEQ+E Y+N KLDD NT+LE 
Sbjct: 646  RLCNASTIINQRVLLRTKLENIGSIRIMNKLKKLDYEKITEQLEDYENKKLDDLNTLLEQ 705

Query: 610  ESKNSKVNMQNPNSLIENLWESCKGSDNEKXXXXXXXXXXXXXXKLMGEKEDPTKLSKQL 669
            ++K+S V++ NP SL+ +L E CK ++ E+              KL  +K+DPTKLSKQL
Sbjct: 706  DTKSS-VDLDNPISLLSHLLEVCKDTEGEQSLTSIIQHLYLSSSKLFDDKDDPTKLSKQL 764

Query: 670  KLIDSLLTNVNGSMFDEESHMNLAIQRLYDSMQTDEVARRAILESRTLTKKLEEAHAERD 729
            KL+DSL+T+   S  D ES MN+AIQ LYDSM TD+VARRAILESR LTKKLEE  AERD
Sbjct: 765  KLMDSLMTDATLSTVDNESKMNMAIQHLYDSMVTDDVARRAILESRNLTKKLEEVQAERD 824

Query: 730  YLSNKLSNAENGLVGQLESDLKQRDNILEKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXX 789
            +LSN+LS AENGLVG+LE++L QRD+IL KNQRV                          
Sbjct: 825  FLSNRLSEAENGLVGKLENELAQRDSILAKNQRVTQQLRTELDELKKKHLMEKHDHEVEL 884

Query: 790  XXMLTILNSRNGTQNPDVDDVTITLDPNK-------KLD-------IQKALELELNKTKK 835
              MLTILNSR  T+   +D+   ++   K       KL+       I+KAL+  L KTKK
Sbjct: 885  RKMLTILNSRPETE---LDNTMSSISRTKRNKHEIEKLELLKRKKVIEKALQDGLQKTKK 941

Query: 836  DLSNDSKRFGITVQPNKRLKMLRMQMEDIENEARQLEMTNFADHKRT---NXXXXXXXXX 892
            DLS DSKRFGITVQPNKRL+ LR+QMEDIENEARQLEMTNF D  RT             
Sbjct: 942  DLSLDSKRFGITVQPNKRLQALRLQMEDIENEARQLEMTNFTDPVRTPKKGQEKRDSHNK 1001

Query: 893  XXXXXXXXXXNTEEFDKENEM--KTKKLMQLRKALAAIQSETNDISKFNVEGRVNEMFQD 950
                        +  D+  EM  K +KL +LRKALA IQ ETNDIS+FNVE  VNE+F  
Sbjct: 1002 HPSLKPGIPIAKKNKDRSEEMAKKQQKLAELRKALADIQQETNDISRFNVEEHVNELFNA 1061

Query: 951  XXXXXXXXXXXXXXXYKDFEIPFXXXXXXXXXXXXXXX------XHSTLDPTYLQKKINE 1004
                           Y++F + F                      + TLDP     K++E
Sbjct: 1062 KKIQAMERLKELETMYQNFGVDFNMEEFLEKNNTSTKELDPDSPAYETLDPNLFIDKMDE 1121

Query: 1005 LDEIS------------------DELYLMNYXXXXXXXXXXXXXXXXXXXXXXXXXMRSV 1046
            LD+ S                  + L   N                            +V
Sbjct: 1122 LDKFSMKLDQLTSDLNNTMSAKQNSLSTTNSNQISTPSSTSSSDFESDEENENTALSNNV 1181

Query: 1047 SNAPS----KGISEAGS-FLESLSQKYGTGQNAISSPTSITSPNERIASQGEKSFMNRLK 1101
            ++  S    +  +  GS FLESLSQKYGTGQNA S P S  +PN       E+ FM+R+K
Sbjct: 1182 NDNSSTFSHQSTTSGGSSFLESLSQKYGTGQNA-SGPMSSNTPNVS-HYNPERKFMSRMK 1239

Query: 1102 RQTMAAPFLEELTQK 1116
            +Q     ++ EL QK
Sbjct: 1240 KQHATPNYIRELNQK 1254

 Score =  130 bits (328), Expect = 2e-29,   Method: Compositional matrix adjust.
 Identities = 76/176 (43%), Positives = 104/176 (59%), Gaps = 18/176 (10%)

Query: 64  PLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTNNTSHTRAHSSQSATKYSYSRRSS---- 119
           PLN +++L   N++QYV+     + N +   + NTS    +S+  +TKYSYSRR S    
Sbjct: 95  PLNMRNSLTNPNMNQYVTSPYTHEYNNSH--SRNTSINSVNSNPLSTKYSYSRRGSNQIL 152

Query: 120 --TATGPI----------KXXXXXXXXXXXXXXXXXXXXYTNLLKYIDSDGKINLEMPRD 167
             + TG            +                      NL+K++  DGK+NLEMP +
Sbjct: 153 SPSPTGNSSNNNTSNINPQQRYSVHSNNPNSSSILSQGSLHNLMKFMTPDGKVNLEMPNN 212

Query: 168 PHEVEALFEDLMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQNEIKKLMSKS 223
           P EVEAL+ED+MYKRNI Q LP DKQ+ELMSYDV+KKW +VKQDLQ+E+KK+ SK+
Sbjct: 213 PAEVEALYEDIMYKRNILQNLPADKQRELMSYDVSKKWLIVKQDLQSELKKMRSKN 268

>NDAI0F04220 Chr6 (1024727..1030795) [6069 bp, 2022 aa] {ON} 
          Length = 2022

 Score =  700 bits (1806), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/603 (61%), Positives = 448/603 (74%), Gaps = 33/603 (5%)

Query: 1260 PSLLQLTNSDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKGVLRNLEKAF 1319
            PSL +       PRP KKLKQLHW+K+++TD+SIW    AE+FADDLYEKGVL  LE AF
Sbjct: 1343 PSLFE-----NYPRPHKKLKQLHWEKVEATDNSIWRANKAEQFADDLYEKGVLSELENAF 1397

Query: 1320 AAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTP 1379
            AAREIKS+ +++K+DL KI+FLSHD+SQQFGINLHMY SL VP+LI K+LKCDR+ + TP
Sbjct: 1398 AAREIKSLASKQKKDLQKITFLSHDVSQQFGINLHMYASLDVPDLITKILKCDRDFLQTP 1457

Query: 1380 SVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQK--------FQRRIQMTYRELI 1431
            SVIEFL++ EIV+VSVNLARNYAPY  DWEG+K+++  K         QR  Q+ Y +L 
Sbjct: 1458 SVIEFLSRPEIVDVSVNLARNYAPYMQDWEGIKNVEDAKPPEKNPNELQRADQI-YLQL- 1515

Query: 1432 KFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVI 1491
                 MVNLQSYW SRMRALKVIT++E+EYNEL+TKLRKVD+AV ++Q SENLKNVF VI
Sbjct: 1516 -----MVNLQSYWGSRMRALKVITTFEKEYNELLTKLRKVDRAVSSLQESENLKNVFGVI 1570

Query: 1492 LAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRDNYPSFNDFIDDLE 1551
            LAVGNYMNDTSKQAQGFKL+TLQRLTFIKD+TN+MTFLNYVEKIVR NYP+FN F+ +LE
Sbjct: 1571 LAVGNYMNDTSKQAQGFKLATLQRLTFIKDSTNTMTFLNYVEKIVRTNYPAFNKFLVELE 1630

Query: 1552 PVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAA 1611
            PVLDVVK+S+EQL+ DC EFSQSIVNVERS+EIGNLSDSSKFHP D+VL KVLP LP+A 
Sbjct: 1631 PVLDVVKISIEQLVDDCKEFSQSIVNVERSIEIGNLSDSSKFHPFDRVLAKVLPSLPDAR 1690

Query: 1612 KKSSLLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEE 1671
            KK  LL DEVKLTIMEF  LM+ YGED+G               ITEYKKAQ+QNL+ EE
Sbjct: 1691 KKGELLGDEVKLTIMEFLRLMQIYGEDSGDKFAKNSFFKKFADFITEYKKAQTQNLRLEE 1750

Query: 1672 EERAYEKHKRMIEEQQHK-QDLXXXXXXXXXXXXXXXQ---SDRRAMMDKLLEKLKNAGP 1727
            EE+ YE+HK+M+EEQQ K Q+                +    D RA+MD LLE+LKN  P
Sbjct: 1751 EEKVYERHKKMVEEQQRKAQEAEISRVNSGTDGTKDDEDGPGDGRAIMDTLLEQLKNVTP 1810

Query: 1728 -GKADPSSARKRALVRKKLLTDKEVTAHILQDIDTGDDSIVYSPNTPTQEGPNDIHLASP 1786
              K DPSSARKRALVRKKL+   E T++IL+DIDT DDSI+YSP+   +     + +A+ 
Sbjct: 1811 TNKTDPSSARKRALVRKKLMG--ESTSNILKDIDTEDDSIIYSPDA-KKPMATTVDMANT 1867

Query: 1787 TPSGKSDL---VLASVSPTKESTADGI-AEDEFISDRAKALLLELRGSEN-MKRNSQLEE 1841
            T   + D+      + SP K   +  +  E+E I +RA+ALL++L GS +  KR+S L E
Sbjct: 1868 TLESELDVSSPTRHNSSPIKNEISMNVDEEEEEIGNRAQALLIQLTGSHSPTKRHSLLNE 1927

Query: 1842 QKE 1844
             KE
Sbjct: 1928 HKE 1930

 Score =  697 bits (1798), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/702 (52%), Positives = 474/702 (67%), Gaps = 17/702 (2%)

Query: 323  TDRINRPPIHYVKKIIADRLTSEEMNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMNTI 382
            TD+ NR PI YVKKII+D LTSEEM DLWVTLRTEQLDWVDAF+EHQGHIAMANVLM +I
Sbjct: 331  TDKTNRLPIEYVKKIISDTLTSEEMKDLWVTLRTEQLDWVDAFIEHQGHIAMANVLMKSI 390

Query: 383  YKCAPGSELTPELQEKEHSFFKCFRVLSMLSQGLYEFAKHKLMSDTIANGLFSSRLATRK 442
            YK  P  +LT +L EKE+SFFKCFRVLSMLSQGL EF KH+LM+ TIA GLFS+ L+TRK
Sbjct: 391  YKTTPNEKLTSQLLEKENSFFKCFRVLSMLSQGLREFTKHELMAQTIARGLFSTTLSTRK 450

Query: 443  MATEVLVCMIEKRNNMRFEVVLASLDRYFRQEENLNMVHLSKTLPGEYPQSTPNTKYKII 502
            MATE+ VCM+ K+N  RF+V+L  LD+ F+  +NL+M H  K     +   T ++  K+ 
Sbjct: 451  MATEIFVCMLNKKNPERFKVILNVLDQKFKIGQNLHMAHNLKKFGEYFGPLTLDSNLKVT 510

Query: 503  QAWLIALDETLNGRGKMGSLVGASDDYR-SAGENAILEYCLWTMVFINHLCSNSSLLNQR 561
            +AWL A++ +L+GRGKMGS VGASDDY+ S GENA LEYC W+M+FINHLC  S  +NQR
Sbjct: 511  RAWLFAVEHSLDGRGKMGSFVGASDDYKNSGGENATLEYCQWSMIFINHLCLCSDNINQR 570

Query: 562  ILLRTKLENLGALRIMTKLKRLDYEKLTEQIELYDNNKLDDFNTVLETESKNSKVNMQNP 621
            +LLR KLE  G +RIM ++K L YEK+ EQI++Y+N+KLDD N +LE  +KN+ +N+ +P
Sbjct: 571  MLLRNKLEYCGIVRIMNQIKSLHYEKVIEQIDVYENSKLDDINKLLELSNKNANINLHDP 630

Query: 622  NSLIENLWESCKGSDNEKXXXXXXXXXXXXXXKLMGEKEDPTKLSKQLKLIDSLLTNVNG 681
             SL++NLW++CKG++NEK              +L+ +K+D T+LSKQLKL+DSL+TNV+ 
Sbjct: 631  TSLVKNLWDACKGTENEKLLISLVQHLFLSSSQLIEDKQDATQLSKQLKLMDSLVTNVSV 690

Query: 682  SMFDEESHMNLAIQRLYDSMQTDEVARRAILESRTLTKKLEEAHAERDYLSNKLSNAENG 741
            +  D+ES MN+AIQRLYD+MQTDEVARR+ILESRTLTKKLEE+ AE D LS KL NAE+G
Sbjct: 691  ASTDQESTMNMAIQRLYDAMQTDEVARRSILESRTLTKKLEESQAEIDLLSQKLKNAEHG 750

Query: 742  LVGQLESDLKQRDNILEKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXXXMLTILNSRNG 801
            LVGQL+ +L+QRD +  KNQR+                            MLTILN+R+ 
Sbjct: 751  LVGQLQDELRQRDRMFAKNQRITEQLQAELEDLKKKHLLEKHEQEVELRKMLTILNARSD 810

Query: 802  TQNPDVDD------VTITLDPNKKLDIQKALELELNKTKKDLSNDSKRFGITVQPNKRLK 855
                +         +  + + +KK +IQK L+  LN+TKKD + DSK FG+TVQPNKRLK
Sbjct: 811  KGEIEKKSSKKHKRIPGSFESSKKQNIQKVLQEGLNRTKKDFTMDSKSFGMTVQPNKRLK 870

Query: 856  MLRMQMEDIENEARQLEMTNFADHKRTNXXXXXXXXXXXXXXXXXXXNTEEFDKENEMKT 915
             LRMQMEDIENEAR+LEMTNFA+ ++                       +   KE + K 
Sbjct: 871  ALRMQMEDIENEARELEMTNFAEFEK-----KKLEPAPKIKKLKQKKQNKNEKKEEDDKI 925

Query: 916  KKLMQLRKALAAIQSETNDISKFNVEGRVNEMFQDXXXXXXXXXXXXXXXYKDFEIPF-- 973
            KKL +LR+ LA IQ+E+NDISKFNVE RVNE+F +               YKDF I F  
Sbjct: 926  KKLNELRQTLANIQNESNDISKFNVEERVNELFNEKRSTALQRLKELETKYKDFGINFNI 985

Query: 974  ---XXXXXXXXXXXXXXXXHSTLDPTYLQKKINELDEISDEL 1012
                               +S+LDP   Q K++EL+ I+++L
Sbjct: 986  DDISEKTTGIDNSGDKSTEYSSLDPNAYQIKLDELNRITEQL 1027

 Score =  120 bits (302), Expect = 2e-26,   Method: Compositional matrix adjust.
 Identities = 68/173 (39%), Positives = 98/173 (56%), Gaps = 20/173 (11%)

Query: 58  TSTELRPLNKKSTLNTQNLSQYVSGTKI------DQDNPNPLPTNNTSHTRAHSSQSATK 111
           +S E++PL K +TLNTQNLSQY++   I           +   + ++    + ++ S T 
Sbjct: 74  SSNEIKPLIKNTTLNTQNLSQYINSKNIPDHSRSQSIQSSSKYSYSSRRASSQTNPSVTG 133

Query: 112 YSYSRRSSTATGPIKXXXXXXXXXXXXXXXXXXXXYTNLLKYIDSDGKINLEMPRDPHEV 171
           Y   R+ +  +  +                     Y+NL K++  DGK+NLEMP DP E+
Sbjct: 134 YKLDRQYTNQSSAV--------------SVLSQGSYSNLSKFMTHDGKLNLEMPTDPSEI 179

Query: 172 EALFEDLMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQNEIKKLMSKSS 224
           E L++++M KRNI Q+LP  KQ ELMSYD+ KKW +VKQDLQNE KK  SK +
Sbjct: 180 EYLYQEIMIKRNILQSLPGTKQDELMSYDIGKKWLIVKQDLQNEWKKFKSKGA 232

 Score = 52.8 bits (125), Expect = 1e-05,   Method: Compositional matrix adjust.
 Identities = 28/62 (45%), Positives = 37/62 (59%), Gaps = 5/62 (8%)

Query: 1055 SEAGSFLESLSQKYGTGQNAISSPTSITSPNERIASQGEKSFMNRLKRQTMAAPFLEELT 1114
            S AGSFLE+LSQKY  GQN  SSP       +R     +  F+NR+++  +   FLEEL+
Sbjct: 1092 SAAGSFLEALSQKYAMGQNNPSSPQ-----RDRPVKASQYDFINRVRKNNITPQFLEELS 1146

Query: 1115 QK 1116
             K
Sbjct: 1147 GK 1148

>SAKL0C02618g Chr3 complement(240920..246886) [5967 bp, 1988 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1988

 Score =  659 bits (1699), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 368/678 (54%), Positives = 468/678 (69%), Gaps = 52/678 (7%)

Query: 1253 YKSVVDQPSLLQLTN-SDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKGV 1311
            Y++    P L Q  +  +R PRP+KKLKQLHW+K++ T +SIW    AE++ADDLYE+GV
Sbjct: 1291 YRAATPSPLLPQSPSLFERYPRPKKKLKQLHWEKIEDTGNSIWKDAKAEKYADDLYERGV 1350

Query: 1312 LRNLEKAFAAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKC 1371
            L  LEKAFAAREIK +  R+KEDL+K++FLS D+SQQFGINLHMY +L+V E++ K+L+C
Sbjct: 1351 LAQLEKAFAAREIKLLANRRKEDLNKVTFLSRDVSQQFGINLHMYAALSVKEVVHKILRC 1410

Query: 1372 DRNLINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQK--------FQRRI 1423
            D++ + + SVI+FL K EIVEVS NLARN+APY+T+WEGV S+   K         QR  
Sbjct: 1411 DKDFLGSASVIDFLLKPEIVEVSNNLARNFAPYSTEWEGVSSVDEAKTPEKDPGELQRAD 1470

Query: 1424 QMTYRELIKFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSEN 1483
            Q+ Y E+      MVNLQ YWASRMRALKVIT+YE+EY++L+TKLR +DKAV ++Q S+N
Sbjct: 1471 QL-YLEM------MVNLQGYWASRMRALKVITTYEKEYSDLLTKLRSIDKAVSSIQHSDN 1523

Query: 1484 LKNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRDNYPSF 1543
            L++VF VILAVGNYMND+SKQA GFKL+TLQRLTFIKD  NSMTFLNYVEKI+R+NY  F
Sbjct: 1524 LRSVFEVILAVGNYMNDSSKQAHGFKLATLQRLTFIKDEKNSMTFLNYVEKIIRENYAEF 1583

Query: 1544 NDFIDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKV 1603
            N F+ +LEPVLDVVK+SVEQL +DC EFSQ+IVNVERS+E+GNLSDSSKFHP D+VL KV
Sbjct: 1584 NSFLQELEPVLDVVKISVEQLAADCREFSQNIVNVERSIEVGNLSDSSKFHPWDRVLVKV 1643

Query: 1604 LPVLPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQ 1663
            LPVLPEA K+S LL+DEVKLT+MEF+ LM+ +GEDA                I EYKKAQ
Sbjct: 1644 LPVLPEARKRSDLLSDEVKLTLMEFDGLMQMFGEDASDKFAKNSFFKKFADFIQEYKKAQ 1703

Query: 1664 SQNLKQEEEERAYEKHKRMIEEQQHKQDLXXXXX----XXXXXXXXXXQSDRRAMMDKLL 1719
            + N+K EEEERAYE+ K+M+EEQ  +  L                       R +MDKLL
Sbjct: 1704 AHNIKMEEEERAYERRKKMVEEQHKRARLEAEKGGVDDGSEAEGVTAVSRGERDVMDKLL 1763

Query: 1720 EKLKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDTGD-----DSIVYSPNTPT 1774
            EKLKNAGPGK+DPSSARKRAL RKKLL  K  +A+IL + +  +      S+VYSP T T
Sbjct: 1764 EKLKNAGPGKSDPSSARKRALARKKLLDGKRSSANILDNFEVDEAAPVNQSLVYSPET-T 1822

Query: 1775 QEGPNDIHLASPTPSGKSDLVLASV---------SPTKESTADGIAEDEFISDRAKALLL 1825
             +  N  H  SPTP       +A           SP+K+++A      E ++DRA+ LL 
Sbjct: 1823 LKAANAAHAESPTPKASRQGSVAGSGATATPLLESPSKQASAG----PEDVADRARNLLK 1878

Query: 1826 ELRGSENMKRNSQLEEQKEKLKARRSRRRTQTESISSNKLFFTDEESHSTSPSES-KGTE 1884
            ELRG E+ KR   LE+ +EK++A   RRR    + S NKL F      S +P++S KG  
Sbjct: 1879 ELRGPESEKRKPLLEDHREKMRA--RRRRVNEGASSENKLVFVG--GASEAPTDSHKGLP 1934

Query: 1885 YEMT--------TANEEP 1894
             + T        +A++EP
Sbjct: 1935 NDTTADIPATPVSADDEP 1952

 Score =  580 bits (1496), Expect = e-173,   Method: Compositional matrix adjust.
 Identities = 350/864 (40%), Positives = 485/864 (56%), Gaps = 57/864 (6%)

Query: 296  GSSSTASGT--NSMIYQSSENNKSVSSIATDRINRPPIHYVKKIIADRLTSEEMNDLWVT 353
            G +ST+S        Y+S   N S ++++ D ++  P +YV+KII+D+++++++ DLWV+
Sbjct: 265  GHNSTSSPILGGGGFYESGNQNSSTATLSQDPLHLSPDYYVRKIISDKISTKQLKDLWVS 324

Query: 354  LRTEQLDWVDAFLEHQGHIAMANVLMNTIYKCAPGSELTPELQEKEHSFFKCFRVLSMLS 413
            LRTEQLDWV  FL+ QG +A+ANVL+   +K +P + L  E  +KE +FFKC + L  L 
Sbjct: 325  LRTEQLDWVVGFLDAQGQVAIANVLLRFFHKESPDALLNDEALDKEFAFFKCLKTLLNLK 384

Query: 414  QGLYEFAKHKLMSDTIANGLFSSRLATRKMATEVLVCMIEKRNNMRFEVVLASLDRYFRQ 473
            +G  E  + KL+   I +GL S R++TR++A+E+LV + +         V+  LD+    
Sbjct: 385  EGANEAVRTKLVVSAITDGLLSLRISTRRIASEMLVFITQWDIPYGLNQVIGELDQESHV 444

Query: 474  EENLNMVHLSKTLPGEYPQS-----------TPNTKYKIIQAWLIALDETLNGRGKMGSL 522
              N   VHL   L     +            T +   K  + WL  ++ TL+GRGKMGSL
Sbjct: 445  SSN---VHLQARLLSANKRDSLLAQDHELDLTRDHASKKFEQWLFVVEYTLDGRGKMGSL 501

Query: 523  VGASDDYRSAG-ENAILEYCLWTMVFINHLCSNSSLLNQRILLRTKLENLGALRIMTKLK 581
            VGAS+D++SAG ENAILEY   T++ +N LC+  + +NQR LLR++ ++ G  RIM KL+
Sbjct: 502  VGASEDFKSAGGENAILEYGYLTLLLVNQLCNTPADVNQRTLLRSRFKSCGLSRIMQKLE 561

Query: 582  RLDYEKLTEQIELYDNNKLDDFNTVLETESKNSKVNMQNPNSLIENLWESCKGSDNEKXX 641
             L+Y+K+ EQ+ ++++   DD+NT++ ++S N  V+M+NP SL++NLWES KG+  EK  
Sbjct: 562  LLNYDKIDEQLRIFEDRTADDYNTIMASKSINHNVDMENPLSLLQNLWESYKGTGAEKYL 621

Query: 642  XXXXXXXXXXXXKLMGEKEDPTKLSKQLKLIDSLLTNVNGSMFDEESHMNLAIQRLYDSM 701
                        K+  E +DPT+ SKQLKLIDSL++NV  S  D ES  N AIQRLYDSM
Sbjct: 622  VSLVQHLFIASSKVQDEGDDPTEASKQLKLIDSLVSNVTMSSIDTESSFNGAIQRLYDSM 681

Query: 702  QTDEVARRAILESRTLTKKLEEAHAERDYLSNKLSNAENGLVGQLESDLKQRDNILEKNQ 761
            QTDEVARRAI+E+R LT+K EE  AERDYL  KLS AE GLVGQL+++L QRD ILEKNQ
Sbjct: 682  QTDEVARRAIMEARELTRKFEEVKAERDYLGEKLSKAEGGLVGQLQNELSQRDRILEKNQ 741

Query: 762  RVMXXXXXXXXXXXXXXXXXXXXXXXXXXXMLTILNSR-----------NGTQNPDVDDV 810
            RV                            +LTILNSR            GT +     V
Sbjct: 742  RVTEQLQADLEELKKKHLLEKHEHEVELRKLLTILNSRPQGSSAVQEEEAGTASSSAPGV 801

Query: 811  TITLDPNKKLDIQKALELELNKTKKDLSNDSKR----FGITVQPNKRLKMLRMQMEDIEN 866
               L  ++KL IQKAL+  L +TKKDL+ +SKR     G T++PN+RLK+LR +MEDIEN
Sbjct: 802  ---LHADRKLAIQKALQDRLQQTKKDLTKESKRLGTTLGTTLEPNRRLKLLRSRMEDIEN 858

Query: 867  EARQLEMTNFADHKRTNXXXXXXXXXXXXXXXXXXXNTEEFDKE-NEMKTKKLMQLRKAL 925
            EAR+LEMTNFAD +R                        +  K+  E + +KL +LR+ L
Sbjct: 859  EARELEMTNFADIQRQTVEEQTVVPALPPPAVPVLDRAPKAKKQVKEDQVRKLRELRQRL 918

Query: 926  AAIQSETNDISKFNVEGRVNEMFQDXXXXXXXXXXXXXXXYKDFEIPFXXXXXXXX---- 981
            A++Q E+ND+SKFNVE R+NE+F D               YK F I F            
Sbjct: 919  ASVQKESNDVSKFNVEERINELFNDKKLSALDRLKELETKYKGFGIDFQADPELSAMLSD 978

Query: 982  -----XXXXXXXXHSTLDPTYLQKKINELDEISDELYLMNYXXXXXXXXXXXXXXXXXXX 1036
                         H +LDP +L +KI E+ +I DEL                        
Sbjct: 979  APPENHHAKDGQAHPSLDPKHLSRKIEEMSKIVDELTAFKKEIENGPPSSSSSSSDEELE 1038

Query: 1037 XXXXXXMRSVSNAPSKGISEAGSFLESLSQKYGTGQNA--ISSPTSITSPNERIASQG-- 1092
                  + S       G +  GSFLE+LSQKYGTGQNA   +S  ++         +G  
Sbjct: 1039 QDDRASIHS-------GNASTGSFLETLSQKYGTGQNAGPTASSRAMVGRESNYPGRGYH 1091

Query: 1093 EKSFMNRLKRQTMAAPFLEELTQK 1116
             +SFM R+K+   AAPFL ELTQK
Sbjct: 1092 RRSFMERVKKSD-AAPFLSELTQK 1114

 Score =  138 bits (347), Expect = 1e-31,   Method: Compositional matrix adjust.
 Identities = 85/195 (43%), Positives = 114/195 (58%), Gaps = 28/195 (14%)

Query: 43  ADISSPK---KPIVPKQFTSTELRPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTNNTS 99
           +DISSPK    P VP +F+    +PL+K++TLNTQNLS YV     D + P+        
Sbjct: 50  SDISSPKIVSTPAVP-EFSG---KPLSKQTTLNTQNLSSYV-----DMNTPH-------- 92

Query: 100 HTRAHS--SQSATKYSYSRRSS------TATGPIKXXXXXXXXXXXXXXXXXXXXYTNLL 151
           H R+ S  S S TKYSYSRRSS            +                     TNL 
Sbjct: 93  HNRSPSGMSGSPTKYSYSRRSSQWSNGNNIGNGGRLSRQQTNQSLSSASIFSQGSMTNLT 152

Query: 152 KYIDSDGKINLEMPRDPHEVEALFEDLMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQD 211
           K++ +DGK+ L+ P +P E+E LF +LM+KRN FQ+LP   QKELM+YD+ KKW LVKQD
Sbjct: 153 KFMGADGKVKLDRPSNPQEIEDLFAELMHKRNFFQSLPAAGQKELMNYDLDKKWLLVKQD 212

Query: 212 LQNEIKKLMSKSSSY 226
           LQ+E+KKL +K +++
Sbjct: 213 LQSELKKLANKKNTH 227

>AFR669W Chr6 (1662202..1667958) [5757 bp, 1918 aa] {ON} Syntenic
            homolog of Saccharomyces cerevisiae YNL271C (BNI1)
          Length = 1918

 Score =  649 bits (1673), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 340/595 (57%), Positives = 415/595 (69%), Gaps = 51/595 (8%)

Query: 1260 PSLLQLTNSDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKGVLRNLEKAF 1319
            PSL +     R PRP+KKLKQLHW+K+D  D+SIW    AE+FADDLYEKGVL  LEKAF
Sbjct: 1364 PSLFE-----RYPRPKKKLKQLHWEKIDDPDNSIWENARAEKFADDLYEKGVLSELEKAF 1418

Query: 1320 AAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTP 1379
            AAREIKS   RKK++ +KI+FLS DISQQFGINLHMY SL V  ++ K+LKCD++ ++T 
Sbjct: 1419 AAREIKSFKGRKKDENNKITFLSRDISQQFGINLHMYSSLPVSAVVSKILKCDKDFLSTQ 1478

Query: 1380 SVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQK--------FQRRIQMTYRELI 1431
            S IEFL+K EIVEVS N+AR++APYTTDWEGV S++  K         QR  Q+      
Sbjct: 1479 SAIEFLSKPEIVEVSTNMARSFAPYTTDWEGVSSVEDAKSPEKDPSELQRSDQL------ 1532

Query: 1432 KFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVI 1491
             F+  +VNLQSYW+SRMR LK+IT+YE++YN+L+ KLR +DKAVGA+Q+SENL+NVF+VI
Sbjct: 1533 -FLNLIVNLQSYWSSRMRGLKLITTYEKDYNDLIIKLRSLDKAVGAIQKSENLRNVFDVI 1591

Query: 1492 LAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRDNYPSFNDFIDDLE 1551
            LAVGNYMNDTSKQAQGFKLSTLQRLTFIKD  NSMTFLNYVE+IV  NYPSFN F+ +LE
Sbjct: 1592 LAVGNYMNDTSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVERIVSQNYPSFNSFLQELE 1651

Query: 1552 PVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAA 1611
            PVL VVK+S+EQL +DCNEF  ++ NVERSLEIGNLSDSSKFHP D+VL KVLP+LPEA 
Sbjct: 1652 PVLQVVKISIEQLANDCNEFCSTVTNVERSLEIGNLSDSSKFHPDDRVLAKVLPILPEAR 1711

Query: 1612 KKSSLLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEE 1671
            KK++LL DEV+L++MEFE LM+ +GEDA                I EYK+AQ  N K +E
Sbjct: 1712 KKANLLADEVQLSLMEFENLMRMFGEDADDKFAKNSFFKKFADFILEYKRAQEFNRKIDE 1771

Query: 1672 EERAYEKHKRMIEEQQHKQDLXXX--XXXXXXXXXXXXQSDRRAMMDKLLEKLKNAGPGK 1729
            EERAYE+ K MI+EQQ +  L                   D R +MDKLLEKLKNAGP K
Sbjct: 1772 EERAYERRKLMIQEQQRRAKLVQEGDETTCARLSAISASGDDRDVMDKLLEKLKNAGPSK 1831

Query: 1730 ADPSSARKRALVRKKLLTDKEVTAHILQDIDTGDDSIVYSPNTPTQEGPNDIHLASPTPS 1789
             DPSSARKRAL RKKL+  +E +  IL+ +D                  +D+  A+P   
Sbjct: 1832 GDPSSARKRALARKKLMGGREGSI-ILEGLDV-----------------DDLQSAAPDVQ 1873

Query: 1790 GKSDLVLASVSPTKESTADGIAEDEFISDRAKALLLELRGSENMK-RNSQLEEQK 1843
              + L  AS SP  +  A          DRA+ LLLELR  E+ + R S L+E K
Sbjct: 1874 PDTPLRAASASPPPDPAA----------DRARHLLLELRNGEHPESRKSMLDEHK 1918

 Score =  466 bits (1200), Expect = e-134,   Method: Compositional matrix adjust.
 Identities = 284/730 (38%), Positives = 419/730 (57%), Gaps = 43/730 (5%)

Query: 312  SENNKSVSSIATDRINRPPIHYVKKIIADRLTSEEMNDLWVTLRTEQLDWVDAFLEHQGH 371
            S+N+    ++A +  +  P HYV+KII+DR+T++E+NDLW++LRTE +DWV  F++ QG 
Sbjct: 278  SQNSAKPMAVAYEPAHLSPDHYVRKIISDRVTAQELNDLWISLRTESIDWVIGFIDAQGQ 337

Query: 372  IAMANVLMNTIYKCAPGSELTPELQEKEHSFFKCFRVLSMLSQGLYEFAKHKLMSDTIAN 431
            +A+AN L+  + + +       +  EKE++++KC RVL+ L +G+ E  K KL+  ++  
Sbjct: 338  VAIANRLLKFVQRESLDILHDYDALEKENAYYKCLRVLTNLREGMQEALKSKLVISSVVE 397

Query: 432  GLFSSRLATRKMATEVLVCMI--------EKRNNMRFEVVLASLDRYFRQEENLNM---V 480
            GL SSRL+TR++ATE L+ M+        +   +  F +++A LD+  +   N+++   +
Sbjct: 398  GLLSSRLSTRRVATETLLYMLSDDELKTADTGQDAIFPLLVA-LDQESKFAANIHLRGRL 456

Query: 481  HLS---KTLPGEYPQSTPNTKYKIIQAWLIALDETLNGRGKMGSLVGASDDYRSAGENAI 537
            H +   K+LP    ++  +   K ++ WL  ++ TL+GRG+MGSLVGASDDY+  GEN +
Sbjct: 457  HETNKRKSLP--TGRADFHVVAKRLEQWLYVIEYTLDGRGRMGSLVGASDDYK-GGENTV 513

Query: 538  LEYCLWTMVFINHLCSNSSLLNQRILLRTKLENLGALRIMTKLKRLDYEKLTEQIELYDN 597
            LEY L++M+ +N LCSN   + QR LLR++L++ G  RI+ K++ L Y  L  ++  +++
Sbjct: 514  LEYLLYSMILLNLLCSNHPDVQQRNLLRSRLKSYGLARIIKKMELLKYPALENEVRKFED 573

Query: 598  NKLDDFNTVLETESKNSKVNMQNPNSLIENLWESCKGSDNEKXXXXXXXXXXXXXXKLMG 657
              LDD+N ++ + + +S V+M++P +L ++ W   +G++ E               +   
Sbjct: 574  ATLDDYNLLMTSTTVDSAVDMKDPAALWQDFWTQHRGTEAE-GHLLSLLQHLFLWSRAFA 632

Query: 658  EKEDPTKLSKQLKLIDSLLTNVNGSMFDEESHMNLAIQRLYDSMQTDEVARRAILESRTL 717
            E  DP +  KQLKL+D+L+TNV  S  D ES  N AIQRLYD+MQTDEVARRAILESR L
Sbjct: 633  EYRDPAESIKQLKLLDALVTNVTFSSIDTESGFNGAIQRLYDAMQTDEVARRAILESREL 692

Query: 718  TKKLEEAHAERDYLSNKLSNAENGLVGQLESDLKQRDNILEKNQRVMXXXXXXXXXXXXX 777
            TKK EE  AERD L++KLS A+NGLVGQL+S+++Q + ILEK+ RV              
Sbjct: 693  TKKYEEIKAERDNLASKLSQAQNGLVGQLQSEVEQLERILEKSNRVTDQLKGELHALKKK 752

Query: 778  XXXXXXXXXXXXXXMLTILNSRNGTQN---PDVDDVTIT-LDPNKKLDIQKALELELNKT 833
                          MLTILNS+   +N   P+V+  T + L P KK+ IQKAL+  L +T
Sbjct: 753  HLLEKHEHEVELRKMLTILNSKPHGENGGSPEVNTSTPSPLKPEKKMAIQKALQDRLRQT 812

Query: 834  KKDLSNDSKRFGITVQPNKRLKMLRMQMEDIENEARQLEMTNFADHKRTNXXXXXXXXXX 893
            +KDL+ DSKR      PN+RLKMLR +M+ IE EAR LEMTNFAD K+            
Sbjct: 813  EKDLTRDSKRLNTVPAPNRRLKMLRSKMDIIEKEARLLEMTNFADFKKEPEEENEPKLLS 872

Query: 894  XXXXXXXXXNTEEFDKENEMKTKKLMQLRKALAAIQSETNDISKFNVEGRVNEMFQDXXX 953
                       +          K+L  LRK LA IQ E+N++SKFNVE RVNE+F +   
Sbjct: 873  PPKIQRSLRGEQ---------VKELAALRKRLAIIQQESNEVSKFNVEERVNELFYEKKN 923

Query: 954  XXXXXXXXXXXXYKDFEIPFXXXXXXXXXXXXXXX-----------XHSTLDPTYLQKKI 1002
                        YK F I F                            + LDP +L  KI
Sbjct: 924  KALDRLRDLENKYKGFGIDFNEDPELMSLRLANGSVDLDGPTIDLESSAPLDPAHLDAKI 983

Query: 1003 NELDEISDEL 1012
             E+ +I D L
Sbjct: 984  EEMTKILDRL 993

 Score = 86.3 bits (212), Expect = 7e-16,   Method: Compositional matrix adjust.
 Identities = 67/215 (31%), Positives = 91/215 (42%), Gaps = 63/215 (29%)

Query: 43  ADISSPKKPIVPKQFTSTELRPLNKKSTLNTQNLSQY---------VSGTKI-------- 85
           +DISSPKK  +P     +  +PLNK +T+N  NL Q           SG  +        
Sbjct: 53  SDISSPKKVTLPSNLDLSGAKPLNKLNTINASNLPQVSGEVTQARSASGAALSSPSKYSY 112

Query: 86  ------------------DQDNP---NPLPTNNTSHTRAHSSQSATKYSYSRRSSTATGP 124
                             DQ  P   N L      H  A + Q   + +YS  S T+   
Sbjct: 113 SKRSSQWASSKQANHPEHDQQYPQHLNHLFVQPHPHHSALTRQMTNQSNYSASSYTS--- 169

Query: 125 IKXXXXXXXXXXXXXXXXXXXXYTNLLKYIDSDGKINLEMPRDPHEVEALFEDLMYKRNI 184
                                  + L K  D DG + LE P DP E+E L+++L+ KRNI
Sbjct: 170 ----------------------LSLLHKATDIDGTLTLEKPEDPQEIEELYQELLQKRNI 207

Query: 185 FQALPQDKQKELMSYDVTKKWTLVKQDLQNEIKKL 219
            Q++     +ELMSY + KKW +VKQDLQ E KK+
Sbjct: 208 PQSVSVHGHRELMSYGIDKKWLMVKQDLQTEYKKM 242

 Score = 46.2 bits (108), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 34/81 (41%), Positives = 45/81 (55%), Gaps = 15/81 (18%)

Query: 1051 SKGISEAGSFLESLSQKYGTG-QNAISSPTSI------------TSPNERIASQGEKSFM 1097
            ++ I    SFLE+LSQKYGTG Q+  +S +S             TS N   +    KSF+
Sbjct: 1079 AEAIISNASFLETLSQKYGTGSQSGAASVSSSEHMRGVVNVKRRTSQNSINSGNHRKSFV 1138

Query: 1098 NRLKRQT--MAAPFLEELTQK 1116
            NR+KR     ++ FLEELTQK
Sbjct: 1139 NRMKRTITPTSSNFLEELTQK 1159

>Kwal_33.13392 s33 complement(199821..205727) [5907 bp, 1968 aa] {ON}
            YNL271C (BNI1) - contains formin homology domains;
            homologous to BNR1 (BNI1 related protein) [contig 118]
            FULL
          Length = 1968

 Score =  645 bits (1663), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 343/626 (54%), Positives = 434/626 (69%), Gaps = 36/626 (5%)

Query: 1260 PSLLQLTNSDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKGVLRNLEKAF 1319
            PSL +     R PRP KKLKQLHW+K+D  + SIW    AE+FADDLYEKG+L  LEKAF
Sbjct: 1312 PSLFE-----RYPRPTKKLKQLHWEKIDDAEDSIWKNAKAEQFADDLYEKGILSRLEKAF 1366

Query: 1320 AAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTP 1379
            AAREIKS+ +RKK+D  K++FLS D+SQQFGINLHMY SL+V E++ K+LKCD++ + TP
Sbjct: 1367 AAREIKSLTSRKKKDSDKLTFLSRDVSQQFGINLHMYSSLSVEEVVTKILKCDKDFLTTP 1426

Query: 1380 SVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQK--------FQRRIQMTYRELI 1431
            SVIEFL+K EIVEVS NLARN+APYTTDWEG+ ++K  K         QR  ++ Y EL 
Sbjct: 1427 SVIEFLSKQEIVEVSNNLARNFAPYTTDWEGITNVKDAKPPEKDPSELQRADRL-YLELF 1485

Query: 1432 KFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVI 1491
                  VNLQ YW+SRMRALKVITSYE+EY++L+ KLR +DKA  A+Q+SENL+NV +VI
Sbjct: 1486 ------VNLQGYWSSRMRALKVITSYEKEYSDLIHKLRMIDKATCAIQQSENLRNVLDVI 1539

Query: 1492 LAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRDNYPSFNDFIDDLE 1551
            LAVGN+MND+SKQAQGF+L+TLQRLTFIKD  NSMTFLNYVEKIVR+ YP FN F+ +LE
Sbjct: 1540 LAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIVRETYPEFNVFLKELE 1599

Query: 1552 PVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAA 1611
            PV+  VK+S+EQ+  DC EFSQS++NVERS++IGNLSDSSKFHP D+ L KVLPVLPEA 
Sbjct: 1600 PVVAAVKISIEQVSQDCKEFSQSVINVERSVDIGNLSDSSKFHPLDRTLLKVLPVLPEAR 1659

Query: 1612 KKSSLLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEE 1671
            KK  LL DE+KLT++EF+ LMK +GEDA                + EYKKAQ+ N+K EE
Sbjct: 1660 KKGDLLMDEMKLTLLEFDNLMKMFGEDAMDKFSRNSFFKKFADFLQEYKKAQTYNMKLEE 1719

Query: 1672 EERAYEKHKRMIEEQQH--KQDLXXXXXXXXXXXXXXXQSDRRAMMDKLLEKLKNAGPGK 1729
            EE+AYE+ K+M+EEQQ   ++                  S  R +MD+LLEKLKNAGPGK
Sbjct: 1720 EEKAYERRKKMVEEQQRRARESNEQENSVDGNADDNTAASGDRDVMDRLLEKLKNAGPGK 1779

Query: 1730 ADPSSARKRALVRKKLLTDKEVTAHILQDIDT---GDDSIVYSPNTPTQEGPNDIHLASP 1786
            +DPSSARKRA+ R+KLL      + IL + +       S+VYSP   T     D    SP
Sbjct: 1780 SDPSSARKRAIARRKLLQGSSSNSTILDNFEIEKPEGKSLVYSPEQVTLSNSVD---HSP 1836

Query: 1787 TPSGKSDLVLASVSPTKESTADGIAEDEFISDRAKALLLELRGSENMKRNSQLEEQK-EK 1845
            TP  +     ++ S  + S      E   ++DRA+ LL+ELRG E+  R +  ++Q+  K
Sbjct: 1837 TPDVRKREGQSTASEVQTS------ESSDLTDRARNLLIELRGPESPSRRASSKDQRISK 1890

Query: 1846 LKARRSRRRTQTESISSNKLFFTDEE 1871
            L+ARR +      S S N L F  +E
Sbjct: 1891 LRARR-KNDGSGNSGSDNHLNFVGQE 1915

 Score =  624 bits (1608), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/1134 (36%), Positives = 597/1134 (52%), Gaps = 159/1134 (14%)

Query: 43   ADISSPKKPIVP--KQFTSTELRPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTNNTSH 100
            +DISSPKK  +P   +F+    +PL+K+STLN  NLS Y             + + +   
Sbjct: 52   SDISSPKKINLPDTGEFSH---KPLSKQSTLNIANLSAYTD-----------VASTHNRS 97

Query: 101  TRAHSSQSATKYSYSRRSS-----TATGP-IKXXXXXXXXXXXXXXXXXXXXYTNLLKYI 154
            + A S+ S TKYSYSRR+S       T P  K                    ++NL K++
Sbjct: 98   SSAASNSSPTKYSYSRRASQWSSNGGTAPSTKLSRQQTNQSISSASIFSQGSFSNLSKFV 157

Query: 155  DSDGKINLEMPRDPHEVEALFEDLMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQN 214
              DG I LE PRDP E+E LFE+++YKRN++Q+LP   QKEL +YD+ KKW +V+QDLQ+
Sbjct: 158  GPDGSIRLEKPRDPREIEELFEEVLYKRNVYQSLPPSAQKELNNYDLEKKWLMVRQDLQS 217

Query: 215  EIKKLMS-KSSSYHPTEXXXXXXXXXXXXXXXXXXXXXXXXXXQDSNSPQTAIFTSNSGT 273
            E+KK M+ KS S  P                                SP T  F SNS  
Sbjct: 218  EVKKFMNNKSVSKSPAAASTGISLIA-------------------PESPSTGHFASNSSI 258

Query: 274  MQXXXXXXXXXXIPVGGKSRPVGSSSTASGTNSMIYQSSENNKSVSSIATDRINRPPIHY 333
             +            + G SR   S +   GT+   Y S+    S ++++ D  +  P +Y
Sbjct: 259  NES-----------LAGSSR---SRAQNPGTSDQFYGSNNGTSSTTTLSQDPSHLSPDYY 304

Query: 334  VKKIIADRLTSEEMNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMNTIYKCAPGSELTP 393
            V+KII + ++++ +NDLWV+LRTEQLDWV  FLE QG +A+ANV++ T Y+ +P + L  
Sbjct: 305  VRKIICNNISAKRLNDLWVSLRTEQLDWVVGFLEAQGQVAIANVILKTCYRESPDNLLGD 364

Query: 394  ELQEKEHSFFKCFRVLSMLSQGLYEFAKHKLMSDTIA-------NGLFSSRLATRKMATE 446
            E+ +KE ++FKC +     S  L E A   ++S++          GL S R+ATR++A+E
Sbjct: 365  EVLDKEFAYFKCLKT----SLNLKEGADEAVLSNSAKIIISAIIEGLLSLRVATRRIASE 420

Query: 447  VLVCMIEKRNNMRFEVVLASLDRYFRQEENLNMVH--LSKTLPGEYPQS------TPNTK 498
            +LV + +      F  V+ +LD+  R  +N+++    LS+T   E   S        N  
Sbjct: 421  LLVSLSQWALPHGFTHVMNALDQESRFCDNVHLQARLLSQTSNKEIKNSLRSSLLADNNG 480

Query: 499  YKII---QAWLIALDETLNGRGKMGSLVGASDDYR-SAGENAILEYCLWTMVFINHLCSN 554
             +I+   + W++ ++ TL+GRGKMGSLVGAS+D+R S GENAI+EY   T++ +NHLC  
Sbjct: 481  DRIMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLVNHLCQT 540

Query: 555  SSLLNQRILLRTKLENLGALRIMTKLKRLDYEKLTEQIELYDNNKLDDFNTVLETESKNS 614
               + QR +LR +L+N G  RI+ K+KRL+YEK+ EQ+ +++++  DDF+T+        
Sbjct: 541  PVDVKQRTILRARLKNAGLPRILNKMKRLNYEKVDEQLAIFEDSTTDDFDTLYSQGPNGE 600

Query: 615  KVNMQNPNSLIENLWESCKGSDNEKXXXXXXXXXXXXXXKLMG-EKEDPTKLSKQLKLID 673
             +NMQ+P S+ +NLW+ CKG++ E+              +L G  KEDP + +KQLKLID
Sbjct: 601  LINMQDPVSMTQNLWDLCKGTEAEEHLMSLLQNLLISTGELGGTSKEDPAQRTKQLKLID 660

Query: 674  SLLTNVNGSMFDEESHMNLAIQRLYDSMQTDEVARRAILESRTLTKKLEEAHAERDYLSN 733
            +L++NV+ +  D +S  N AIQRLYD+MQTDE+ARRAILE+R   K+ EE  AER+ L  
Sbjct: 661  ALVSNVSMASVDLQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKAERNNLKE 720

Query: 734  KLSNAENGLVGQLESDLKQRDNILEKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXXXML 793
            KLSNAE GLVGQL+ +LKQRD+ILEK+QRV                             L
Sbjct: 721  KLSNAEGGLVGQLQEELKQRDHILEKSQRVTAQLQHELDESKKKLILAKHQHEVELRKTL 780

Query: 794  TILNSRNGTQNPDVDDVTIT--------LDPNKKLDIQKALELELNKTKKDLSNDSKRFG 845
            T LNS+ G       D+ +T        L P + L IQ+AL+++L KT K+++ +S R G
Sbjct: 781  TALNSKGG-------DIQLTEDGGQPKPLKPERMLAIQRALQIKLEKTSKEITVESSRLG 833

Query: 846  ITVQPNKRLKMLRMQMEDIENEARQLEMTNFADHKRTNXXXXXXXXXXXXXXXXXXXNTE 905
            ++++PNKRL++LR +ME+IEN+AR+LEMTNF++++                        E
Sbjct: 834  VSLEPNKRLRLLRSRMEEIENQARELEMTNFSEYR------------------------E 869

Query: 906  EFDKENEMKTK-------------------KLMQLRKALAAIQSETNDISKFNVEGRVNE 946
            + DKE EM  +                   KL QLR+ LA++Q+E+NDISKFNVEGR +E
Sbjct: 870  DADKEIEMAHEGTHMYPSDVDVGTTQDSNLKLEQLRRKLASLQNESNDISKFNVEGRFHE 929

Query: 947  MFQDXXXXXXXXXXXXXXXYKDFEIPFXXXXXXXXXXXXXXXXHS--TLDPTYLQKKINE 1004
            MF D               Y  F I +                +   TLDP   +   N 
Sbjct: 930  MFSDQKIQALDRLKKLENDYSGFGINYDPAESPSLKQEQGQDVNKSRTLDP---KGPNNS 986

Query: 1005 LDEISDELYLMNYXXXXXXXXXXXXXXXXXXXXXXXXXMRSVSNAPSKGISEAGSFLESL 1064
            +DE   E    N                          +              GSFLE L
Sbjct: 987  VDESQLETDRANASIDSSPASESLEEEDVHLTKSTTEEI-------------GGSFLERL 1033

Query: 1065 SQKYGTGQNAISSPTSITSPNERIASQG--EKSFMNRLKRQTMAAPFLEELTQK 1116
            SQKYG GQ  +S+  S+          G   KSFMNR+K+ +   P+LEEL+ K
Sbjct: 1034 SQKYGKGQANLSNRNSVVGRENSYPGSGYHRKSFMNRVKK-SDNVPYLEELSGK 1086

>Ecym_1086 Chr1 complement(173244..179519) [6276 bp, 2091 aa] {ON}
            similar to Ashbya gossypii AFR669W
          Length = 2091

 Score =  625 bits (1613), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 350/647 (54%), Positives = 445/647 (68%), Gaps = 48/647 (7%)

Query: 1247 MGKKEPYKSVVDQPSLLQLTN-SDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADD 1305
            +G+ + YK     P L Q  +  ++ PRP+K+LKQLHW+K+D  D+SIW    AE+FADD
Sbjct: 1378 LGRTKKYKGSSPSPLLPQSPSLFEKYPRPKKRLKQLHWEKIDDLDNSIWENARAEKFADD 1437

Query: 1306 LYEKGVLRNLEKAFAAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELI 1365
            LYE+GVL  LEKAFAAREIKS+ +RKK D +K++FLS DISQQFGINLHMY SL V +++
Sbjct: 1438 LYERGVLTELEKAFAAREIKSLISRKK-DENKVTFLSRDISQQFGINLHMYSSLTVDQIV 1496

Query: 1366 EKVLKCDRNLINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQK------- 1418
             K+LKCD++ +NT S IEFL+K EIVEVS+N+AR +APYTTDWEGV S++  K       
Sbjct: 1497 TKILKCDKDFLNTQSAIEFLSKHEIVEVSINMARCFAPYTTDWEGVSSVEEAKQPEKDPN 1556

Query: 1419 -FQRRIQMTYRELIKFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGA 1477
              QR  Q+ Y +LI      VNLQSYW SRMRALK+IT+YE++YN+L+ KLR +DKAVGA
Sbjct: 1557 ELQRADQL-YLDLI------VNLQSYWNSRMRALKLITTYEKDYNDLIIKLRSLDKAVGA 1609

Query: 1478 VQRSENLKNVFNVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVR 1537
            +Q+SENL+NVF+VILAVGNYMND+SKQAQGFKLSTLQRLTFIKD  NSMTFLNYVEKIVR
Sbjct: 1610 IQKSENLRNVFDVILAVGNYMNDSSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKIVR 1669

Query: 1538 DNYPSFNDFIDDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSD 1597
             NYP F+ F+ +LEPVL VVK+S+EQL +DC EF  ++ NVERSLEIGNLSDSSKFHP+D
Sbjct: 1670 TNYPGFDVFLQELEPVLQVVKISIEQLANDCGEFCSTVTNVERSLEIGNLSDSSKFHPND 1729

Query: 1598 KVLTKVLPVLPEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXIT 1657
            +VL KVLPVLPEA K+++LL DEV+L++MEFE+LM+ +GED+                I 
Sbjct: 1730 RVLAKVLPVLPEARKRANLLADEVQLSLMEFESLMRLFGEDSDDKFAKNSFFQKFADFIL 1789

Query: 1658 EYKKAQSQNLKQEEEERAYEKHKRMIEEQQHK-------QDLXXXXXXXXXXXXXXXQSD 1710
            EYK+AQ  N K EEEERAYE+ K MIEEQQ +                           D
Sbjct: 1790 EYKRAQEFNKKMEEEERAYERRKIMIEEQQKRARKNIQIDTSFSRRGSSLSTSSISASGD 1849

Query: 1711 RRAMMDKLLEKLKNAGPGKADPSSARKRALVRKKLLTDKEVTAHILQDIDTGDDSIVYSP 1770
             R +MD+LLEKLKNAGP KADPSSARKRAL RKKL+  K+  + IL  +D  + + + S 
Sbjct: 1850 DRDVMDRLLEKLKNAGPSKADPSSARKRALARKKLMDGKKSGSIILDGLDVEELANIQSD 1909

Query: 1771 NTPTQEGPNDIHLASPTPSGKS-----------DLVLASVSPTK-----------ESTAD 1808
                Q   N   L SPT +  +           DL  A +S  K           ES + 
Sbjct: 1910 GLDDQSDSNPAILGSPTSTVGATADVEGLNPDHDLPSAPISAEKGSVSSALSHSSESPSK 1969

Query: 1809 GIAEDEFISDRAKALLLELRGSENMK--RNSQLEEQKEKLKARRSRR 1853
             I +++ ++ RA+ LL ELR S++    R S L+E KEK++ RR+++
Sbjct: 1970 KILDEDAVTHRARNLLQELRSSDDHTEDRKSLLDEHKEKVRQRRNKK 2016

 Score =  531 bits (1368), Expect = e-155,   Method: Compositional matrix adjust.
 Identities = 358/1010 (35%), Positives = 522/1010 (51%), Gaps = 108/1010 (10%)

Query: 43   ADISSPKKPIVPKQFTSTELRPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTNNTSHTR 102
            +DISSPKK  +P     +  +PL+K STLNT +LSQY    +I Q      P +  S ++
Sbjct: 58   SDISSPKKVSIPSSLDLSTAKPLSKHSTLNTSSLSQYAD--EIAQSRTPSGPVSLGSPSK 115

Query: 103  AHSSQSATKYSYSRRSS-----TATGPIKXXXXXXXXXXXXXXXXXXXXYTNLLKYIDSD 157
               S+ ++++S    +            +                     T L K  DSD
Sbjct: 116  YSYSKRSSQWSGGNSNKQLLLLPQPQHSQHTLSRQPTNQSNNSDNSFSSVTLLQKITDSD 175

Query: 158  GKINLEMPRDPHEVEALFEDLMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQNEIK 217
            G ++LE P+ P E+E L+++L+ KRNI  ++     +ELM YD+ KKW +VKQDLQ E+K
Sbjct: 176  GNLSLEKPKYPQEIEELYQELLQKRNILNSVSVHSHRELMGYDLDKKWLMVKQDLQAELK 235

Query: 218  KLMSKSSSYHPTEXXXXXXXXXXXXXXXXXXXXXXXXXXQDSNSPQTAIFTSNSGTMQXX 277
            ++                                       +N PQ+ +    S ++   
Sbjct: 236  RM--------------------------------------KNNVPQSTVADPLSNSVHLK 257

Query: 278  XXXXXXXXIPVGGKSRPVGSSSTASGTNSMIYQSSENNKSVSSIATDRINRPPIHYVKKI 337
                            P GS S+++ +   I Q+S    +VS    D  +  P HYV+KI
Sbjct: 258  S---------------PRGSFSSSNMSARSISQNSAKQLAVS---YDPSHLSPDHYVRKI 299

Query: 338  IADRLTSEEMNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMNTIYKCAPGSELTPELQE 397
            I+DR+T+ E+NDLWV+LRTE +DWV  F++ QG +A+AN L+    + +  S L  +L E
Sbjct: 300  ISDRITAYELNDLWVSLRTESIDWVIGFIDAQGQVAIANRLIKFAQRESLESLLDSDLLE 359

Query: 398  KEHSFFKCFRVLSMLSQGLYEFAKHKLMSDTIANGLFSSRLATRKMATEVLVCMIE---- 453
            KE +++KC RVL+ L +G+      KL+   +  GL S RL TR++ATE L+ M+     
Sbjct: 360  KETAYYKCLRVLTNLREGMQAALSSKLVISAVVEGLLSIRLTTRRIATETLLYMLTDDEL 419

Query: 454  KRNNMRFEVVLASLDRYFRQEENLNMVHLSKTL-PGEYPQSTPNTKY------KIIQAWL 506
            K  +  F+ +   L    ++ +  + +HL   L      +S P  +       K I+ WL
Sbjct: 420  KTADTDFDAIFPVLHALDQESKYSSSIHLRGRLHETNKRRSLPTGRADLHVIAKKIEQWL 479

Query: 507  IALDETLNGRGKMGSLVGASDDYRSAGENAILEYCLWTMVFINHLCSNSSLLNQRILLRT 566
              L+ TL+GRG+MGSLVGAS+DY++ GEN +LEY L++M+ IN LCS+   L+QR LLR+
Sbjct: 480  YVLEYTLDGRGRMGSLVGASEDYKN-GENTVLEYLLYSMILINLLCSSHPDLHQRNLLRS 538

Query: 567  KLENLGALRIMTKLKRLDYEKLTEQIELYDNNKLDDFNTVLETESKNSKVNMQNPNSLIE 626
            +L++ G  R++ K++ L Y  L  ++  +++  LDD+N+++ + + +S V+M++P SL  
Sbjct: 539  RLKSYGLSRVIKKMELLKYPALENEVSKFEDRTLDDYNSLMASSTVDSSVDMKDPESLWN 598

Query: 627  NLWESCKGSDNEKXXXXXXXXXXXXXXKLMGEKEDPTKLSKQLKLIDSLLTNVNGSMFDE 686
            N W   KG+++E               K   E  DP + SKQLKL+D+L++NV  S  D 
Sbjct: 599  NFWTRHKGTESEAHLLSLMQHLFLWSSKAFSESTDPAEGSKQLKLLDALVSNVTFSSIDT 658

Query: 687  ESHMNLAIQRLYDSMQTDEVARRAILESRTLTKKLEEAHAERDYLSNKLSNAENGLVGQL 746
            ES  N AIQRLYD+MQTDEVARRAILESR LTKK EE  AERD+L  KL+ A++GLVGQL
Sbjct: 659  ESGFNGAIQRLYDAMQTDEVARRAILESRELTKKCEEMKAERDHLQTKLAQAQDGLVGQL 718

Query: 747  ESDLKQRDNILEKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXXXMLTILNSR-----NG 801
            + +++Q   ILEK+ RV                            MLTILNS+     N 
Sbjct: 719  QGEVQQLQRILEKSNRVTDQLKADLHDLKKKHLLEKHEHEVELRKMLTILNSKPNDASND 778

Query: 802  TQNPD-VDDVTIT-LDPNKKLDIQKALELELNKTKKDLSNDSKRFGITVQPNKRLKMLRM 859
              +PD +++ T + L P KK+ IQKAL+  L +T+KDL+ DS+RFG    PN+RLKMLR 
Sbjct: 779  AVSPDGINNKTPSPLKPEKKMAIQKALQDRLRQTEKDLTRDSRRFGTVPAPNRRLKMLRS 838

Query: 860  QMEDIENEARQLEMTNFADHKRTNXXXXXXXXXXXXXXXXXXXNTEEFDKENEMKTKKLM 919
            +M+DIE EA  LEMTNFA+ K+                     +          K K+L 
Sbjct: 839  KMDDIEKEALMLEMTNFAEFKKETKVEDLPRLQSPPKIERNVRSE---------KVKELA 889

Query: 920  QLRKALAAIQSETNDISKFNVEGRVNEMFQDXXXXXXXXXXXXXXXYKDFEIPF------ 973
             LR+ LA IQ E+N+ISKFNVE RVNE+F +               Y+ F I F      
Sbjct: 890  ALRQRLAVIQQESNEISKFNVEERVNELFYEKKTKALDRLRDLEEKYRSFGIDFNMESEL 949

Query: 974  -----------XXXXXXXXXXXXXXXXHSTLDPTYLQKKINELDEISDEL 1012
                                          LDP  L  KI E+ +I +EL
Sbjct: 950  LIETDREGDGDASVGEASNSTAPNSLDSCVLDPARLDAKIEEMTKILEEL 999

 Score = 42.7 bits (99), Expect = 0.012,   Method: Compositional matrix adjust.
 Identities = 27/71 (38%), Positives = 41/71 (57%), Gaps = 13/71 (18%)

Query: 1059 SFLESLSQKYGTGQN-----------AISSPTSITSPNERIASQGEKSFMNRLKRQTM-- 1105
            SFLESLSQKYGTG N           + SS       ++R +    KSF+NR+K+ +   
Sbjct: 1110 SFLESLSQKYGTGTNLQPAEDGAKRLSSSSAFRAGDSSQRNSGYHRKSFVNRMKKNSTPK 1169

Query: 1106 AAPFLEELTQK 1116
            ++ F++E++QK
Sbjct: 1170 SSSFVDEVSQK 1180

>KLTH0F02376g Chr6 complement(196194..202124) [5931 bp, 1976 aa] {ON}
            some similarities with uniprot|P41832 Saccharomyces
            cerevisiae YNL271C BNI1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1976

 Score =  619 bits (1597), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 335/625 (53%), Positives = 436/625 (69%), Gaps = 36/625 (5%)

Query: 1260 PSLLQLTNSDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKGVLRNLEKAF 1319
            PSL      DR PRP KKLKQLHW+K+D  + SIW    AE+FADDLYEKGVL  LEKAF
Sbjct: 1329 PSLF-----DRYPRPSKKLKQLHWEKIDDAEDSIWRDAKAEKFADDLYEKGVLSRLEKAF 1383

Query: 1320 AAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTP 1379
            AAREIKS+ +RKK+D  K+SFLS D+SQQFGINLHMY SL+V E++ K+L+CDR+ ++TP
Sbjct: 1384 AAREIKSLASRKKKDSDKLSFLSRDVSQQFGINLHMYSSLSVEEVVSKILRCDRDFLSTP 1443

Query: 1380 SVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQK--------FQRRIQMTYRELI 1431
            SVI+FL+K EIVEVS NLARN+APYT DWEGV S++  K         QR  ++ Y EL 
Sbjct: 1444 SVIDFLSKQEIVEVSNNLARNFAPYTIDWEGVSSVENAKPPEKDPTELQRADRL-YLELF 1502

Query: 1432 KFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVI 1491
                  VNLQ+YW+SRMRALKVIT+YE++Y++LV KL  +DKA  ++Q+SENL+NV +VI
Sbjct: 1503 ------VNLQTYWSSRMRALKVITTYEKDYSDLVHKLSMIDKATCSIQQSENLRNVLDVI 1556

Query: 1492 LAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRDNYPSFNDFIDDLE 1551
            LAVGN+MND+SKQAQGF+L+TLQRLTFIKD  NSMTFLNYVEKI+R+ YP FNDF+ +LE
Sbjct: 1557 LAVGNFMNDSSKQAQGFRLATLQRLTFIKDDKNSMTFLNYVEKIIRETYPEFNDFLKELE 1616

Query: 1552 PVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAA 1611
            PV+  VK+S+EQ+  DC EFSQS++NVERS++IGNLSD +KFHPSD+VL KVLP LPEA 
Sbjct: 1617 PVVAAVKISIEQVAQDCREFSQSVINVERSVDIGNLSDPTKFHPSDRVLLKVLPTLPEAR 1676

Query: 1612 KKSSLLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEE 1671
            KK  LL DE+KLT++EF+ LM+ +GEDA                + EYKKAQ  NLK EE
Sbjct: 1677 KKGDLLMDEMKLTLLEFDNLMRLFGEDAMDKFARNSFFKKFADFLLEYKKAQVYNLKLEE 1736

Query: 1672 EERAYEKHKRMIEEQ----QHKQDLXXXXXXXXXXXXXXXQSDRRAMMDKLLEKLKNAGP 1727
            EERAYE+ K+++E+Q    +  +                  ++ R +MD+LLEKLKNAGP
Sbjct: 1737 EERAYERRKKLVEDQLKRTRESESKNKGTTDAGGDSVRNEVNEDRDVMDRLLEKLKNAGP 1796

Query: 1728 GKADPSSARKRALVRKKLLTDKEVTAHILQDIDTGDD---SIVYSPNTPTQEGPNDIHLA 1784
             K+DPSSARKRA+ RK+LL      + IL + D  D    S+VYSP+  + E   +    
Sbjct: 1797 AKSDPSSARKRAVARKRLLQGSSSNSTILDNFDIEDSDGKSLVYSPDNNSSEVQLNEADT 1856

Query: 1785 SPTPSGKSDLVLASVSPTKESTADGIAEDEFISDRAKALLLELRGSENMKRNSQLEEQKE 1844
            SPTP  +    +   + T  ++ D  + D  ++DRA+ LL+ELRG E+     ++  Q +
Sbjct: 1857 SPTPERR----VRDSNATSPASHDTGSSD--LTDRARNLLIELRGPESP--GVKMSAQHQ 1908

Query: 1845 KLKARRSRRRTQTESISS-NKLFFT 1868
            +L   R+RR+  + S  S N+L F 
Sbjct: 1909 RLSKLRARRKNDSSSSGSENRLNFV 1933

 Score =  619 bits (1596), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 411/1122 (36%), Positives = 602/1122 (53%), Gaps = 115/1122 (10%)

Query: 43   ADISSPKKPIVP--KQFTSTELRPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPTNNTSH 100
            +DISSPKK  +P   +F+    +PL+K+STLN  +LS Y           + +  +N S 
Sbjct: 53   SDISSPKKINLPDTGEFSH---KPLSKQSTLNMASLSAYT----------DAVGAHNRSA 99

Query: 101  TRAHSSQSATKYSYSRRSS------TATGPIKXXXXXXXXXXXXXXXXXXXXYTNLLKYI 154
            + A S  S TKYSYSRR+S      +A    K                    ++NL K++
Sbjct: 100  SNA-SVGSPTKYSYSRRASQWSNNNSAVSGSKLSRQQTNQSMSSASIFSQGSFSNLSKFV 158

Query: 155  DSDGKINLEMPRDPHEVEALFEDLMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQN 214
              DG + LE PRDP E+E LFE+++YKRN++Q+LP   Q+EL +YD+ KKW +V+QDLQ+
Sbjct: 159  GPDGAVRLERPRDPKEIEELFEEVLYKRNVYQSLPASAQRELNNYDLEKKWLMVRQDLQS 218

Query: 215  EIKKLM-SKSSSYHPTEXXXXXXXXXXXXXXXXXXXXXXXXXXQDSNSPQTAIFTSNSGT 273
            E+KK M SK++S   T                              +SP  + FTS++  
Sbjct: 219  EVKKFMNSKNASKSSTVVGGSSSAV--------------------PDSPSASNFTSSTS- 257

Query: 274  MQXXXXXXXXXXIPVG---GKSRPVGSSSTASGTNSMIYQSSENNKSVSSIATDRINRPP 330
                         P G   G SRP  S+S+ + T+   Y S+    S ++++ D  +  P
Sbjct: 258  -------------PNGSFTGLSRPKISTSSVN-TSEQFYSSNLGTSSTTTLSQDPSHLSP 303

Query: 331  IHYVKKIIADRLTSEEMNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMNTIYKCAPGSE 390
             +YV+KII + ++++ +NDLWV+LRTEQLDWV  FLE QG +A+ANV++ T Y+ +P + 
Sbjct: 304  DYYVRKIICNDISAKRLNDLWVSLRTEQLDWVQGFLEAQGQVAIANVILKTCYRESPDNL 363

Query: 391  LTPELQEKEHSFFKCFRVLSMLSQGLYEFA---KHKLMSDTIANGLFSSRLATRKMATEV 447
            L  E+ +KE ++FKC +    L +G  E       +++   I  GL S R+ATR++A+E+
Sbjct: 364  LGDEVLDKEFAYFKCLKTSLNLREGADEAVMSNSARIIVSAIVEGLLSLRVATRRVASEL 423

Query: 448  LVCMIEKRNNMRFEVVLASLDRYFRQEENLNMVHLSKTLPGEYPQSTPNTKYKI------ 501
            L+ + +      F  V+ +LD+  R  +N   VHL   L  +     P     I      
Sbjct: 424  LISLSQWSLPHGFNHVMDALDQESRFCDN---VHLQARLITQSASKDPKKGSSIAPTPDG 480

Query: 502  --------IQAWLIALDETLNGRGKMGSLVGASDDYR-SAGENAILEYCLWTMVFINHLC 552
                     + W++ ++ TL+GRGKMGSLVGAS+D+R S GENAI+EY   T++ INHLC
Sbjct: 481  DGDRVMRKFEQWMLVVEYTLDGRGKMGSLVGASEDFRTSGGENAIMEYAYLTLLLINHLC 540

Query: 553  SNSSLLNQRILLRTKLENLGALRIMTKLKRLDYEKLTEQIELYDNNKLDDFNTVLETESK 612
                 + QR +LR +L+N G  RI+ K+K L+YEK+ EQ+  +D++  DDF+ +   ES 
Sbjct: 541  QTPVDVKQRTVLRARLKNAGLPRILNKMKLLNYEKVDEQLARFDDSTTDDFDALYSQEST 600

Query: 613  NSKVNMQNPNSLIENLWESCKGSDNEKXXXXXXXXXXXXXXKLMGE-KEDPTKLSKQLKL 671
               V+M++P S+ +NLW  CKG+D E+              +L  + K+DPT+ +KQLKL
Sbjct: 601  GEGVDMKDPVSMTQNLWNLCKGTDAEQHLTSLLQNLLISTGELGSKNKDDPTQRTKQLKL 660

Query: 672  IDSLLTNVNGSMFDEESHMNLAIQRLYDSMQTDEVARRAILESRTLTKKLEEAHAERDYL 731
            ID+L++NV+ +  D +S  N AIQRLYD+MQTDE+ARRAILE+R   K+ EE  A+RD L
Sbjct: 661  IDALVSNVSMASVDMQSSFNSAIQRLYDAMQTDEIARRAILENRDWVKRYEEIKADRDNL 720

Query: 732  SNKLSNAENGLVGQLESDLKQRDNILEKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXXX 791
              KLSNAE GLVGQL+ +++QRD+ILEK+QRV                            
Sbjct: 721  KEKLSNAEGGLVGQLQDEVRQRDHILEKSQRVNAQLQHELDESKKKLILAKHEHEVELRK 780

Query: 792  MLTILNS----------RNGTQNPDVDDVTITLDPNKKLDIQKALELELNKTKKDLSNDS 841
             LT +NS            G++NP        L P +KL IQKAL+ +L KT K+++ +S
Sbjct: 781  TLTAMNSNFEGSHNMRDEKGSENPR------PLRPERKLAIQKALQAKLEKTSKEINVES 834

Query: 842  KRFGITVQPNKRLKMLRMQMEDIENEARQLEMTNFADHKRTNXXXXXXXXXXXXXXXXXX 901
            KR G++++PNKRLK+LR +MEDIEN+AR+LEMTNF+D+++ +                  
Sbjct: 835  KRLGLSLEPNKRLKLLRSRMEDIENQARELEMTNFSDYQKDDIKEPEVSNEDDHKAV--- 891

Query: 902  XNTEEFDKENEMKTKKLMQLRKALAAIQSETNDISKFNVEGRVNEMFQDXXXXXXXXXXX 961
              +E  +K  ++   KL +LRK LA++Q E+NDISKFNVEGR +EMF             
Sbjct: 892  --SESEEKAQQISALKLEELRKKLASLQQESNDISKFNVEGRFHEMFSGQKSLALDRLKK 949

Query: 962  XXXXYKDFEIPFX----XXXXXXXXXXXXXXXHSTLDPTYLQKKINELDEISDELYLMNY 1017
                YK F I F                      TLDP   ++ +N ++E+S+ L  ++ 
Sbjct: 950  LETDYKGFGINFDPDSPLGQALAGKSVSSDDKARTLDP---KEALNIVEEVSNILSGLDS 1006

Query: 1018 XXXXXXXXXX-XXXXXXXXXXXXXXXMRSVSNAPSKGISEAGSFLESLSQKYGTGQNAIS 1076
                                       ++     +       SFLESLSQKYG  QN++S
Sbjct: 1007 SKAAEKSNETPLRTATSSDSSEDEMDDKNGDKIAADSTLPTSSFLESLSQKYGGAQNSLS 1066

Query: 1077 SPTSITSPNERIASQG--EKSFMNRLKRQTMAAPFLEELTQK 1116
            +  S           G   KSFMNR+KR T A P+L EL+ K
Sbjct: 1067 NRHSFAGGEINYPGSGYHRKSFMNRVKR-TGAVPYLGELSGK 1107

>KLLA0C02321g Chr3 complement(196533..202061) [5529 bp, 1842 aa] {ON}
            similar to uniprot|P41832 Saccharomyces cerevisiae
            YNL271C BNI1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNR1
          Length = 1842

 Score =  592 bits (1527), Expect = e-178,   Method: Compositional matrix adjust.
 Identities = 328/652 (50%), Positives = 432/652 (66%), Gaps = 43/652 (6%)

Query: 1260 PSLLQLTNSDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKGVLRNLEKAF 1319
            PSL +     R PRP+KKLKQLHW+K+D+   SIW    AE+ ADDL+E+GVL  LEKAF
Sbjct: 1223 PSLFE-----RYPRPKKKLKQLHWEKIDNAGDSIWKNAQAEKVADDLFERGVLSQLEKAF 1277

Query: 1320 AAREIKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTP 1379
            AARE KS+  + KE   KI+FLS D+SQQFGINLHM+ +L V +++ KV+KCDR  ++TP
Sbjct: 1278 AARETKSLKGKSKEANEKITFLSRDVSQQFGINLHMFSNLDVKDVVGKVMKCDREFLSTP 1337

Query: 1380 SVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQK--------FQRRIQMTYRELI 1431
            SVIEFL+K  I+EV+ NLAR + PY+TDWEGV S+   K         QR  Q+      
Sbjct: 1338 SVIEFLSKPTIIEVTNNLARYFNPYSTDWEGVTSVDDAKPPEKDPNELQRADQL------ 1391

Query: 1432 KFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVI 1491
             ++  M+NLQ YW SRMRA+ +IT+YE++Y++LVTKLRK+D+AV  +++SE+L++VF+VI
Sbjct: 1392 -YVEFMINLQPYWGSRMRAITMITTYEKDYSDLVTKLRKIDRAVQCIEQSESLRHVFDVI 1450

Query: 1492 LAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATNSMTFLNYVEKIVRDNYPSFNDFIDDLE 1551
            LAVGNYMND+SKQAQGFKLSTLQRLTFIKD  NSMTFLNYVEKI+R+NYP ++ F+++LE
Sbjct: 1451 LAVGNYMNDSSKQAQGFKLSTLQRLTFIKDEKNSMTFLNYVEKIIRENYPEYSHFVEELE 1510

Query: 1552 PVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAA 1611
            P+  V K+S+EQL++DC EFSQS++NVERS+EIGNLSD SKFHP D+VL KV+PVLPEA 
Sbjct: 1511 PIFSVTKISIEQLVTDCKEFSQSVINVERSIEIGNLSDPSKFHPLDRVLNKVVPVLPEAR 1570

Query: 1612 KKSSLLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEE 1671
            KK+ LL+DE+KL+++EFE LMKK+GEDA                ITE+KKA++ N+K EE
Sbjct: 1571 KKADLLSDEIKLSLLEFENLMKKFGEDANDKFSKNSFFQKFADFITEFKKAKTHNVKLEE 1630

Query: 1672 EERAYEKHKRMIEEQQHKQDLXXXXXXXXXXXXXXXQSDRRAMMDKLLEKLKNAGPGKAD 1731
            EERAYE+ K+MIE+QQ KQ                  SD R  ++KLL+KLKNA P K D
Sbjct: 1631 EERAYERRKKMIEDQQRKQQEADSKATAKNLSTSQEPSDDRDDIEKLLDKLKNAAPSKGD 1690

Query: 1732 PSSARKRALVRKKLLTDKEVTAHILQDI--DTGDDSIVYSPNTPTQEGPNDIHLASPTPS 1789
            PSS RKRAL RKKLL D +  A I  +I  D+  ++ V    T T+         SPT  
Sbjct: 1691 PSSTRKRALARKKLL-DGKSGASIFDNITADSTIEAFVEQNRTLTE---------SPTAK 1740

Query: 1790 GKSDLV-LASVSPTKESTADGIAEDEFISDRAKALLLELRGSENMKRNSQLEEQKEKLKA 1848
              + L    S+S +K+  A          DRA+ LLLELRG +  K  S    + +    
Sbjct: 1741 KSASLPETESLSSSKQDPA----------DRARNLLLELRGPDERKDASPSPIKAKDKLR 1790

Query: 1849 RRSRRRTQTESISSNKLFFTDEESHSTSPSESKGTEYEMTTANEEPEEILNA 1900
               ++ +  +    NKL F         P     T+  M T+N   +E ++A
Sbjct: 1791 DLKKKDSSVKVDQPNKLQFVGSLEVGPHPKPLSPTQDLMDTSNSSEDEFIDA 1842

 Score =  507 bits (1305), Expect = e-148,   Method: Compositional matrix adjust.
 Identities = 311/821 (37%), Positives = 453/821 (55%), Gaps = 53/821 (6%)

Query: 329  PPIHYVKKIIADRLTSEEMNDLWVTLRTEQLDWVDAFLEHQGHIAMANVLMNTIYKCAPG 388
            PP +YV++II+ ++ ++E+NDLWV+LRTE LDWV +FLE QG +A+AN+++ ++++    
Sbjct: 267  PPEYYVRQIISKKIKNKELNDLWVSLRTEPLDWVISFLEAQGQVAIANLIITSMHQDTTD 326

Query: 389  SE---LTPELQEKEHSFFKCFRVLSMLSQGLYEFAKHKLMSDTIANGLFSSRLATRKMAT 445
            ++     P+  E+E + FKC RVL  + + L E     L+++ +  GL S+++ TR++AT
Sbjct: 327  NQNAVTDPQFLERETALFKCLRVLLNIRECLEEAVNSTLVTNALVEGLLSTKIPTRRLAT 386

Query: 446  EVLVCMIEKRNNMR--------FEVVLASLDRYFRQEENLNMVHLSKTLPGEYPQSTPNT 497
            E L+ ++ K  + +        F +V+ SL+      +N++M     T     P+S P  
Sbjct: 387  ETLIYLVTKDEDFKSRTAGLDCFSLVMESLNHETSLVQNIHMKAKFSTNDSTDPESNPQL 446

Query: 498  K--YKIIQAWLIALDETLNGRGKMGSLVGASDDYRS-AGENAILEYCLWTMVFINHLCSN 554
                KI+Q WL  +++TL+GRGKMGSLVGASD+YR+  GEN+I EY + ++V I+ LC N
Sbjct: 447  YQVCKILQQWLYVVEQTLDGRGKMGSLVGASDEYRNNTGENSIYEYLVDSIVLIDQLCLN 506

Query: 555  SSLLNQRILLRTKLENLGALRIMTKLKRLDYEKLTEQIELYDNNKLDDFNTVLETESKNS 614
            +  + +R ++RT+L++ G  RI+ K++ LDY  L+  +  +++  +DD+N++++++    
Sbjct: 507  NEDVKKRHMMRTQLKSFGLNRILQKMQLLDYPPLSTMLLQFEDAAIDDYNSLIDSQKFTE 566

Query: 615  KVNMQNPNSLIENLWESCKGSDNEKXXXXXXXXXXXXXXKLMGEKEDPTKLSKQLKLIDS 674
             V+M +P S+++ L  S KG++ E               K   E +DP K  +QLKLIDS
Sbjct: 567  NVDMDDPVSILQKLTSSFKGTEAESYLLSMLQNLFLSSNKNAQESDDPGKNVQQLKLIDS 626

Query: 675  LLTNVNGSMFDEESHMNLAIQRLYDSMQTDEVARRAILESRTLTKKLEEAHAERDYLSNK 734
            L++NV  +  D ES+ N+AIQRLYDSMQTDE+ARRAILESR LTKKLEE  AERDYL++K
Sbjct: 627  LISNVAITTLDSESNFNVAIQRLYDSMQTDEIARRAILESRELTKKLEEVKAERDYLNDK 686

Query: 735  LSNAENGLVGQLESDLKQRDNILEKNQRVMXXXXXXXXXXXXXXXXXXXXXXXXXXXMLT 794
            +S AENGLVGQL+ +L +RD IL+K QRV                            MLT
Sbjct: 687  ISKAENGLVGQLQKELAERDLILDKTQRVTEQLQSELEELKKRHLLEKHEHEIELRKMLT 746

Query: 795  ILNSRNGT---QNPDVDDVTITLDPNKKLDIQKALELELNKTKKDLSNDSKRFGITVQPN 851
            I+NS+          V +    L+P +K  IQ  L+  L KT++DL N+S+R G  V   
Sbjct: 747  IVNSKTSDDLESGSTVQNDPKPLNPERKTAIQNVLQRSLQKTEQDLLNESRRLGTAVGSK 806

Query: 852  KRLKMLRMQMEDIENEARQLEMTNFADHKRTNXXXXXXXXXXXXXXXXXXXNTEEFDKEN 911
             RLK+LR +MEDIEN+AR+LEMTNFAD K                      N +  ++  
Sbjct: 807  SRLKLLRSKMEDIENQARELEMTNFADVK-------------------PKQNQKFKEQVK 847

Query: 912  EMKTKKLMQLRKALAAIQSETNDISKFNVEGRVNEMFQDXXXXXXXXXXXXXXXYKDFEI 971
              +  KL +LRK LA IQ+E+NDI+KFN+E RVNE+FQD               Y  F I
Sbjct: 848  GQQATKLAELRKKLAIIQNESNDITKFNIEARVNELFQDKKLAALDRLKDLENKYNGFHI 907

Query: 972  PFXXXXXXXXXXXXXXXXHSTLDPTYLQKKINELDEISDELYLM-----NYXXXXXXXXX 1026
             F                  +LDPT +Q+K+ E++ I DEL  +     N          
Sbjct: 908  DFADDPELKELLTQSSNGGPSLDPTIVQRKVEEMNSIIDELNALKEEMKNRPKTGSSSSS 967

Query: 1027 XXXXXXXXXXXXXXXXMRSVSNAPSKGISEAGSFLESLSQKYGTGQNAISSPTSITSPNE 1086
                                S+  S  +S   SFLESLSQKY TGQ   +S        E
Sbjct: 968  SSSLSSASSSSEDGSSQSQASHG-SDIVSNGSSFLESLSQKYSTGQQTATSTNGGRVGRE 1026

Query: 1087 -RIASQG--EKSFMNRLKRQTM--------AAPFLEELTQK 1116
             R    G   KSF+NRLK  T+          PFL EL  K
Sbjct: 1027 TRYPGSGYHRKSFLNRLKNTTVNPTATSEHLPPFLTELKSK 1067

 Score = 99.8 bits (247), Expect = 5e-20,   Method: Compositional matrix adjust.
 Identities = 66/186 (35%), Positives = 92/186 (49%), Gaps = 29/186 (15%)

Query: 45  ISSPKKPIVPKQFTSTEL---------RPLNKKSTLNTQNLSQYVSGTKIDQDNPNPLPT 95
           ISSPK+      FT+  L         +PLNK S+LNT NLS Y              P 
Sbjct: 55  ISSPKR-----VFTTASLESATPIGGSKPLNKISSLNTHNLSHYTMD-----------PE 98

Query: 96  NNTSHTRAHSSQSATKYSYSRRSSTATGPIKXXXXXXXXXXXXXXXXXXXXYTNLLKYID 155
            N+    A    S TKYSYSRRSS  T                         + L +++ 
Sbjct: 99  ANSRSQSASLLTSPTKYSYSRRSSQLT----RSSTNKSIISSSAVSVSSNSTSILNRFLT 154

Query: 156 SDGKINLEMPRDPHEVEALFEDLMYKRNIFQALPQDKQKELMSYDVTKKWTLVKQDLQNE 215
           +DG + L+ P +P E+  LF DL+ KRN+F ++    QK++++Y + KKW +VKQDLQ+E
Sbjct: 155 NDGTLKLDRPENPEEINGLFMDLLIKRNVFDSVSSQDQKDMLNYPIEKKWLMVKQDLQSE 214

Query: 216 IKKLMS 221
            K+L S
Sbjct: 215 FKRLKS 220

>SAKL0E15224g Chr5 complement(1269114..1273121) [4008 bp, 1335 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1335

 Score =  280 bits (715), Expect = 1e-75,   Method: Compositional matrix adjust.
 Identities = 152/416 (36%), Positives = 252/416 (60%), Gaps = 18/416 (4%)

Query: 1277 KLKQLHWDKLDSTDSSIWSKGMAERFADD-LYEKGVLRNLEKAFAAREI---KSIGTRKK 1332
            KL+Q+HWD ++    + WS+    +     L E GV   +E+ F  ++    K    +  
Sbjct: 859  KLRQIHWDNIEDIRETFWSEEEERKEKSKELQELGVFEEIEELFRIKQPVPKKPNVAKTS 918

Query: 1333 EDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEFLAKSEIVE 1392
            ++L K+SFLS D++QQFGINLHM+ +  V EL+ KVL C+  ++   SV+EF  K ++  
Sbjct: 919  QNLKKVSFLSRDLAQQFGINLHMFSNYTVHELVLKVLHCENEVVKNQSVLEFFNKEDLTN 978

Query: 1393 VSVNLARNYAPYTTD---WEGVKSLKMQKFQRRIQMTYRELIKFIYNMVNLQSYWASRMR 1449
            +S ++ +N+ PY+T+    EG       K    ++   R  ++  YN   L+SYW +RMR
Sbjct: 979  ISQSVKKNFEPYSTNVLTGEGP-----TKDVSELERADRIFLELCYN---LRSYWRARMR 1030

Query: 1450 ALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMNDTSKQAQGFK 1509
             L ++ +YE++Y +++ KL+K+D A  A++ S+ LK +  +I+ +GNYMN+  +QA+G K
Sbjct: 1031 CLLILLTYEKDYYDILYKLQKIDDATRAIRNSKRLKELLFIIVEIGNYMNN--RQARGIK 1088

Query: 1510 LSTLQRLTFIKDATNS-MTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLSVEQLISDC 1568
            LS+L +L F+K +TN+ M+FL+Y+E+I+R  Y      IDDL  +  + KL+V+Q+  DC
Sbjct: 1089 LSSLGKLAFVKASTNNNMSFLHYIERILRTKYMDLYGVIDDLSKISHLGKLTVDQVELDC 1148

Query: 1569 NEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDEVKLTIMEF 1628
             EF++ I N+ERS + G+LS +  FHP D +++K    +P A +K SLL D+ KLT+ + 
Sbjct: 1149 REFNERIDNMERSFKTGDLSKTQNFHPEDLIVSKTKHKIPIAKRKRSLLMDQCKLTMHDL 1208

Query: 1629 EALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEEEERAYEKHKRMIE 1684
            E LM   GE+                 ++ +KKA  +N+++EE ER YE+ K+++E
Sbjct: 1209 EKLMTYCGEEPKDHNAKNTFFQNFIDFVSLFKKAARENIEKEEVERIYEQRKKLLE 1264

 Score = 42.7 bits (99), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 31/107 (28%), Positives = 58/107 (54%), Gaps = 10/107 (9%)

Query: 667 KQLKLIDSLLTNVNGSMFDE------ESHMNLAIQRLYDSMQTDEVARRAILESRTLTKK 720
           K  KL  S+L  +    FD       ES +  ++ ++ DS+Q+DE+ARRA+ E  +L + 
Sbjct: 439 KLFKLFHSILCYLKDHTFDSDSGEGPESALKTSLNQMMDSLQSDEIARRAMKELNSLQET 498

Query: 721 LEEAHAERDYLSNKLSNAENGLVGQLE---SDLKQRDNILEK-NQRV 763
           +++  AE + L  +    +  ++ QLE     L+ +D  L++ N+R+
Sbjct: 499 VDQLTAEVESLKEERKVTKGEVIMQLEEARESLRDKDETLKQLNERI 545

>Kpol_416.10 s416 (35789..38224,38226..40265) [4476 bp, 1491 aa] {ON}
            (35789..38224,38226..40265) [4476 nt, 1492 aa]
          Length = 1491

 Score =  280 bits (715), Expect = 2e-75,   Method: Compositional matrix adjust.
 Identities = 157/434 (36%), Positives = 251/434 (57%), Gaps = 17/434 (3%)

Query: 1265 LTNSDRLPRPQ--KKLKQLHWDKLDSTDSSIWSKGMAER-FADDLYEKGVLRNLEKAFAA 1321
            LTN  + P+PQ  K LKQ+HWDK+++ D++IW   +  R    +L    +   +E +F  
Sbjct: 987  LTNMAK-PKPQHVKNLKQIHWDKVENIDNTIWKYNLENREILKELEYGSIFNQVEDSFKI 1045

Query: 1322 REI---KSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINT 1378
            +E+   KS   + KE  +  SFLS D++QQFGINLHMY +    E ++ VL C   +I  
Sbjct: 1046 KEVVIKKSKTEKNKEKSNLKSFLSRDLAQQFGINLHMYSNYTEKEFLDLVLSCSDEVIKN 1105

Query: 1379 PSVIEFLAKSEIVEVSVNLARNYAPYTTDW-EGVKSLKMQKFQRRIQMTYRELIKFIYNM 1437
             SV+EF  K +++ +  +++RNYAPY+ D+  G + +K      R    + EL       
Sbjct: 1106 ISVLEFFCKEDLINIPGSISRNYAPYSRDYLSGEEPVKDSSELERADKLFLELC------ 1159

Query: 1438 VNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNY 1497
             NL+ YWA R + L ++ +YER+Y +LV KL+K+D A+  +  S+  ++   ++L +GNY
Sbjct: 1160 YNLRYYWADRSQCLLLLYTYERDYYDLVFKLQKIDDAIQRLLNSQRFRDFLYIVLEIGNY 1219

Query: 1498 MNDTSKQAQGFKLSTLQRLTFIKDATNS-MTFLNYVEKIVRDNYPSFNDFIDDLEPVLDV 1556
            MN   K  +G K+S+L +L FIK ++N+ ++FL+++EK++R  YP    FIDDL  V D+
Sbjct: 1220 MN--KKTVEGVKISSLSKLAFIKSSSNNNISFLHFIEKLIRTRYPEVYGFIDDLTKVEDL 1277

Query: 1557 VKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSL 1616
             K+++E + ++C+EF   + +V  S+  G LS S K HP+D +L KV   +  A  KS L
Sbjct: 1278 GKVTLEHIGTECDEFCAKVNSVVYSVTNGKLSKSEKLHPNDSILKKVKYKVSRAKTKSEL 1337

Query: 1617 LTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEEEERAY 1676
            L D+  LT  +   L+  YGED                 ++ +KK   +N+++EE ER Y
Sbjct: 1338 LKDQYNLTKHDVTKLLVYYGEDPKDKDSNDSFFSNILEFLSVFKKCAKENIEREESERVY 1397

Query: 1677 EKHKRMIEEQQHKQ 1690
            E+ K M+E Q  K+
Sbjct: 1398 EQRKNMLESQSKKE 1411

 Score = 35.4 bits (80), Expect = 1.7,   Method: Compositional matrix adjust.
 Identities = 21/69 (30%), Positives = 39/69 (56%)

Query: 680 NGSMFDEESHMNLAIQRLYDSMQTDEVARRAILESRTLTKKLEEAHAERDYLSNKLSNAE 739
           N ++   ES +  +I  L D +Q+DE+ARRA+ E ++L + ++   +E   L  +    +
Sbjct: 497 NDTLLSPESTVQNSINELMDRLQSDEIARRAMNEMKSLEQIIDNLQSEISSLKEERQLDK 556

Query: 740 NGLVGQLES 748
             L+ QL+S
Sbjct: 557 GELIAQLKS 565

>AFR301C Chr6 complement(981209..986176) [4968 bp, 1655 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1655

 Score =  273 bits (699), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 164/474 (34%), Positives = 260/474 (54%), Gaps = 29/474 (6%)

Query: 1265 LTNSDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFA--DDLYEKGVLRNLEKAFAAR 1322
            LT     P  + KLKQ+HWDK+++   ++W     +R +   +L   G+ + +E+ F   
Sbjct: 1153 LTQQPSPPSTRIKLKQIHWDKIENIKETVWCDEQ-QRVSKSSELESLGIFKEIEELF--- 1208

Query: 1323 EIKSIGTRK--------KEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRN 1374
            EIK   T          K   S+IS LS +++Q+FGINLH++    V EL++KVL CD  
Sbjct: 1209 EIKPASTNLANATASLLKAKSSRISLLSRELAQEFGINLHVFSLYTVEELVDKVLSCDSE 1268

Query: 1375 LINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDW-EGVKSLKMQKFQRRIQMTYRELIKF 1433
            ++    V+EF  K E   V  ++ R + PY T++  G +  K      R    Y EL   
Sbjct: 1269 VMKNQGVLEFFCKEEANNVPQSIQRLFGPYETNYLTGERPEKDPAELERADRIYLEL--- 1325

Query: 1434 IYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILA 1493
                 NL+SYWA+R   L VI+++ER+Y +++ KL+++D A  A+Q S  LK +F +I+ 
Sbjct: 1326 ---FYNLRSYWAARSNYLLVISTFERDYFDILYKLQRIDDATKAIQSSNKLKELFFIIVE 1382

Query: 1494 VGNYMNDTSKQAQGFKLSTLQRLTF---IKDATNSMTFLNYVEKIVRDNYPSFNDFIDDL 1550
            +GNYMN   K  QG +LS+L +L F   IKD  N+++F++ +E+IVR  YPS +DF++ +
Sbjct: 1383 IGNYMNQ--KPVQGIQLSSLNKLAFTKTIKD--NNLSFIHVLERIVRTRYPSVHDFVEGI 1438

Query: 1551 EPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEA 1610
              +  V  + V+ +  + +EF   I N++RSL  G LSD SKFHP D+ L +    L +A
Sbjct: 1439 NSITGVANIIVQHVQQEAHEFCDRIANLDRSLASGKLSDPSKFHPKDRFLQRTDTKLAQA 1498

Query: 1611 AKKSSLLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQE 1670
             KK+ LL D+  LTI +FE LM  +GE+                 I  ++KA  +N ++E
Sbjct: 1499 KKKARLLRDQCSLTISDFEKLMLYWGENPANPNSKNTFFQKFIDFILLFRKAAKENTERE 1558

Query: 1671 EEERAYEKHKRMIEEQQHKQDLXXXXXXXXXXXXXXXQSDRRAMMDKLLEKLKN 1724
            E +R YEK +R++E+    QD                 +D+ A +D L+ +L++
Sbjct: 1559 ELDRTYEKRRRLLEQTAALQDRRRSSGLSSVPSSAGDSADKDA-VDTLMRRLRD 1611

>NCAS0G00120 Chr7 (7566..11510) [3945 bp, 1314 aa] {ON} Anc_5.717
          Length = 1314

 Score =  269 bits (688), Expect = 2e-72,   Method: Compositional matrix adjust.
 Identities = 150/434 (34%), Positives = 249/434 (57%), Gaps = 21/434 (4%)

Query: 1268 SDRLPRPQ----KKLKQLHWDKLDSTDSSIW-SKGMAERFADDLYEKGVLRNLEKAFAAR 1322
            S+ LP P+    KK+KQ+HW+K++  +++ W ++   E    +L   G+ + +E  F  +
Sbjct: 806  SNSLPVPKLSETKKIKQIHWEKIEDIENTFWDNEQEREETVTELRHMGIFKQIEDIFKMK 865

Query: 1323 EIKSIGTRKKEDLSK---ISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTP 1379
             +  I  +KK   S    ISFLS D++QQFGINLH++  L+  EL+ KVL+CD +++   
Sbjct: 866  NVSVIMKKKKVVSSSTELISFLSRDLAQQFGINLHIFVQLSEDELVSKVLRCDDDILENV 925

Query: 1380 SVIEFLAKSEIVEVSVNLARNYAPYTTDW---EGVKSLKMQKFQRRIQMTYRELIKFIYN 1436
            SV+EF  K E+  ++ +L R+  PY+TD+   E V +    + QR  ++       F+  
Sbjct: 926  SVLEFFCKEEMTHINPSLVRHLTPYSTDYMNPESVPTKNPDELQRADKI-------FLKL 978

Query: 1437 MVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGN 1496
              NL+SYW  R + L ++ +YE++Y +L+ KL+K+D A+  +  SE  KN+  +I+ +GN
Sbjct: 979  SFNLRSYWNERSQCLLLLCTYEKDYYDLLYKLQKIDDALQRIYHSERFKNLLYIIVEIGN 1038

Query: 1497 YMNDTSKQAQGFKLSTLQRLTFIK-DATNSMTFLNYVEKIVRDNYPSFNDFIDDLEPVLD 1555
            +MN  ++   G +LS L +L FIK +  N+++FL+Y+E+++R +Y     FIDDL  V +
Sbjct: 1039 FMN--TRPVSGIRLSALNKLAFIKSNNDNNVSFLHYIERVIRIHYADVYGFIDDLHKVEE 1096

Query: 1556 VVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSS 1615
            + K+S++Q+   C EF   I  +  ++  G LSD  K HP D++L KV   +  A  K  
Sbjct: 1097 LGKISMDQVALQCEEFCSKIDKMVFNITKGKLSDPLKLHPDDQILKKVKYKINRARTKGE 1156

Query: 1616 LLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEEEERA 1675
            LL D  KL+  +FE +M+ YGED                  T +KK   +N+++EE ER 
Sbjct: 1157 LLGDHFKLSNNDFEKVMRYYGEDPTDVESKSVFFQTFVEFSTLFKKCAKENMEREEAERV 1216

Query: 1676 YEKHKRMIEEQQHK 1689
            Y + K+++E    K
Sbjct: 1217 YAQRKKIMEASTRK 1230

 Score = 37.7 bits (86), Expect = 0.38,   Method: Compositional matrix adjust.
 Identities = 32/105 (30%), Positives = 55/105 (52%), Gaps = 15/105 (14%)

Query: 666 SKQLKLIDSLLT----NVNGSMFDE-ESHMNLAIQRLYDSMQTDEVARRAILESRTLTKK 720
           SK L+ ++S L     N N + ++  E+    ++  L DS+Q+DE+A+RA+LE       
Sbjct: 460 SKLLQFMESFLQYSLDNSNHNHYEHPETLFQESVNNLMDSLQSDEIAKRAMLE------- 512

Query: 721 LEEAHAERDYLSNKLSNAENGLV---GQLESDLKQRDNILEKNQR 762
           L+E  ++ + LSN+L+   N        +   LKQ  ++LE   R
Sbjct: 513 LDEKQSQMNILSNQLTKLRNEKTMDKSDILDQLKQVTDLLESKDR 557

>Ecym_5679 Chr5 (1380448..1384368) [3921 bp, 1306 aa] {ON} similar to
            Ashbya gossypii AGL364C
          Length = 1306

 Score =  266 bits (679), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 157/457 (34%), Positives = 257/457 (56%), Gaps = 18/457 (3%)

Query: 1277 KLKQLHWDKLDSTDSSIWSKGMAERFA--DDLYEKGVLRNLEKAF-----AAREIKSIGT 1329
            KLKQ+HWDK+D    ++WS    ER +   +L   GV + +E+ F     A +   ++ T
Sbjct: 815  KLKQIHWDKIDDISKTVWSDD-KERVSVSSELANFGVFKEIEELFKIVPAAPKVGNTMFT 873

Query: 1330 RKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEFLAKSE 1389
             +     K++ LS+D++QQFGINL+++ + +V EL+EKVL CD  ++   SVIEF +K +
Sbjct: 874  AQNTRNGKVTLLSNDLAQQFGINLYIFSNYSVEELVEKVLLCDTEVMKNQSVIEFFSKDD 933

Query: 1390 IVEVSVNLARNYAPYTTDWEGVKSLKMQKFQRRIQMTYRELIKFIYNMVNLQSYWASRMR 1449
            I  +  ++ R +APY T++  +   K +K  R +    R  ++  YN   L+SYWA R +
Sbjct: 934  INHIPQSIQRMFAPYETNY--LTGDKPEKDSRSLDRADRIYLELFYN---LRSYWAPRAK 988

Query: 1450 ALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMNDTSKQAQGFK 1509
             L  + +YE++Y +++ KL+++D    A++ S+ LK +  +I+ VGNYMN+  KQA G +
Sbjct: 989  YLLALLTYEKDYYDILYKLQRIDDGTTAIKTSKRLKPLLFIIIEVGNYMNN--KQALGIQ 1046

Query: 1510 LSTLQRLTFIKDAT-NSMTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLSVEQLISDC 1568
            LS+L +L F K +  N+++F++ +E IVR NYP  + F++DLE +LDV  + V+ +  + 
Sbjct: 1047 LSSLNKLAFTKTSKDNNLSFIHVIESIVRLNYPDLHGFVNDLEKILDVSNIIVQHVQQEA 1106

Query: 1569 NEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDEVKLTIMEF 1628
             EF + I  +ERSL +G LSDSSKFHP DK L      +  A KK+ LL  +  LT+ EF
Sbjct: 1107 QEFYEKISTLERSLRVGVLSDSSKFHPKDKFLINTESNISHAMKKADLLKQQCTLTMGEF 1166

Query: 1629 EALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEEEERAYEKHKRMIEEQQH 1688
            + LM  +GED                    +KKA  +N+  E E R   + +R + E+  
Sbjct: 1167 DKLMVFWGEDPNNVFSKNTFFQKFLDFALLFKKANKENI--EREVRRVCESRRYLLEKTG 1224

Query: 1689 KQDLXXXXXXXXXXXXXXXQSDRRAMMDKLLEKLKNA 1725
               +                SD +  ++ L+++L+N 
Sbjct: 1225 NSHIRVDRSERCTLPSLPADSDDQQAVEILIKRLRNV 1261

 Score = 34.3 bits (77), Expect = 4.6,   Method: Compositional matrix adjust.
 Identities = 25/101 (24%), Positives = 43/101 (42%), Gaps = 8/101 (7%)

Query: 505 WLIALDETLNGRGKMGSLVGASDDYRSAGENAILEYCLWTMVFINHLCSNSSLLNQRILL 564
           W  A D T++   +       S       +  +++YC+ TM  +N +       N++   
Sbjct: 286 WFTAFDNTISDESQWHQ----SSFIIQKPQQLMIDYCVSTMFLVNSIVQGLPSYNEKRKT 341

Query: 565 RTKLENLGALRIMTKL----KRLDYEKLTEQIELYDNNKLD 601
              L+  G  RI  K+    KR D E L +QI  Y + ++D
Sbjct: 342 LAMLKYAGIHRIFQKISNSKKRFDSEILLDQIAKYRDREVD 382

>KLTH0E00704g Chr5 (70073..74242) [4170 bp, 1389 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1389

 Score =  266 bits (680), Expect = 3e-71,   Method: Compositional matrix adjust.
 Identities = 151/414 (36%), Positives = 245/414 (59%), Gaps = 15/414 (3%)

Query: 1277 KLKQLHWDKLDSTDSSIWSK-GMAERFADDLYEKGVLRNLEKAFAAREIKSIGTRKKEDL 1335
            KLKQ+HWDKL+    +IWS+ G  +  A  L   G L  + + F  R  +S+  + K + 
Sbjct: 920  KLKQIHWDKLEDVSETIWSQEGERQDAARHLESSGFLDEIAELF--RVNQSLPIKAKSET 977

Query: 1336 S----KISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEFLAKSEIV 1391
            S    K+S L  D++QQFGINLHM+ +L+V E + KVL CDR+++N  SV+EF A+ ++ 
Sbjct: 978  SSGKDKVSILPRDLAQQFGINLHMFSNLSVDEFVNKVLHCDRDVVNNQSVLEFFAREDLS 1037

Query: 1392 EVSVNLARNYAPYTTDWEGVKSLKMQKFQRRIQMTYRELIKFIYNMVNLQSYWASRMRAL 1451
             +  ++A    PY TD +  ++  + +   +++   R  ++  YN   L+SYW  R   L
Sbjct: 1038 IIPRSIASKLEPYATDHQPNEAPLLDR--EKLERADRIFLELCYN---LRSYWRPRSLCL 1092

Query: 1452 KVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMNDTSKQAQGFKLS 1511
              +++YE++Y +L+ KL++VD A+  ++ S  LK+   +I+ +GNYMN   KQA G +LS
Sbjct: 1093 LTLSTYEKDYFDLIYKLQRVDDAINIIKNSAKLKDTLMMIIEIGNYMN--RKQAGGIRLS 1150

Query: 1512 TLQRLTFIKDATN-SMTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLSVEQLISDCNE 1570
            +LQ+LTF+K + + +M+ L+ VE+ +R    S   F++DL  VLD+  L V Q+  D +E
Sbjct: 1151 SLQKLTFVKSSKDKNMSLLHAVERFLRVKCRSAYGFVEDLSRVLDLGNLMVGQIEQDFHE 1210

Query: 1571 FSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDEVKLTIMEFEA 1630
            ++Q I  V++SLE G LS    FHP D++L KV P +  A +K+SLL ++  LT+   E 
Sbjct: 1211 YTQRISGVKQSLEQGRLSKPENFHPEDRLLIKVGPKIAGATRKASLLRNQFVLTMRALEN 1270

Query: 1631 LMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEEEERAYEKHKRMIE 1684
            LMK YGED                 ++++KK   +N ++E  ER Y + K +++
Sbjct: 1271 LMKLYGEDPSNIDSKNEFFQHFINFVSQFKKVAKENEEKEAVERIYIQRKELLQ 1324

 Score = 34.7 bits (78), Expect = 3.4,   Method: Compositional matrix adjust.
 Identities = 17/61 (27%), Positives = 40/61 (65%)

Query: 687 ESHMNLAIQRLYDSMQTDEVARRAILESRTLTKKLEEAHAERDYLSNKLSNAENGLVGQL 746
           ES +++++ +L D++Q+DE+A RA+ E +T    +++ ++E   L  + S ++  ++ +L
Sbjct: 493 ESVISVSLNQLVDNLQSDEIAERAMSELKTAQNSIDQLNSEIQILQKERSVSKGSILSEL 552

Query: 747 E 747
           E
Sbjct: 553 E 553

>Smik_9.9 Chr9 (19563..23687) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  265 bits (677), Expect = 6e-71,   Method: Compositional matrix adjust.
 Identities = 142/431 (32%), Positives = 238/431 (55%), Gaps = 30/431 (6%)

Query: 1272 PRP-QKKLKQLHWDKLDSTDSSIWSKGMA-ERFADDLYEKGVLRNLEKAFAAREIKSIGT 1329
            P P +K+LKQ+HWDK++    ++W  G+  +     L   G+   +E  F  +    I  
Sbjct: 870  PVPTEKRLKQIHWDKVEDIKDTLWEDGLQRQETIRGLQTDGIFSQIEDIFKMKSPTKIAN 929

Query: 1330 R---------------KKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRN 1374
            +                  +L KISFLS D++QQFGINLHM+  L+  E + KVLKCD +
Sbjct: 930  KTSAISSTVLSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKVLKCDND 989

Query: 1375 LINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQKFQRRIQMTYRELIKFI 1434
            ++   ++++F  K E+V +  +L   Y PY+    G  +  +Q+  R     + EL    
Sbjct: 990  IVQNVNILKFFCKEELVNIPKSLLNKYEPYSRGENGKAASDLQRADR----IFLELC--- 1042

Query: 1435 YNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAV 1494
               +NL+ YW  R ++L  +++YER+Y +L+ KL+ +D  +  + RS+  KN+  +I  +
Sbjct: 1043 ---INLRFYWNVRSKSLLTLSTYERDYYDLIFKLQNIDDGISHLNRSDKFKNLMFIITEI 1099

Query: 1495 GNYMNDTSKQAQGFKLSTLQRLTFIKDATN-SMTFLNYVEKIVRDNYPSFNDFIDDLEPV 1553
            GN+MN   +  +G KL +L +L F++ +T+ +M+FL+++EKI+R  YP    F+DDL+ V
Sbjct: 1100 GNHMN--KRIVKGIKLKSLTKLVFVRSSTDQTMSFLHFIEKIIRIKYPDIYGFVDDLKKV 1157

Query: 1554 LDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKK 1613
             D+ K+S+E +  +C+EF   I N+    + G LS+     P D+++ KV   +  A  K
Sbjct: 1158 EDLGKISLEHIEIECHEFHNKIENLVTQFQTGKLSNEENLDPRDQIVKKVKFKINRARIK 1217

Query: 1614 SSLLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEEEE 1673
            S LL D+ KLT+++   LM+ YGED                 +T +KK   +N+++EE E
Sbjct: 1218 SELLMDQCKLTLIDLNKLMRYYGEDPNDKESKNEFFQPFIEFLTMFKKCAKENIEKEEME 1277

Query: 1674 RAYEKHKRMIE 1684
            R YE+ K ++E
Sbjct: 1278 RVYEQRKNLLE 1288

 Score = 38.9 bits (89), Expect = 0.17,   Method: Compositional matrix adjust.
 Identities = 26/71 (36%), Positives = 38/71 (53%), Gaps = 9/71 (12%)

Query: 671 LIDSLLTNVNGSMFDE--------ESHMNLAIQRLYDSMQTDEVARRAILESRTLTKKLE 722
           LIDS     N S FDE        +S    ++ +L DS+Q+DE+ARRA+ E   L KK+ 
Sbjct: 482 LIDSFQVPTNPS-FDENIESAENADSVFQDSVNKLLDSLQSDEIARRAVTEIDDLNKKIS 540

Query: 723 EAHAERDYLSN 733
             + + D + N
Sbjct: 541 HLNEKLDLVEN 551

>Ecym_4004 Chr4 (8927..13291) [4365 bp, 1454 aa] {ON} similar to
            Ashbya gossypii AFR301C - AGL364C
          Length = 1454

 Score =  263 bits (672), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 155/475 (32%), Positives = 257/475 (54%), Gaps = 18/475 (3%)

Query: 1260 PSLLQLTNSDRLPRPQKKLKQLHWDKLDSTDSSIWSKGMAERFAD--DLYEKGVLRNLEK 1317
            P + +L N   L  P+ KLKQ+HWDK+D    ++W    ++R +   +L   G+ + +++
Sbjct: 944  PDIPKLGNVTLLSAPKLKLKQIHWDKIDDIKETVWC-DQSQRVSKSTELASFGIFQEIDE 1002

Query: 1318 AFAAREIKSIGTRKKEDL-----SKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCD 1372
             F              +L     +K+S LS +++Q+FGINLH++    V EL  KVL CD
Sbjct: 1003 LFQLNPTSPAIANATANLLKAKSTKVSLLSRELAQEFGINLHIFSHYTVEELTSKVLNCD 1062

Query: 1373 RNLINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDW-EGVKSLKMQKFQRRIQMTYRELI 1431
              ++   SVIEF  K EI  +  ++ + +APY+ ++  G +  +      R    Y EL 
Sbjct: 1063 NEVLKNQSVIEFFCKEEINNIPKSVQQLFAPYSANYITGEQPDRDPNELDRADRIYLEL- 1121

Query: 1432 KFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVI 1491
                   NL+SYW +R + L VI +++++Y +++ KL ++D A  A+Q S  LK +F +I
Sbjct: 1122 -----FYNLRSYWGARSKYLLVILTFDKDYFDILHKLERIDDATKALQNSAKLKELFFII 1176

Query: 1492 LAVGNYMNDTSKQAQGFKLSTLQRLTFIKDAT-NSMTFLNYVEKIVRDNYPSFNDFIDDL 1550
            + +GNYMN   +   G +LS+L +L F K +T N+M+F++ +E+IVR  YPS +DF++ L
Sbjct: 1177 VEIGNYMNQ--RPVAGIQLSSLNKLAFTKTSTDNNMSFIHVIERIVRRKYPSIHDFVEGL 1234

Query: 1551 EPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEA 1610
            + +L+V  + V+ +  + +EF   I ++ER   IG LSD S+FHP DK + K    +  A
Sbjct: 1235 DKILEVQNIIVQHVQQEAHEFCDRIAHLERLTTIGILSDPSRFHPEDKFMLKTESKILLA 1294

Query: 1611 AKKSSLLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQE 1670
             KK+ LL D+  LT+ +FE LM  +GE+                 IT ++KA  +N ++E
Sbjct: 1295 KKKADLLKDQCTLTMSDFEKLMVYWGENPNNTNSKNSFFKKFIDFITLFRKAGKENSERE 1354

Query: 1671 EEERAYEKHKRMIEEQQHKQDLXXXXXXXXXXXXXXXQSDRRAMMDKLLEKLKNA 1725
            E  R YEK +R +E+    Q                  + +   +D L++KL+N 
Sbjct: 1355 EMTRIYEKRRRALEQSASSQRQRRRASRLSTAASMDDGTQQEDAVDTLIKKLRNV 1409

>TDEL0F05560 Chr6 complement(1037567..1041445) [3879 bp, 1292 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1292

 Score =  261 bits (668), Expect = 4e-70,   Method: Compositional matrix adjust.
 Identities = 152/482 (31%), Positives = 255/482 (52%), Gaps = 39/482 (8%)

Query: 1273 RPQKKLKQLHWDKLDSTDSSIWS-KGMAERFADDLYEKGVLRNLEKAFAARE--IKSIGT 1329
            +P++ LKQ+HW+KL+  + ++W+ +   +    +L   G+   +E++F  +E  IK    
Sbjct: 798  KPKEALKQIHWEKLNDIEETLWADQNQKDETMKELKRGGIFSQIEESFKVKERTIKQTKN 857

Query: 1330 R-KKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEFLAKS 1388
            + K+E     SFL  D++QQFGINLHM+   +  + + KVL+CD  +I   + +EF  + 
Sbjct: 858  KDKREKTPTKSFLPRDVAQQFGINLHMFSQYSPEQFVLKVLQCDNEIIQNSTALEFFTRE 917

Query: 1389 EIVEVSVNLARNYAPYTTDW--EGVKSLKMQKFQRRIQMTYRELIKFIYNMVNLQSYWAS 1446
            ++V V+ +L R + PY+TD+  E   S    +  R  ++       F+    NLQ YW  
Sbjct: 918  DLVNVTQSLRRAFDPYSTDYLSEDGPSKDPAELDRPDRI-------FLELCYNLQYYWYE 970

Query: 1447 RMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMNDTSKQAQ 1506
            R   L  +T+YER+Y + + +L+K+D  +  ++     K++  +I+ +GNYMN   + A+
Sbjct: 971  RSFCLFTLTTYERDYYDFIYRLQKIDDVIQKLRHGTRFKSILYIIVEIGNYMN--KRPAE 1028

Query: 1507 GFKLSTLQRLTFIKDATNSMT-FLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLSVEQLI 1565
            G KLS+L +L F+K + +  T FL+++E+I+R  YP    F DDL  V D+ K+S++ L 
Sbjct: 1029 GIKLSSLNKLAFVKSSVDKNTSFLHFLERIIRVKYPDLYGFTDDLSKVEDIGKISLDHLE 1088

Query: 1566 SDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDEVKLTI 1625
             +CNEF   I  V  +L+ G LSD S+ HP D ++ K+   +  A  KS LL D+ KL  
Sbjct: 1089 QECNEFRSKIDEVVHTLKEGKLSDHSRLHPKDLIVEKITYKIRRAKVKSDLLQDQFKLIN 1148

Query: 1626 MEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEEEERAYEKHKRMIEE 1685
            ++ + LM  +GED                    +KK   +N+++E+ +R YE+ K M+E 
Sbjct: 1149 IDLKKLMSHFGEDFNDSEAKNSFFQHFIEFSVNFKKCAKENIEREDSQRVYEQRKNMLES 1208

Query: 1686 QQ-----HKQDLXXXXXXXXXXXXXXXQSDRRAMMDKLLEKLKNAGPGKADPSSARKRAL 1740
            +Q     H  DL               Q +    +D LL KL+     +  P   R+R +
Sbjct: 1209 RQRTASNHNSDL---------------QGEDEDAVDVLLAKLRGT---EEKPGLVRRRKI 1250

Query: 1741 VR 1742
             R
Sbjct: 1251 TR 1252

>CAGL0H06765g Chr8 complement(672619..676503) [3885 bp, 1294 aa] {ON}
            similar to uniprot|P40450 Saccharomyces cerevisiae
            YIL159w BNR1
          Length = 1294

 Score =  261 bits (668), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 156/471 (33%), Positives = 264/471 (56%), Gaps = 26/471 (5%)

Query: 1272 PRPQKKLKQLHWDKLDSTDSSIWSKGMAERFADDLYEKGVLRNLEKAFAARE-IKS--IG 1328
            P+   +LKQ+HW+K+D    ++W + ++    D L ++GV   +EK F   E +K   + 
Sbjct: 816  PKSTIRLKQIHWEKVDDVGGTLW-EDVSGIPLDHLKDEGVFSQIEKYFKILEPVKKTKVL 874

Query: 1329 TRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEFLAKS 1388
               +   +KISFL+ DI+QQFGINLHMY  L+V E + KVLKC+ +LI   SV+ F  K 
Sbjct: 875  AENENKPTKISFLTRDIAQQFGINLHMYSQLSVEEFVTKVLKCEDDLIQNVSVLGFFTKE 934

Query: 1389 EIVEVSVNLARNYAPYTTDWEGVKSLKMQKFQRRIQMTYRELIKFIYNMVNLQSYWASRM 1448
            ++ ++   L R +APY+T++  +     +K  R ++      ++  YN   L+SYW++R 
Sbjct: 935  DLTQIPSGLERKFAPYSTNY--LTDDSPEKDPRELERADHIYLELFYN---LRSYWSARS 989

Query: 1449 RALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMNDTSKQAQGF 1508
              L V+T+YER+Y +L+ KL K+D+A+  +  S  +K +  +I  +GNYMN  S    G 
Sbjct: 990  HCLLVLTTYERDYFDLMYKLEKIDEAIQRLYDSTRIKKLLLIIREIGNYMNKGS--VTGI 1047

Query: 1509 KLSTLQRLTFIKDAT-NSMTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLSVEQLISD 1567
            KL++L +L+F+K ++  +++FL++VE++VR+++P    F +D+  V D+ K+++E +  +
Sbjct: 1048 KLNSLPKLSFVKSSSEKNISFLHFVERVVRESFPDVYTFTEDIAKVEDLGKVTLEHVELE 1107

Query: 1568 CNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDEVKLTIME 1627
            C EF++ + +V  SL  G LSD +K HP D + TK+   +  A  KS LL ++ +LT   
Sbjct: 1108 CEEFAEKVGSVVYSLTQGKLSDPTKLHPKDAIFTKMRYKINRAKSKSELLINQHELTKRS 1167

Query: 1628 FEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEEEERAYEKHKRMIEEQQ 1687
               LMK YGE+                    +KK   +N+++EE  R YE+ K ++E++ 
Sbjct: 1168 LNRLMKYYGEEPMDKESKNNFFNYFVEFAMVFKKCAKENIEREEVTRLYEQRKHLLEQRN 1227

Query: 1688 HKQDLXXXXXXXXXXXXXXXQSDRRAMMDKLLEKLKNAGPGKADPSSARKR 1738
             K +                  D    +D L+ KL++A   K  P+  R+R
Sbjct: 1228 KKIE------------EQEHSDDEINAVDDLITKLRDA--KKQHPAPLRRR 1264

 Score = 37.7 bits (86), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 58/234 (24%), Positives = 108/234 (46%), Gaps = 27/234 (11%)

Query: 537 ILEYCLWTMVFINHLCSNSSLLNQRILLRTKLENLGALR-IMTKLKRLDYEKLTEQIELY 595
           ++EYC   M  +N +        ++  +    EN+     ++T ++ LD E  + QI+ Y
Sbjct: 266 LVEYCTLFMFMVNSIIEGYQSFEKKSAIIASFENVEKFTPLITLIENLDDENTSTQIKKY 325

Query: 596 DNNKLDDFNTVLETESKNSKVNMQNPNSLIENLWESCKGSDNE-KXXXXXXXXXXXXXXK 654
            + KL       E  ++NS V      S++E++  S   +D   +               
Sbjct: 326 RDVKL-------EIMTRNSCVP-----SILEDVSYSQVLTDLVIQTKNTALESGLGNLFT 373

Query: 655 LMGEKEDPTKLS---KQLKLIDSLLTNVNGSMFDEESHMNL------AIQRLYDSMQTDE 705
           L+ +     KL+   K LKLI  L+  +N  +  E+S  N       AI  L D++Q+++
Sbjct: 374 LVFQVIHTKKLNECIKFLKLIALLVPYLNKVLTVEDSLENPDYFFKDAITTLVDNLQSED 433

Query: 706 VARRAILESRTLTKKLEEAHAERDYLSNKLSNAENGLVGQLESDLKQRDNILEK 759
           + RRA++E +TL K + E ++    L N+    +  ++ Q    LKQ +++LE+
Sbjct: 434 LTRRAMVEIKTLEKNITELNSHIAELENEAHMDKRTIIQQ----LKQAEHMLEE 483

>Kwal_55.19620 s55 (52863..57032) [4170 bp, 1389 aa] {ON} YIL159W
            (BNR1) - involved in actin filament organization [contig
            159] FULL
          Length = 1389

 Score =  261 bits (667), Expect = 9e-70,   Method: Compositional matrix adjust.
 Identities = 148/417 (35%), Positives = 244/417 (58%), Gaps = 15/417 (3%)

Query: 1276 KKLKQLHWDKLDSTDSSIWSKGMAER-FADDLYEKGVLRNLEKAF---AAREIKSIGTRK 1331
            ++LKQ+HWDK++    +IW++       A  L E G+L  +   F    +   K+   R 
Sbjct: 919  QRLKQIHWDKIEDVKETIWNEEEGRHNVALHLEESGILDEISDLFKITPSAPTKANTGRL 978

Query: 1332 KEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEFLAKSEIV 1391
             E+   ++ L  D++QQFGINLHM+ +L+V + + KVL CDR +I   SV+EF A+ ++V
Sbjct: 979  NEE-GPLAILPRDLAQQFGINLHMFSNLSVEDFVLKVLHCDRQIITNQSVLEFFARDDLV 1037

Query: 1392 EVSVNLARNYAPYTTDWE-GVKSLKMQKFQRRIQMTYRELIKFIYNMVNLQSYWASRMRA 1450
             +  +L+  + PY++D+  G   LK      +++   R  +   YN   L+SYW  R   
Sbjct: 1038 NIPHSLSLKFEPYSSDFRLGKGPLKDSS---KLERADRIFLALCYN---LRSYWRQRSIC 1091

Query: 1451 LKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMNDTSKQAQGFKL 1510
            L  + +YE++Y +++ KL++VD A+  ++ S  LK+   +I+ +GNYMN   KQA G KL
Sbjct: 1092 LLTLLTYEKDYFDIMYKLQRVDDAITMIKSSHKLKDALMMIVEIGNYMN--RKQAPGIKL 1149

Query: 1511 STLQRLTFIKDATN-SMTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLSVEQLISDCN 1569
            S+LQ+L F+K + + +++FL+ VE+ +R    +   F+D+L  VLD+  L V Q+  D  
Sbjct: 1150 SSLQKLAFVKSSKDKNVSFLHVVERFLRVKCKATYGFVDELSKVLDLGNLVVGQVEQDFQ 1209

Query: 1570 EFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDEVKLTIMEFE 1629
            E+ + I  V++SL+ G LSDS  FHP D++L KV P +  AA+K++LL ++ KLT+   E
Sbjct: 1210 EYLKRIDAVKQSLDCGRLSDSESFHPEDRLLIKVGPKMAGAARKATLLQNQFKLTMRALE 1269

Query: 1630 ALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEEEERAYEKHKRMIEEQ 1686
             LM+ YGED                 I ++KKA  +N++ EE ER Y   K +++++
Sbjct: 1270 NLMRLYGEDHKSVDCRNDFFHHFIQFIIQFKKAAKENIENEEVERIYNHRKELLQQK 1326

>AGL364C Chr7 complement(16861..20643) [3783 bp, 1260 aa] {ON}
            Syntenic homolog of Saccharomyces cerevisiae YIL159W
            (BNR1)
          Length = 1260

 Score =  259 bits (661), Expect = 3e-69,   Method: Compositional matrix adjust.
 Identities = 151/423 (35%), Positives = 243/423 (57%), Gaps = 21/423 (4%)

Query: 1272 PRPQK-KLKQLHWDKLDSTDSSIWSKGMAERFADD--LYEKGVLRNLEKAFAA-----RE 1323
            P  Q+ KLKQ+HWDK+D+   ++W++   ER +    L   GV + +E  F       + 
Sbjct: 765  PTSQRVKLKQIHWDKIDNIKETVWNE-HNERISTSTKLETFGVFKEIEDLFKVVPATPKT 823

Query: 1324 IKSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIE 1383
              S    +     KI  LS+D++Q FGINLH++   +  ELI+ VL C   ++    VIE
Sbjct: 824  ASSNSPTQTTRNGKIRLLSNDLAQLFGINLHIFSHYSTEELIDMVLLCHAEILQNQRVIE 883

Query: 1384 FLAKSEIVEVSVNLARNYAPYTTDW-EGVKSLKMQKFQRRIQMTYRELIKFIYNMVNLQS 1442
            F +K +I  +  +  R +APY T++  G    K      R    Y EL        NL+S
Sbjct: 884  FFSKDDINHIPQSTQRMFAPYETNYLTGKTPDKDPAVLERADRIYLEL------FYNLRS 937

Query: 1443 YWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMNDTS 1502
            YWA+R + L V+ +YER+Y +++ KL+++D A  A++ S+ LK +F +I+ +GNYMN+  
Sbjct: 938  YWAARSKYLLVLLTYERDYYDILYKLQRIDDATKAIRSSKKLKQLFFIIIEIGNYMNN-- 995

Query: 1503 KQAQGFKLSTLQRLTFIKDAT-NSMTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLSV 1561
            KQA G +LS++ +L F K +  N+++F++ +E+I+R  YP  ++F +DLE V D+  + V
Sbjct: 996  KQALGIQLSSINKLAFTKTSKDNNLSFIHVIERIIRTRYPELHNFAEDLEKVQDMANIIV 1055

Query: 1562 EQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDEV 1621
            + +  +  EF + I N+ERSL +G LSDSS+FHP D+ L+K    +  A KK+ LL D+ 
Sbjct: 1056 QHVQQEAQEFRERISNLERSLTVGALSDSSRFHPKDQFLSKTASSIQHARKKAELLIDQS 1115

Query: 1622 KLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEEEERAYEKHKR 1681
             LT+ +FE L+  +GED                 +  +KKA  +N+++EE  R+  + KR
Sbjct: 1116 TLTMGDFEKLVSYWGEDTKDIQSRNTFFQKFLDFVALFKKASKENIEREEIRRS--QVKR 1173

Query: 1682 MIE 1684
            +IE
Sbjct: 1174 VIE 1176

>KNAG0L02250 Chr12 complement(399706..403809) [4104 bp, 1367 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1367

 Score =  258 bits (660), Expect = 6e-69,   Method: Compositional matrix adjust.
 Identities = 143/424 (33%), Positives = 237/424 (55%), Gaps = 9/424 (2%)

Query: 1271 LPRPQKKLKQLHWDKLDSTDSSIWSKGMAER-FADDLYEKGVLRNLEKAFAAREI----- 1324
            + +P KKLKQ+HWDK++  + +IW      R     L   GVL+ +E  F  +E      
Sbjct: 865  IAKPVKKLKQIHWDKVEDIEDTIWHNEEIRRDTLKHLQHDGVLKEIESTFKIKEAGPIAK 924

Query: 1325 KSIGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEF 1384
            KS  T        +SFLS D++Q FGINLHM+ +L+V E ++KVL CD ++I    V+EF
Sbjct: 925  KSCATEGSASKKSVSFLSRDLAQAFGINLHMFSNLSVDEFVKKVLGCDNDIIKNVPVLEF 984

Query: 1385 LAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQKFQRRIQMTYRELIKFIYNMVNLQSYW 1444
              + E+  +S +  R YAPY   +              +    R    F+     L+ YW
Sbjct: 985  FNREELGAISSSTLRKYAPYCVQYFPEPDASNHTTFEPLPPLERGDEIFLKLCYVLRDYW 1044

Query: 1445 ASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMNDTSKQ 1504
            + R   L V+ +YE++Y ++V KL+K++ A+  ++ S  L+N   +I+ +GNYMN  +K 
Sbjct: 1045 SVRSHCLLVVCTYEKDYYDIVYKLQKLEDAMRRLKESTALQNFLYIIIEIGNYMN--TKA 1102

Query: 1505 AQGFKLSTLQRLTFIKDATN-SMTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLSVEQ 1563
            A G K+S+L +L FIK + N +++FL+Y+E+++R  YP    F+ DL+ V D+ KL+++Q
Sbjct: 1103 ASGVKISSLNKLVFIKSSDNKNLSFLHYIERLIRTKYPDIYRFVHDLKTVEDLGKLTLDQ 1162

Query: 1564 LISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDEVKL 1623
            L  +C+E+   I  +  +++ G LSD +K +P D VL K+      A  K+ LL  ++KL
Sbjct: 1163 LELECSEYIGKIRKMGHAVKKGPLSDPAKLYPGDMVLKKIRFKAQRANSKAQLLESQMKL 1222

Query: 1624 TIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEEEERAYEKHKRMI 1683
            +  +   LMK YGED                 +  +KK   +N+++EE +R YE+ ++++
Sbjct: 1223 SSNDMNQLMKYYGEDPKDATTKNHFFTSFAEFLQLFKKCSRENIEREEMDRVYEQRRKLL 1282

Query: 1684 EEQQ 1687
            E++Q
Sbjct: 1283 EDKQ 1286

>KLLA0F10912g Chr6 (1003827..1007678) [3852 bp, 1283 aa] {ON} some
            similarities with uniprot|P40450 Saccharomyces cerevisiae
            YIL159W BNR1 Formin nucleates the formation of linear
            actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1283

 Score =  257 bits (656), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 148/476 (31%), Positives = 268/476 (56%), Gaps = 36/476 (7%)

Query: 1272 PRPQ-KKLKQLHWDKLDSTDSSIWSKGMAER-FADDLYEKGVLRNLEKAFAAREIKSIGT 1329
            P+P+ K LKQ+HWDK++    ++W++        +DL EKGV   +   F   E K++  
Sbjct: 796  PKPEVKPLKQIHWDKIEDISDTLWNEPTTRSDLKEDLNEKGVFNEIVNLF---EQKAVRM 852

Query: 1330 RKKEDLS------KISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIE 1383
            +KK +++      K+S LS D++QQFGINLHM+ S +V +L+ KVL+CD ++I   SV+E
Sbjct: 853  KKKSNVTASKKNEKVSLLSRDLAQQFGINLHMFSSYSVEDLLIKVLRCDDDIIKNHSVLE 912

Query: 1384 FLAKSEIVEVSVNLARNYAPYTTDWEGVKSLK--MQKFQRRIQMTYRELIKFIYNMVNLQ 1441
            F  K +   +  ++ R++ PY +DW+  K+ K  + K +R      R  ++  YNM   +
Sbjct: 913  FFNKDDFETIPQSIIRSFEPYASDWKTGKAPKEDVSKLER----ADRIYLEMFYNM---R 965

Query: 1442 SYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMNDT 1501
             YW  R  +L +  +YE++Y +++ +L+K+D     ++ S  LK  F +++ +GN+MN+ 
Sbjct: 966  YYWKIRSSSLLIALTYEKDYYDILYQLQKIDDGTSMIKNSNRLKQFFYIVVEIGNFMNN- 1024

Query: 1502 SKQAQGFKLSTLQRLTFIK-DATNSMTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLS 1560
             K+ QG KLS+L +L+ +K ++  +++FL+ +E+I+R+ YP   DF  DL  + D+ K++
Sbjct: 1025 -KKTQGIKLSSLNKLSMVKTNSDKNLSFLHVIERIIREKYPDIYDFTRDLNRLSDLGKIN 1083

Query: 1561 VEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDE 1620
            +E + S+ +E+ + I+ ++ S E G LS + K HP DK   K+   LP A +K+ LL ++
Sbjct: 1084 IESIESEIHEYYEKIMRMKESFERGKLSHTEKHHPDDKFRKKISAKLPSAVRKAELLHNQ 1143

Query: 1621 VKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEEEERAYEKHK 1680
             KLT+ +F + MK  GED                 +T + K   +N ++E   R +E+ +
Sbjct: 1144 CKLTMNDFNSTMKYCGEDPTNSEAKNTFFRNFSEFLTLFNKISQENKEREAMNRVHEQRQ 1203

Query: 1681 RMIEEQQHKQDLXXXXXXXXXXXXXXXQSDRRA-MMDKLLEKLKNAGPGKADPSSA 1735
            +++++   +  +                 D  A  +D L++KL++  P +  P S+
Sbjct: 1204 QLLQKASTETQVEKSA------------DDEAADTIDILIKKLRSVDPQQTIPGSS 1247

>Skud_9.8 Chr9 (18913..23037) [4125 bp, 1374 aa] {ON} YIL159W (REAL)
          Length = 1374

 Score =  257 bits (656), Expect = 2e-68,   Method: Compositional matrix adjust.
 Identities = 139/430 (32%), Positives = 231/430 (53%), Gaps = 29/430 (6%)

Query: 1272 PRPQKKLKQLHWDKLDSTDSSIWSKGMA-ERFADDLYEKGVLRNLEKAFAAREIKSIGTR 1330
            P P+++LKQ+HWD+++    ++W      +    +L   GV   +E  F  R    I ++
Sbjct: 871  PSPERRLKQIHWDRVEDVKDTLWEDAFQRQETIRELQTDGVFSQIEDIFKMRSPAKIASK 930

Query: 1331 KK---------------EDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNL 1375
                              +L K+SFLS D++QQFGINLHM+  L+  E + KVL CD ++
Sbjct: 931  NNAGSSTALSSNNGKSLNELKKVSFLSRDLAQQFGINLHMFSQLSDMEFVMKVLNCDNDI 990

Query: 1376 INTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQKFQRRIQMTYRELIKFIY 1435
            I   ++++F  K E+  +  +L   Y PY+   EG     +Q+  R     + EL     
Sbjct: 991  IQNVNILKFFCKEELTNIPKSLLNKYEPYSQGKEGKAVSDLQRADR----IFLELC---- 1042

Query: 1436 NMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVG 1495
              +NL+SYW  R + L  +++YER+Y +L+ KL+K+D  +  +  S   KN+  +I  +G
Sbjct: 1043 --INLRSYWNVRSKNLLTLSTYERDYYDLLFKLQKIDDGISHLNLSPKFKNLMFIITEIG 1100

Query: 1496 NYMNDTSKQAQGFKLSTLQRLTFIKDATN-SMTFLNYVEKIVRDNYPSFNDFIDDLEPVL 1554
            N+MN   K  +G KL +L +L F++ + + +M+FL+++EKI+R  YP    F+DDL+ + 
Sbjct: 1101 NHMN--KKIVKGIKLKSLTKLAFVRSSVDQNMSFLHFIEKIIRIKYPDLYGFVDDLKKIE 1158

Query: 1555 DVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKS 1614
            D+ K+S+E +  +C+EF   I N+    + G LS      P D+++ KV   +  A  KS
Sbjct: 1159 DLGKISLEHIELECHEFYNRIENLVTQFQTGKLSKEENLDPRDQIVKKVKFKINRAKIKS 1218

Query: 1615 SLLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEEEER 1674
             LL  + KLT+++   LMK YGED                 +  +KK   +N+++EE ER
Sbjct: 1219 ELLMGQCKLTLIDLNKLMKYYGEDPSDKESKNDFFQPFIEFLAMFKKCAKENIEKEEMER 1278

Query: 1675 AYEKHKRMIE 1684
             YE+ K ++E
Sbjct: 1279 VYEQRKSLLE 1288

 Score = 33.9 bits (76), Expect = 5.1,   Method: Compositional matrix adjust.
 Identities = 28/95 (29%), Positives = 50/95 (52%), Gaps = 15/95 (15%)

Query: 654 KLMGEKEDPTKLSKQLKLIDSLLTNVNGSM-------FDE--------ESHMNLAIQRLY 698
           K++  K+  ++  K LKLI+SLL  +  S        FDE        +S    ++ +L 
Sbjct: 458 KILDSKKPYSESIKLLKLINSLLFYLIDSFQAPICSSFDENLDLAQNVDSVFQDSVNKLL 517

Query: 699 DSMQTDEVARRAILESRTLTKKLEEAHAERDYLSN 733
           DS+Q++E+ARRA+ E   L  K+ + + + + + N
Sbjct: 518 DSLQSNEIARRAVTEIDDLNNKILDLNEKLNLVEN 552

>YIL159W Chr9 (41825..45952) [4128 bp, 1375 aa] {ON}  BNR1Formin,
            nucleates the formation of linear actin filaments,
            involved in cell processes such as budding and mitotic
            spindle orientation which require the formation of
            polarized actin cables, functionally redundant with BNI1
          Length = 1375

 Score =  254 bits (649), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 136/437 (31%), Positives = 241/437 (55%), Gaps = 30/437 (6%)

Query: 1266 TNSDRLPRP-QKKLKQLHWDKLDSTDSSIWSKGMA-ERFADDLYEKGVLRNLEKAFAARE 1323
            T +D  P P +K+LKQ+HWDK++    ++W      +    +L   G+   +E  F  + 
Sbjct: 865  TTTDLKPPPTEKRLKQIHWDKVEDIKDTLWEDTFQRQETIKELQTDGIFSQIEDIFKMKS 924

Query: 1324 IKSIGTRK---------------KEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKV 1368
               I  ++                 +L KISFLS D++QQFGINLHM+  L+  E + KV
Sbjct: 925  PTKIANKRNAESSIALSSNNGKSSNELKKISFLSRDLAQQFGINLHMFSQLSDMEFVMKV 984

Query: 1369 LKCDRNLINTPSVIEFLAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQKFQRRIQMTYR 1428
            L CD +++   ++++F  K E+V +  ++   Y PY+   +G     +Q+  R     + 
Sbjct: 985  LNCDNDIVQNVNILKFFCKEELVNIPKSMLNKYEPYSQGKDGKAVSDLQRADR----IFL 1040

Query: 1429 ELIKFIYNMVNLQSYWASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVF 1488
            EL       +NL+ YW +R ++L  +++YER+Y +L+ KL+K+D A+  + RS   K++ 
Sbjct: 1041 ELC------INLRFYWNARSKSLLTLSTYERDYYDLIFKLQKIDDAISHLNRSPKFKSLM 1094

Query: 1489 NVILAVGNYMNDTSKQAQGFKLSTLQRLTFIKDATN-SMTFLNYVEKIVRDNYPSFNDFI 1547
             +I  +GN+MN   +  +G KL +L +L F++ + + +++FL+++EK++R  YP    F+
Sbjct: 1095 FIITEIGNHMN--KRIVKGIKLKSLTKLAFVRSSIDQNVSFLHFIEKVIRIKYPDIYGFV 1152

Query: 1548 DDLEPVLDVVKLSVEQLISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVL 1607
            DDL+ + D+ K+S+E + S+C+EF + I ++    ++G LS      P D+++ KV   +
Sbjct: 1153 DDLKNIEDLGKISLEHVESECHEFHKKIEDLVTQFQVGKLSKEENLDPRDQIIKKVKFKI 1212

Query: 1608 PEAAKKSSLLTDEVKLTIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNL 1667
              A  KS LL  + KLT+++   LMK YGED                 +  +KK   +N+
Sbjct: 1213 NRAKTKSELLIGQCKLTLIDLNKLMKYYGEDPKDKESKNEFFQPFIEFLAMFKKCAKENI 1272

Query: 1668 KQEEEERAYEKHKRMIE 1684
            ++EE ER YE+ K +++
Sbjct: 1273 EKEEMERVYEQRKSLLD 1289

 Score = 38.1 bits (87), Expect = 0.28,   Method: Compositional matrix adjust.
 Identities = 29/78 (37%), Positives = 46/78 (58%), Gaps = 16/78 (20%)

Query: 671 LIDSLLTNVNGSMFDE--ESHMNL------AIQRLYDSMQTDEVARRAILESRTLTKKLE 722
           LIDS   + N S FDE  ES  N+      ++ +L DS+Q+DE+ARRA+ E       ++
Sbjct: 482 LIDSFQVSTNPS-FDETLESAENVDYVFQDSVNKLLDSLQSDEIARRAVTE-------ID 533

Query: 723 EAHAERDYLSNKLSNAEN 740
           + +A+  +L+ KL+  EN
Sbjct: 534 DLNAKISHLNEKLNLVEN 551

>NDAI0F00160 Chr6 (21351..25400) [4050 bp, 1349 aa] {ON} Anc_5.717
          Length = 1349

 Score =  253 bits (645), Expect = 3e-67,   Method: Compositional matrix adjust.
 Identities = 140/421 (33%), Positives = 238/421 (56%), Gaps = 23/421 (5%)

Query: 1275 QKKLKQLHWDKLDSTDSSIW--SKGMAERFADDLYEKGVLRNLEKAFAAREI-----KSI 1327
            +KKLKQ+HWDK+++  +++W  + G  +   + L   G+   ++  F+ +++     +++
Sbjct: 856  KKKLKQIHWDKIENVKNTLWDHADGRQDTILE-LEHAGIFEKVQGMFSVQDLVVKPKRAV 914

Query: 1328 GTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEFLAK 1387
              R+   L  +SFLS D SQQ  INLH++  L   E+++KVL CD + I   SV+EF  K
Sbjct: 915  NVRESNKL--LSFLSRDFSQQLAINLHIFAQLTEKEVLQKVLACDNDTIQNVSVLEFFCK 972

Query: 1388 SEIVEVSVNLARNYAPYTTDWEGVKSLKMQ---KFQRRIQMTYRELIKFIYNMVNLQSYW 1444
             E+V +     R++ PY+ D+        +   + +R  ++       F+Y   NL+ YW
Sbjct: 973  DEMVNIGSARIRHFTPYSADYLNASEQPAKNPDELERADKL-------FLYLPFNLRRYW 1025

Query: 1445 ASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMNDTSKQ 1504
            A R + L VI++YEREY +++  L+K+D A+  ++ SE  K    +I+ +GNYMN  +K 
Sbjct: 1026 AERSQCLLVISTYEREYYDMLYNLQKIDDALQNIRHSEKFKTFLYIIIELGNYMN--TKA 1083

Query: 1505 AQGFKLSTLQRLTFIKDATN-SMTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLSVEQ 1563
             +G +L++L +L FIK   N + +FL++VEK++R +YP    FI+DL  V D+ K++++Q
Sbjct: 1084 VEGIRLNSLTKLAFIKSNDNKNFSFLHFVEKMLRIHYPDVYGFINDLNKVEDLGKITIDQ 1143

Query: 1564 LISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDEVKL 1623
            +   C E+   I  +  S+  G LSD ++ HP D++L KV   +  A  KS LL  + KL
Sbjct: 1144 VQLQCEEYCTKIERIAHSVTKGKLSDPTQLHPDDQILRKVKYKVTRAKTKSELLQAQFKL 1203

Query: 1624 TIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEEEERAYEKHKRMI 1683
            T  +F   M  YGED                  + ++K   +N+++EE +RAYE+ K++ 
Sbjct: 1204 TNNDFRKSMLYYGEDPDDTDNKINFFNQFVEFSSLFRKCARENIEKEEADRAYEQRKKIA 1263

Query: 1684 E 1684
            E
Sbjct: 1264 E 1264

>ZYRO0B16654g Chr2 complement(1351398..1355672) [4275 bp, 1424 aa]
            {ON} some similarities with uniprot|P40450 Saccharomyces
            cerevisiae YIL159W BNR1 Formin nucleates the formation of
            linear actin filaments involved in cell processes such as
            budding and mitotic spindle orientation which require the
            formation of polarized actin cables functionally
            redundant with BNI1
          Length = 1424

 Score =  250 bits (638), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 136/419 (32%), Positives = 233/419 (55%), Gaps = 15/419 (3%)

Query: 1273 RPQKKLKQLHWDKLDSTDSSIWSKG-MAERFADDLYEKGVLRNLEKAF-----AAREIKS 1326
            +P++ LKQ+HW+K+D  + ++W      E    +L   G+   ++  F       +++K+
Sbjct: 848  KPKQSLKQIHWEKIDDVEKTVWEDNEQREETVKELEISGIFEKVQTTFQLKNSTVKKVKN 907

Query: 1327 IGTRKKEDLSKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEFLA 1386
              + KK    K SFLS D++QQFGINLHMY    V E + KVL+CD +++   SV+EF  
Sbjct: 908  DNSTKKTTQLK-SFLSRDLAQQFGINLHMYSQYPVEEFVLKVLRCDNDILQNVSVLEFFN 966

Query: 1387 KSEIVEVSVNLARNYAPYTTDWEGVKSLKMQKFQRRIQMTYRELIKFIYNMVNLQSYWAS 1446
              E+  +  +L+R++APY+ D++  KS  +      ++   R  ++  YN   L+SYW  
Sbjct: 967  NEELTNIPASLSRSFAPYSADFQENKSPTVDP--NELERPDRIFLELCYN---LRSYWRE 1021

Query: 1447 RMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMNDTSKQAQ 1506
            R + L +  +YER+Y +LV KL+ +D A+  ++ +  LK +  +I+ +GNYMN   K   
Sbjct: 1022 RSKCLLIFATYERDYYDLVYKLQNIDDAIQKIKNAFRLKQLLYIIMEIGNYMN--KKNVS 1079

Query: 1507 GFKLSTLQRLTFIKDAT-NSMTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLSVEQLI 1565
            G +L++L +L+F+K +  N+++FL+++EK+VR  YP    F DDL     +  +S + + 
Sbjct: 1080 GIRLNSLSKLSFVKSSVDNNLSFLHFIEKVVRVKYPDIYHFTDDLNKAEALGYISFDHIQ 1139

Query: 1566 SDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDEVKLTI 1625
            S+C E+   + +V R    G LS  S  HP D+++ KV   +  A  KS LL D+ KL  
Sbjct: 1140 SECEEYCSKVNSVVRMTTEGILSQQSNLHPKDEIMRKVKYKINRAKTKSQLLWDQYKLIS 1199

Query: 1626 MEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEEEERAYEKHKRMIE 1684
             + + LMK +GE+                    +KK   +N+++EE  R YE+ K++++
Sbjct: 1200 ADLDKLMKYFGENPMDKEAKNSFFANFGEFSVVFKKCAKENIEKEEAYRVYEQRKKLLD 1258

>Suva_9.26 Chr9 (34756..38883) [4128 bp, 1375 aa] {ON} YIL159W (REAL)
          Length = 1375

 Score =  248 bits (633), Expect = 1e-65,   Method: Compositional matrix adjust.
 Identities = 133/421 (31%), Positives = 230/421 (54%), Gaps = 25/421 (5%)

Query: 1277 KLKQLHWDKLDSTDSSIWSKGMA-ERFADDLYEKGVLRNLEKAFAAREIKSIGTRKKEDL 1335
            +LKQ+HWDK++    ++W      +    +L   G+   +E  F  ++   I ++K  + 
Sbjct: 881  RLKQIHWDKVEEIKDTLWEDTTQRQETLKELQTDGIFSQIEDIFKMKDPVKIASKKNGNS 940

Query: 1336 -----------SKISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEF 1384
                       S +SFLS D++QQFGINLHM+  ++  E ++KVL CD N+I   ++++F
Sbjct: 941  STSISSNNGKSSNVSFLSRDLAQQFGINLHMFSQVSDMEFVKKVLNCDNNIIMNVNILKF 1000

Query: 1385 LAKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQKFQRRIQMTYRELIKFIYNMVNLQSYW 1444
              K E+V +  ++   Y PY+    G     +Q+  R     + EL       +NL+SYW
Sbjct: 1001 FCKEELVSIPKSMLSKYEPYSQGKGGKSVSDLQRADR----IFLELC------INLRSYW 1050

Query: 1445 ASRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMNDTSKQ 1504
             +R ++L  +++YER+Y +L+ KL+K+D  +  + RS   K++  +I  +GN+MN   K 
Sbjct: 1051 NARSKSLLTLSTYERDYYDLIFKLQKIDDGILQLNRSVKFKSLMFIITEIGNHMN--KKM 1108

Query: 1505 AQGFKLSTLQRLTFIKD-ATNSMTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLSVEQ 1563
             +G KL +L +L F++  A  +++FL+++EK++R  YP    F+DDL+ + D+ K+S+E 
Sbjct: 1109 VKGIKLKSLTKLAFVRSSADQNLSFLHFIEKVIRTKYPDIYGFVDDLKRIEDLGKVSLEH 1168

Query: 1564 LISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDEVKL 1623
            +  +C EF   +       + G LS+     P D+++ KV   +  A  KS LL D+ KL
Sbjct: 1169 VELECREFQNKVEYAVTQFQTGKLSNEENLDPRDQIVKKVKFKINRAKTKSDLLVDQCKL 1228

Query: 1624 TIMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEEEERAYEKHKRMI 1683
            T+++   LMK YGED                 +  +KK   +N+++EE ER YE+ K ++
Sbjct: 1229 TLIDLSKLMKYYGEDPNDKESKNEFFQPFIEFLAMFKKCAKENIEKEEMERVYEQRKNLL 1288

Query: 1684 E 1684
            E
Sbjct: 1289 E 1289

 Score = 35.0 bits (79), Expect = 2.2,   Method: Compositional matrix adjust.
 Identities = 29/98 (29%), Positives = 51/98 (52%), Gaps = 19/98 (19%)

Query: 671 LIDSLLTNVNGSMFDE-----------ESHMNLAIQRLYDSMQTDEVARRAILESRTLTK 719
           LIDS    +N S FDE           +S    +I +L DS+Q+D++ARRA++E      
Sbjct: 484 LIDSFQVPLNAS-FDEALDQPQNTQNVDSVFQDSIDKLLDSLQSDDIARRAVIE------ 536

Query: 720 KLEEAHAERDYLSNKLSNAENGLVGQLESDLKQRDNIL 757
            +++ + +   L+ ++S  EN    QL + L + + +L
Sbjct: 537 -IDDLNCKISTLNERISLVENYSKDQLLTKLDESEILL 573

>TPHA0E00120 Chr5 (4818..9746) [4929 bp, 1642 aa] {ON} Anc_5.717
            YIL159W
          Length = 1642

 Score =  247 bits (630), Expect = 5e-65,   Method: Compositional matrix adjust.
 Identities = 139/427 (32%), Positives = 237/427 (55%), Gaps = 13/427 (3%)

Query: 1271 LPRPQKKLKQLHWDKLDSTDSSIWSKGMAER-FADDLYEKGVLRNLEKAFAAREI---KS 1326
            + +  KKLKQ+HW +++    +IW     +R    +L   GV   ++ +F  +++   K+
Sbjct: 1136 IQKEDKKLKQIHWIRVNEVAETIWKDNDRDRGIFMELECVGVFDRVKSSFKLKDVIKKKN 1195

Query: 1327 IGTRKKEDLSKI-SFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEFL 1385
                K +D  ++ SFLS D++QQFGINLH++ S  V EL+EKVL+CD ++    +++EF 
Sbjct: 1196 TDEAKTKDKQQLKSFLSRDLAQQFGINLHLFASCEVSELLEKVLRCDNDINKNITILEFF 1255

Query: 1386 AKSEIVEVSVNLARNYAPYTTDWEGVKSLKMQKFQRRIQMTYRELIKFIYNMVNLQSYWA 1445
             K E   +S ++ARNYAPY  D++   + +  K    ++   R  ++  Y   NL++YWA
Sbjct: 1256 NKEEFTHISGSVARNYAPYGVDYQT--NNEATKDASELERADRIFLELFY---NLRAYWA 1310

Query: 1446 SRMRALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMNDTSKQA 1505
             R + L ++ +YE++Y +L+ KL+++D AV  +  S   K    ++L +GN+MN   K A
Sbjct: 1311 ERSQCLLLLHTYEKDYFDLMFKLQRIDDAVQKLMNSTRFKKFLYIVLEIGNFMN--KKPA 1368

Query: 1506 QGFKLSTLQRLTFIKDA-TNSMTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLSVEQL 1564
            +G  +S+L +L FIK +  N+++FL+++EK +R  +P    FIDDL  V ++  +S++ +
Sbjct: 1369 EGILISSLTKLVFIKSSENNNLSFLHFIEKTIRTQFPEVYGFIDDLSKVAELGNVSLDHI 1428

Query: 1565 ISDCNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDEVKLT 1624
              +C EF   +     ++  G LS     HP D++L KV   + +A  KS+ L D+  LT
Sbjct: 1429 TMECKEFCTHVNTTVYAVTKGKLSHPEDLHPRDQILKKVKYKISKAKTKSNFLRDQQILT 1488

Query: 1625 IMEFEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEEEERAYEKHKRMIE 1684
                  ++K YGED                  T +KK   +N+  EE ER YE+ K M++
Sbjct: 1489 NHSIVKVLKYYGEDPNDRDSKDDFFKNIAEFATLFKKCAKENIYNEEAERLYEQRKYMLD 1548

Query: 1685 EQQHKQD 1691
             +  K +
Sbjct: 1549 NKLQKNN 1555

>TBLA0E01810 Chr5 complement(441141..445496) [4356 bp, 1451 aa] {ON}
            Anc_5.717 YIL159W
          Length = 1451

 Score =  243 bits (620), Expect = 5e-64,   Method: Compositional matrix adjust.
 Identities = 146/491 (29%), Positives = 269/491 (54%), Gaps = 27/491 (5%)

Query: 1274 PQKKLKQLHWDKLDSTDSSIWSKGMAERFA--DDLYEKGVLRNLEKAFAAREIKSIGTRK 1331
            P K +KQ+HW+K+  T +S+W     +R +   +L   G+   +E  F +++   I  R 
Sbjct: 966  PTKNMKQIHWEKVSRTGASLWEDD-DQRLSIIKELEHTGIFSEVEDIFYSKD-AVIKRRN 1023

Query: 1332 KEDLSK---ISFLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEFLAKS 1388
             +D ++   ++ L  +++QQFGINLHM+  ++  +L EKVL+CD ++    SVIEF    
Sbjct: 1024 PKDQTQNKVLTLLPRELAQQFGINLHMFSQISPQDLFEKVLQCDISINQNLSVIEFFNNE 1083

Query: 1389 EIVEVSVNLARNYAPYTTDWEGVKSLKMQKFQRRIQMTYRELIKFIYNMVNLQSYWASRM 1448
            ++  +  N+ R + PY+ D++   S    K  + I    R    F+    NL+SYW  R 
Sbjct: 1084 DLTNIPSNICRTFEPYSIDYKTPGS----KPTKDISELSRVDHIFLLLCYNLRSYWKERS 1139

Query: 1449 RALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMNDTSKQAQGF 1508
            + L ++ +YE++Y +L+ KL ++D+A+ A++ S+ LK+V  +I+A+GN+MN   K   G 
Sbjct: 1140 QCLLMLLTYEKDYYDLMFKLERLDEAINAIKNSQRLKSVLYIIVAIGNFMN--KKGVDGI 1197

Query: 1509 KLSTLQRLTFIKDATNS-MTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLSVEQLISD 1567
            +LS+L +LT+IK  + S  +FL+++E+++R  YP    F  DL  V ++  ++++ L  +
Sbjct: 1198 RLSSLNKLTYIKSNSESKASFLHFIERLIRVRYPELYYFTSDLRKVENLGNVTLDHLQLE 1257

Query: 1568 CNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDEVKLTIME 1627
             ++ S  I  V RS++ G LS+    HP D +L KV   +  AA K ++L D+  LT ++
Sbjct: 1258 YDDLSSKINTVHRSIQKGQLSNKKNLHPQDNILDKVKYKVIRAANKRTILQDKFTLTNID 1317

Query: 1628 FEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEEEERAYEKHKRMIEEQQ 1687
             E L+  +GED                 +T ++K   +N+++EE +R YE+ +++++ + 
Sbjct: 1318 LEKLLVYFGEDPDDMNNKITFFKSISEFLTLFRKCAKENIEKEEADRVYEQRRQLLDSKI 1377

Query: 1688 HKQDLXXXXXXXXXXXXXXXQSDRRAMMDKLLEKLKNAGPGKADPSSARKRALVRKKLLT 1747
              Q                 + D++  +D+LL+KL+    G   P++A +R    K+L  
Sbjct: 1378 QAQ---------WDSSMDEIEEDQQDAVDQLLKKLR----GVEQPTTAVRRRKSSKRLDQ 1424

Query: 1748 DKEVTAHILQD 1758
              ++ + + QD
Sbjct: 1425 MDQIPSRLSQD 1435

>KAFR0D02120 Chr4 (425677..429651) [3975 bp, 1324 aa] {ON} Anc_5.717
            YIL159W
          Length = 1324

 Score =  236 bits (601), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 135/417 (32%), Positives = 225/417 (53%), Gaps = 28/417 (6%)

Query: 1277 KLKQLHWDKLDSTDSSIW-SKGMAERFADDLYEKGVLRNLEKAFAAREIKSIGTRKKEDL 1335
            +LKQ+HW+K++  +S++W      E  A +L   G+   +   F  + IK     KK D 
Sbjct: 852  RLKQIHWEKVEDIESTLWHDSARREETAKELKLDGIFDQVMDTFQVKNIK----MKKRDT 907

Query: 1336 SKIS------FLSHDISQQFGINLHMYGSLAVPELIEKVLKCDRNLINTPSVIEFLAKSE 1389
            +  S       L  +++QQFGINLHM+ SL   E +EKVL+C+ ++++  SV+EF  K E
Sbjct: 908  TTASKKQNGTLLPRNLAQQFGINLHMFSSLGTDEFVEKVLECNSDIVSNVSVLEFFNKEE 967

Query: 1390 IVEVSVNLARNYAPYTTDWEGVKSLKMQKFQ-RRIQMTYRELIKFIYNMVNLQSYWASRM 1448
            +  +  +L + + PY    E +KS    KF+  R    + EL         L SYW  R 
Sbjct: 968  LTSIPTSLIQKFTPYA---ENIKS----KFELERADRIFFELC------FQLHSYWRERS 1014

Query: 1449 RALKVITSYEREYNELVTKLRKVDKAVGAVQRSENLKNVFNVILAVGNYMNDTSKQAQGF 1508
              L ++ +YE++Y +L+ KL+KVD  +  +  S   ++   +I+ +GNYMN   K   G 
Sbjct: 1015 NCLLILNTYEKDYYDLMYKLKKVDDGIQRLLSSSKFRDFLYIIIEIGNYMN--KKTVNGI 1072

Query: 1509 KLSTLQRLTFIKDAT-NSMTFLNYVEKIVRDNYPSFNDFIDDLEPVLDVVKLSVEQLISD 1567
            ++ +L +L F+K +  N+++FL+++EKI+R  YP    FI++L  + D+ KLS++QL  D
Sbjct: 1073 RIGSLNKLVFVKSSLDNNVSFLHFIEKIIRVKYPDIYSFINELRIIQDLGKLSIDQLEYD 1132

Query: 1568 CNEFSQSIVNVERSLEIGNLSDSSKFHPSDKVLTKVLPVLPEAAKKSSLLTDEVKLTIME 1627
              EF   I  +   LE G LS + +  P D++L K    +  A  KS L+  ++KL   +
Sbjct: 1133 SQEFCSKINKMSNDLEKGKLSKADRIDPRDQLLKKTKYKVLRAKSKSELMRHQLKLLGHD 1192

Query: 1628 FEALMKKYGEDAGXXXXXXXXXXXXXXXITEYKKAQSQNLKQEEEERAYEKHKRMIE 1684
            +  +M+ +GEDA                I  +KK   +N+++EE ER YE+ ++M +
Sbjct: 1193 YAKIMRYFGEDASDRDSKNAFFTNIFEFIQVFKKCSKENIEKEEMERVYEQRQKMFD 1249

 Score = 34.3 bits (77), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 55/224 (24%), Positives = 102/224 (45%), Gaps = 23/224 (10%)

Query: 537 ILEYCLWTMVFINHLCSNSSLLNQRILLRTKLENLGALRIMTKLKRLDYEKLTEQIELYD 596
           I EY    M  IN +     L N++  +  KL+++   ++  +L  LD + + EQI  Y 
Sbjct: 323 ITEYLSSCMFLINSIIEGFPLQNEKYSVLEKLKDVELPKLFFELSALDSKVIQEQIYRYK 382

Query: 597 NNKLDDFNTVLETESKNSKVNMQNPNSLIENLWESCKGSDNEKXXXXXXXXXXXXXXKLM 656
            N   D N  L       K+  +NP S+ +  + +      EK                +
Sbjct: 383 KN---DENIRL-------KIINENPLSIPDISYGATLMLLIEKSKSTPLEEPIGALLDSV 432

Query: 657 GEKEDPTKLSKQLKL---IDSLLT----NVNGSMFDEESHMNL------AIQRLYDSMQT 703
            +  D    S+ +KL   + SLLT     ++ ++   E+  +L      +I+RL D++++
Sbjct: 433 LKILDTRTYSESIKLFASVSSLLTYLVDKLDSTISSAENANSLKPVLQDSIERLIDNLES 492

Query: 704 DEVARRAILESRTLTKKLEEAHAERDYLSNKLSNAENGLVGQLE 747
           DEVARRA+ E R     +++ + E   L  + ++++  ++ QLE
Sbjct: 493 DEVARRAMKELRESETVIKDLNTEIHNLKREKNSSKEDILEQLE 536

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.311    0.127    0.347 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 168,622,292
Number of extensions: 6891358
Number of successful extensions: 30612
Number of sequences better than 10.0: 135
Number of HSP's gapped: 31407
Number of HSP's successfully gapped: 228
Length of query: 1930
Length of database: 53,481,399
Length adjustment: 125
Effective length of query: 1805
Effective length of database: 39,148,149
Effective search space: 70662408945
Effective search space used: 70662408945
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 73 (32.7 bits)