Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_2000.651.83ON59559523630.0
TPHA0B044801.83ON60360318920.0
Skud_5.261.83ON59052317280.0
TDEL0C061801.83ON58351817200.0
Smik_5.241.83ON59051617190.0
Suva_5.41.83ON59052317190.0
NDAI0A006101.83ON56552317160.0
YEL063C (CAN1)1.83ON59051617180.0
CAGL0J08184g1.83ON57252216670.0
TBLA0A054501.83ON60652116590.0
KNAG0C007901.83ON57951616400.0
NCAS0B085701.83ON53251215980.0
KAFR0D007001.83ON57452815800.0
SAKL0C02684gsingletonON58851815730.0
SAKL0C02662g1.83ON54851415620.0
NDAI0F042001.83ON56650815570.0
KNAG0C05920singletonON59951215580.0
KLLA0C02343g1.83ON58152515460.0
YNL270C (ALP1)1.83ON57355915400.0
Smik_14.671.83ON57351215330.0
SAKL0C02640gsingletonON54851415230.0
Skud_14.701.83ON57350915230.0
NCAS0A006001.83ON54452015130.0
Suva_14.731.83ON49747915020.0
KLTH0F02398g1.83ON55552215010.0
Kpol_2000.641.84ON61052315030.0
Kwal_33.134011.83ON55950714920.0
YNL268W (LYP1)1.84ON61152314910.0
TDEL0C061701.84ON57352114860.0
Skud_14.711.84ON61251114860.0
NCAS0A006101.84ON60751114790.0
NDAI0F041901.84ON59951114760.0
CAGL0J08162g1.84ON59751214750.0
SAKL0C02728g1.84ON56251514720.0
ZYRO0F16654g1.83ON58052214660.0
Smik_14.681.84ON61150814650.0
Suva_14.751.84ON61151114600.0
TPHA0B044701.84ON59951614430.0
Ecym_10881.84ON56752114280.0
KAFR0D039401.83ON59753014310.0
KLTH0F02420g1.84ON62153214120.0
Kwal_33.134111.84ON56051614040.0
Ecym_10871.83ON57051013870.0
KNAG0F004801.84ON59750813840.0
KLLA0C02365g1.84ON57952313780.0
TBLA0A054601.84ON60858613790.0
AFR667C1.84ON56352913091e-175
AFR668W1.83ON55650913061e-174
ZYRO0F16632g1.84ON60751512651e-167
CAGL0A01199gna 1ON6134727274e-87
Kpol_358.3na 1ON5754717071e-84
TPHA0M00130singletonON6114886881e-81
KAFR0B06430singletonON5934736836e-81
Kwal_26.69407.44ON5705226791e-80
KLTH0D01474g7.44ON6244846742e-79
TBLA0A07060na 1ON6254566701e-78
Smik_6.473na 1ON6064966672e-78
Kwal_33.15545na 1ON5764896624e-78
SAKL0G14916gna 1ON5814576624e-78
TPHA0H028507.44ON6015276636e-78
SAKL0F09790gsingletonON5585276553e-77
YPL265W (DIP5)na 1ON6084966583e-77
Skud_16.12na 1ON6074966575e-77
KLLA0E16281gna 1ON6054776532e-76
KNAG0E003907.44ON5994766522e-76
Suva_16.40na 1ON6064716522e-76
NCAS0D02260na 1ON5974756487e-76
Ecym_2480na 1ON5864666382e-74
CAGL0E05632g7.44ON5985216382e-74
KNAG0L02470singletonON6384636403e-74
NDAI0I02660na 1ON5944726363e-74
KNAG0L02460singletonON5884726321e-73
Kpol_367.77.44ON5844986293e-73
TDEL0H040707.44ON5774696275e-73
YOR348C (PUT4)7.44ON6274986299e-73
KLTH0B01166gna 1ON5774846251e-72
SAKL0B10956g7.44ON5724646241e-72
KAFR0C051607.44ON5844676206e-72
AFR156W7.44ON5585156117e-71
Ecym_80357.44ON5634676118e-71
Ecym_47895.158ON5884266138e-71
NDAI0E038007.44ON6214826132e-70
Ecym_60211.244ON6004616103e-70
Suva_8.4027.44ON6835396143e-70
Smik_15.5327.44ON6315396105e-70
SAKL0C01232gsingletonON6134596087e-70
ZYRO0D17908gna 1ON5184856001e-69
SAKL0D00836gna 2ON6014736042e-69
Kwal_33.154075.158ON5874485998e-69
Ecym_26643.285ON5754895934e-68
TDEL0A08030singletonON5144865861e-67
KLTH0B02046g5.158ON5894255875e-67
TDEL0C00930singletonON5954585875e-67
TDEL0C065101.50ON6424565889e-67
Skud_15.5157.44ON6264985871e-66
KAFR0D00510na 3ON6174695851e-66
Smik_4.7901.50ON6634535863e-66
SAKL0G14014g5.158ON6054345823e-66
Kwal_26.9612singletonON5434795783e-66
NDAI0D021605.158ON5874375804e-66
Suva_2.6881.50ON6614625845e-66
Skud_4.7841.50ON6634555836e-66
CAGL0K05753g1.50ON6604535836e-66
KLLA0F23419g7.44ON5734655777e-66
Kwal_23.4026singletonON5344515722e-65
YDR508C (GNP1)1.50ON6634535802e-65
KAFR0D005001.50ON6174265772e-65
ZYRO0D03762g1.244ON6004555753e-65
NCAS0A071105.158ON5924265744e-65
Suva_4.3073.284ON6094485744e-65
KNAG0C02140singletonON5984735736e-65
TBLA0C01240singletonON6294795746e-65
YBR068C (BAP2)3.284ON6094525737e-65
SAKL0C01650g1.50ON6134595738e-65
ACL135Wna 1ON5884785701e-64
KLLA0A11770g5.158ON5815065691e-64
Skud_11.2751.244ON6024465701e-64
NDAI0B052201.244ON6114135711e-64
NCAS0E022607.44ON5934795692e-64
KLTH0E15642g1.244ON5964725674e-64
NDAI0A006401.50ON6414565694e-64
AGR319W5.158ON6264265676e-64
Kwal_27.126811.244ON5934615648e-64
TPHA0E036601.50ON6474485661e-63
ZYRO0F17446g1.50ON6334535651e-63
Smik_6.482na 4ON5584565602e-63
CAGL0B01012g1.50ON6234615615e-63
AFR698C1.50ON6094185605e-63
TBLA0A05190na 5ON6674715635e-63
SAKL0C13992gsingletonON5524505566e-63
TPHA0B010901.244ON6064555588e-63
Skud_6.2na 6ON5584655541e-62
Skud_7.5255.158ON6034255571e-62
NDAI0G060301.368ON5994545561e-62
Smik_11.3021.244ON5534465522e-62
TDEL0E05750singletonON5484815522e-62
Kpol_1010.325.158ON5994995552e-62
NCAS0D018705.158ON5954245542e-62
KAFR0A011203.284ON5924565543e-62
Skud_16.2na 4ON4964645473e-62
SAKL0D02948gna 7ON5944865533e-62
CAGL0B03773g5.158ON6054365534e-62
Ecym_10561.50ON6064535535e-62
KAFR0D04120na 5ON6484945555e-62
KAFR0D00520na 5ON5984265516e-62
Smik_16.1155.158ON6034205518e-62
Kpol_543.78singletonON6054555518e-62
YKR039W (GAP1)1.244ON6024785509e-62
YGR191W (HIP1)5.158ON6034265491e-61
Smik_13.1singletonON5234535442e-61
TBLA0B077605.158ON6584825512e-61
Smik_3.531.50ON6334455502e-61
Suva_7.4855.158ON6034375482e-61
KAFR0D041401.50ON6374795493e-61
AFR230C1.244ON6044145473e-61
YFL055W (AGP3)na 6ON5584665443e-61
KNAG0G009005.158ON6134115473e-61
SAKL0F16544gsingletonON5675355444e-61
Kpol_543.791.244ON6054105464e-61
Suva_2.2033.284ON6044645455e-61
KLTH0F01584g1.50ON5964895447e-61
KAFR0E018505.158ON5604265419e-61
TBLA0A051801.50ON6764595471e-60
CAGL0L03267g1.244ON5974145421e-60
Skud_3.381.50ON6334495413e-60
Suva_13.517singletonON5474535364e-60
Kwal_33.14276na 2ON5964415384e-60
Skud_2.1913.284ON6094515394e-60
AGR040C3.285ON5734425366e-60
KLLA0F27093gsingletonON5634535357e-60
NDAI0C029505.158ON6094165377e-60
TPHA0A047005.158ON5694385341e-59
KLTH0F04048gsingletonON5835215351e-59
YCL025C (AGP1)1.50ON6334455371e-59
Suva_3.1891.50ON6334455371e-59
Kpol_2002.441.50ON6274535361e-59
KLTH0A00308gsingletonON5414575312e-59
NCAS0A106803.284ON5934425342e-59
SAKL0D02970g3.284ON6014535342e-59
Suva_2.716singletonON6034555342e-59
NDAI0A056203.284ON5714545322e-59
AGR039Cna 7ON5864575322e-59
KLTH0C05170g3.284ON5984525332e-59
NCAS0B085801.50ON6274685334e-59
TBLA0G031203.284ON6734255346e-59
Smik_2.2013.284ON6094525316e-59
SAKL0D04664g1.244ON5934585298e-59
TPHA0A002405.158ON6034895308e-59
Smik_4.2843.284ON6044625308e-59
SAKL0D02926g3.285ON5834425289e-59
Kpol_2000.921.50ON6374495311e-58
KLTH0H13398g1.368ON5874905271e-58
YDR046C (BAP3)3.284ON6044625281e-58
Skud_15.1381.368ON5925025272e-58
Ecym_2663na 7ON5894565262e-58
KAFR0C004003.284ON5824585252e-58
KLLA0C01606g1.50ON6204255264e-58
NCAS0B079001.244ON6194145255e-58
NCAS0A089201.368ON5994995245e-58
KLTH0F01606gna 5ON6044775236e-58
Suva_11.2731.244ON6014795236e-58
KAFR0D04130na 3ON6444545258e-58
NDAI0A074903.284ON5964445221e-57
Kwal_33.132041.50ON6074445221e-57
Kpol_534.221.368ON5924475211e-57
KNAG0H011503.284ON6174565221e-57
Ecym_26623.284ON5894515182e-57
KNAG0F002701.50ON6344445212e-57
Skud_4.3003.284ON6044485193e-57
Sklu_YGOB_Anc_1.3681.368ON5414295153e-57
AEL030W1.368ON5824545164e-57
NCAS0I015303.284ON5954485141e-56
Ecym_27161.368ON5924905132e-56
YOL020W (TAT2)1.368ON5924845132e-56
KNAG0J022103.285ON5814915122e-56
Suva_15.1481.368ON5924925122e-56
CAGL0D02178g1.368ON5774905112e-56
Kwal_8.590na 8ON6294705142e-56
Kwal_23.2817na 9ON5805415095e-56
ZYRO0A00308gsingletonON5644505085e-56
TBLA0C012101.368ON6004475096e-56
AGR038C3.284ON5804415079e-56
CAGL0H08393g3.284ON6124725081e-55
KNAG0J022003.284ON6074465072e-55
KLLA0B14685gna 9ON5715335033e-55
Smik_2.2023.285ON6174845053e-55
Smik_15.1461.368ON5934925025e-55
Suva_4.3083.285ON6184455027e-55
Skud_2.1923.285ON6194455028e-55
Kwal_34.16254singletonOFF4814294931e-54
Kwal_YGOB_34.162541.368ON4914294931e-54
KLLA0A06930g1.244ON5874254991e-54
TBLA0I020103.285ON6283995002e-54
NDAI0F043901.50ON6674505012e-54
Kwal_27.105383.284ON6024264957e-54
NCAS0A004201.50ON6794454961e-53
TDEL0F02830na 10ON5614644874e-53
TDEL0C053403.397ON5754814875e-53
KLLA0A10813g1.368ON5844914867e-53
ADL272Wna 11ON5644184859e-53
KLLA0A06886gsingletonON5874584851e-52
TPHA0B047501.50ON6394884871e-52
ZYRO0C18502g7.44ON5754884832e-52
ZYRO0G12342g3.284ON6204754852e-52
TDEL0D00200singletonON5675034822e-52
CAGL0M00154gsingletonON5504644803e-52
NDAI0A01340singletonON5544694804e-52
NCAS0I015203.285ON6144444834e-52
KLTH0B00154gna 8ON5565084779e-52
Kpol_1052.143.285ON6024574791e-51
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_2000.65
         (595 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON} (1348...   914   0.0  
TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1...   733   0.0  
Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON} Y...   670   0.0  
TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1...   667   0.0  
Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON} Y...   666   0.0  
Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL0...   666   0.0  
NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {O...   665   0.0  
YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}  CA...   666   0.0  
CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} simil...   646   0.0  
TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa] ...   643   0.0  
KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON}              636   0.0  
NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON}            620   0.0  
KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {O...   613   0.0  
SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {...   610   0.0  
SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {...   606   0.0  
NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON}            604   0.0  
KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON}            604   0.0  
KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {...   600   0.0  
YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON} ...   597   0.0  
Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {O...   595   0.0  
SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {...   591   0.0  
Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {O...   591   0.0  
NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {O...   587   0.0  
Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {O...   583   0.0  
KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {...   582   0.0  
Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa] ...   583   0.0  
Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {...   579   0.0  
YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysin...   578   0.0  
TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa] ...   577   0.0  
Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C...   577   0.0  
NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON}              574   0.0  
NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa] ...   573   0.0  
CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa] ...   572   0.0  
SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} simila...   571   0.0  
ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} simi...   569   0.0  
Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C...   568   0.0  
Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C...   566   0.0  
TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa] ...   560   0.0  
Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar t...   554   0.0  
KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {O...   555   0.0  
KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} simila...   548   0.0  
Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268...   545   0.0  
Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}...   538   0.0  
KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON}                537   0.0  
KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} simila...   535   0.0  
TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1...   535   0.0  
AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}...   508   e-175
AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic ...   507   e-174
ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]...   491   e-167
CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} simila...   284   4e-87
Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)...   276   1e-84
TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON}     269   1e-81
KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa] ...   267   6e-81
Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C...   266   1e-80
KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} simila...   264   2e-79
TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa] ...   262   1e-78
Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON...   261   2e-78
Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]...   259   4e-78
SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]...   259   4e-78
TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {O...   259   6e-78
SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} simila...   256   3e-77
YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}  DIP5Dicarbo...   258   3e-77
Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W (...   257   5e-77
KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} simi...   256   2e-76
KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44 ...   255   2e-76
Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W (...   255   2e-76
NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON}              254   7e-76
Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}...   250   2e-74
CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {...   250   2e-74
KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON}             251   3e-74
NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {O...   249   3e-74
KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON}             248   1e-73
Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON} (23929..25...   246   3e-73
TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {O...   246   5e-73
YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON} ...   246   9e-73
KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} simila...   245   1e-72
SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {...   244   1e-72
KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7...   243   6e-72
AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-synteni...   239   7e-71
Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to ...   239   8e-71
Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {O...   240   8e-71
NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44     240   2e-70
Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to ...   239   3e-70
Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON...   241   3e-70
Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {...   239   5e-70
SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} simila...   238   7e-70
ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} simi...   235   1e-69
SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON...   237   2e-69
Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR1...   235   8e-69
Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {O...   233   4e-68
TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON}            230   1e-67
KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {...   230   5e-67
TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {O...   230   5e-67
TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1...   231   9e-67
Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {...   230   1e-66
KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON}      229   1e-66
Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {...   230   3e-66
SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} high...   228   3e-66
Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa] ...   227   3e-66
NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158    228   4e-66
Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {...   229   5e-66
Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {...   229   6e-66
CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highl...   229   6e-66
KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]...   226   7e-66
Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W...   224   2e-65
YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}...   228   2e-65
KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON}      226   2e-65
ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {...   226   3e-65
NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON} Anc_5...   225   4e-65
Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON...   225   4e-65
KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {O...   225   6e-65
TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.3...   225   6e-65
YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}  ...   225   7e-65
SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {...   225   8e-65
ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-synteni...   224   1e-64
KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} simi...   223   1e-64
Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039...   224   1e-64
NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON} Anc_1...   224   1e-64
NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44     223   2e-64
KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} simi...   223   4e-64
NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {O...   223   4e-64
AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic ...   223   6e-64
Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR0...   221   8e-64
TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.5...   222   1e-63
ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} simi...   222   1e-63
Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON...   220   2e-63
CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar ...   220   5e-63
AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}...   220   5e-63
TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa] ...   221   5e-63
SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]...   218   6e-63
TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {O...   219   8e-63
Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)      218   1e-62
Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W ...   219   1e-62
NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa] ...   218   1e-62
Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039...   217   2e-62
TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON}            217   2e-62
Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON} (82500....   218   2e-62
NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {O...   218   2e-62
KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {O...   218   3e-62
Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON} YP...   215   3e-62
SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} simila...   217   3e-62
CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly...   217   4e-62
Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar t...   217   5e-62
KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.5...   218   5e-62
KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}...   216   6e-62
Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {...   216   8e-62
Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON} (193316...   216   8e-62
YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1Gener...   216   9e-62
YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}  HIP1High-a...   216   1e-61
Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)    214   2e-61
TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa] ...   216   2e-61
Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON} Y...   216   2e-61
Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W ...   215   2e-61
KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON}              216   3e-61
AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON} N...   215   3e-61
YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}  AGP3Low-affi...   214   3e-61
KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {O...   215   3e-61
SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]...   214   4e-61
Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON} (197876...   214   4e-61
Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON...   214   5e-61
KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {...   214   7e-61
KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.1...   213   9e-61
TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa] ...   215   1e-60
CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highl...   213   1e-60
Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON} Y...   213   3e-60
Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265...   211   4e-60
Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {...   211   4e-60
Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON...   212   4e-60
AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON} S...   211   6e-60
KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} simi...   210   7e-60
NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158    211   7e-60
TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON} Anc_5...   210   1e-59
KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly...   210   1e-59
YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}  AG...   211   1e-59
Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON...   211   1e-59
Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 b...   211   1e-59
KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly s...   209   2e-59
NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa] ...   210   2e-59
SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON} unipro...   210   2e-59
Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {...   210   2e-59
NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON}            209   2e-59
AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON} S...   209   2e-59
KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} simila...   209   2e-59
NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa] ...   209   4e-59
TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON}              210   6e-59
Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON...   209   6e-59
SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {...   208   8e-59
TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}...   208   8e-59
Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON...   208   8e-59
SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON} unipro...   207   9e-59
Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON} (2085...   209   1e-58
KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]...   207   1e-58
YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}  ...   207   1e-58
Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020...   207   2e-58
Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {O...   207   2e-58
KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON}                206   2e-58
KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {...   207   4e-58
NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON} Anc_1...   206   5e-58
NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON} Anc_1...   206   5e-58
KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {...   206   6e-58
Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039...   206   6e-58
KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON}              206   8e-58
NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa] ...   205   1e-57
Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {...   205   1e-57
Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON} (50849..5...   205   1e-57
KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON}              205   1e-57
Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {O...   204   2e-57
KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}...   205   2e-57
Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON...   204   3e-57
Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..85104...   202   3e-57
AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic ho...   203   4e-57
NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON}              202   1e-56
Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar...   202   2e-56
YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High ...   202   2e-56
KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {...   201   2e-56
Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020...   201   2e-56
CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly...   201   2e-56
Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON} YO...   202   2e-56
Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}...   200   5e-56
ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON...   200   5e-56
TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {O...   200   6e-56
AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON} S...   199   9e-56
CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly...   200   1e-55
KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {...   199   2e-55
KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]...   198   3e-55
Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON...   199   3e-55
Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020...   197   5e-55
Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON...   197   7e-55
Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON...   197   8e-55
Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL02...   194   1e-54
Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON} A...   194   1e-54
KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {...   196   1e-54
TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {O...   197   2e-54
NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1...   197   2e-54
Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068...   195   7e-54
NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}...   195   1e-53
TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {O...   192   4e-53
TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {O...   192   5e-53
KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {...   191   7e-53
ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-synteni...   191   9e-53
KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {...   191   1e-52
TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1...   192   1e-52
ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]...   190   2e-52
ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {...   191   2e-52
TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON}                190   2e-52
CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar...   189   3e-52
NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON}              189   4e-52
NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON}              190   4e-52
KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON} ...   188   9e-52
Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON} (39793....   189   1e-51
TPHA0A02500 Chr1 (533688..535460) [1773 bp, 590 aa] {ON} Anc_1.3...   188   1e-51
TPHA0M01200 Chr13 complement(244556..246379) [1824 bp, 607 aa] {...   189   1e-51
YBR069C Chr2 complement(376574..378433) [1860 bp, 619 aa] {ON}  ...   189   1e-51
Suva_4.381 Chr4 complement(668597..670369) [1773 bp, 590 aa] {ON...   188   2e-51
ZYRO0G07172g Chr7 complement(565863..567566) [1704 bp, 567 aa] {...   186   4e-51
KNAG0L00110 Chr12 complement(8543..10258) [1716 bp, 571 aa] {ON}...   186   5e-51
NCAS0J00140 Chr10 complement(8478..10154) [1677 bp, 558 aa] {ON}      185   1e-50
TBLA0C02520 Chr3 (595918..597660) [1743 bp, 580 aa] {ON} Anc_3.3...   183   7e-50
Kpol_526.10 s526 complement(18362..20104) [1743 bp, 580 aa] {ON}...   182   1e-49
KNAG0C00590 Chr3 complement(100801..102705) [1905 bp, 634 aa] {O...   183   2e-49
Kpol_1065.13 s1065 (28709..30499) [1791 bp, 596 aa] {ON} (28709....   182   2e-49
CAGL0L07546g Chr12 complement(833821..835725) [1905 bp, 634 aa] ...   182   2e-49
Skud_2.260 Chr2 complement(467322..469118) [1797 bp, 598 aa] {ON...   182   3e-49
Kwal_33.13215 s33 complement(123154..124950) [1797 bp, 598 aa] {...   181   5e-49
KLTH0D07128g Chr4 complement(624863..626494) [1632 bp, 543 aa] {...   180   7e-49
YBR132C Chr2 complement(499652..501442) [1791 bp, 596 aa] {ON}  ...   181   7e-49
KAFR0F02250 Chr6 (439217..440881) [1665 bp, 554 aa] {ON}              179   1e-48
SAKL0A09724g Chr1 complement(855698..857353) [1656 bp, 551 aa] {...   179   1e-48
NCAS0I00850 Chr9 (156277..158031) [1755 bp, 584 aa] {ON} Anc_3.3...   180   1e-48
Ecym_8297 Chr8 complement(602984..604693) [1710 bp, 569 aa] {ON}...   179   2e-48
Smik_2.272 Chr2 complement(484274..486067) [1794 bp, 597 aa] {ON...   179   2e-48
Kpol_1052.16 s1052 (44303..46144) [1842 bp, 613 aa] {ON} (44303....   179   3e-48
TBLA0I02000 Chr9 complement(452716..454710) [1995 bp, 664 aa] {O...   178   1e-47
NDAI0A08190 Chr1 complement(1875783..1877543) [1761 bp, 586 aa] ...   177   1e-47
TPHA0A03960 Chr1 (877702..879549) [1848 bp, 615 aa] {ON}              176   3e-47
SAKL0H08184g Chr8 (704748..706544) [1797 bp, 598 aa] {ON} simila...   176   4e-47
KAFR0K01360 Chr11 complement(279140..280888) [1749 bp, 582 aa] {...   173   2e-46
CAGL0C00539g Chr3 (57175..57177,57724..59502) [1782 bp, 593 aa] ...   174   3e-46
TPHA0G03770 Chr7 complement(797508..799322) [1815 bp, 604 aa] {O...   173   4e-46
ZYRO0C17182g Chr3 complement(1334883..1336619) [1737 bp, 578 aa]...   172   7e-46
TBLA0F03240 Chr6 complement(790069..791826) [1758 bp, 585 aa] {O...   172   9e-46
Kwal_26.8097 s26 (643310..644944) [1635 bp, 544 aa] {ON} YNL270C...   171   1e-45
KAFR0F04410 Chr6 (865219..866961) [1743 bp, 580 aa] {ON}              171   1e-45
KNAG0B01270 Chr2 (240862..242640) [1779 bp, 592 aa] {ON} Anc_3.3...   171   2e-45
AAR038W Chr1 (409071..410771) [1701 bp, 566 aa] {ON} Syntenic ho...   170   2e-45
NDAI0A07500 Chr1 complement(1715826..1717685) [1860 bp, 619 aa] ...   171   3e-45
Ecym_3430 Chr3 (807979..809658) [1680 bp, 559 aa] {ON} similar t...   170   4e-45
KLTH0C08052g Chr3 (685805..687604) [1800 bp, 599 aa] {ON} simila...   170   4e-45
TDEL0E05700 Chr5 complement(1059079..1060833) [1755 bp, 584 aa] ...   169   7e-45
TPHA0A02450 Chr1 (522439..524190) [1752 bp, 583 aa] {ON} Anc_3.3...   169   7e-45
Kwal_56.22951 s56 complement(345097..346887) [1791 bp, 596 aa] {...   169   9e-45
Kwal_23.3847 s23 (457732..459471) [1740 bp, 579 aa] {ON} YBR132C...   169   1e-44
AER405C Chr5 complement(1413790..1415283) [1494 bp, 497 aa] {ON}...   167   2e-44
KLLA0C15873g Chr3 (1381699..1383405) [1707 bp, 568 aa] {ON} simi...   167   4e-44
TDEL0H04510 Chr8 complement(813321..815075) [1755 bp, 584 aa] {O...   167   6e-44
Smik_12.2 Chr12 (2207..3958) [1752 bp, 583 aa] {ON} YLL061W (REAL)    166   1e-43
KAFR0B00220 Chr2 complement(52244..54001) [1758 bp, 585 aa] {ON}      165   2e-43
SAKL0D04048g Chr4 (328883..330643) [1761 bp, 586 aa] {ON} simila...   164   3e-43
KLTH0F11286g Chr6 (959314..961062) [1749 bp, 582 aa] {ON} simila...   164   6e-43
YLL061W Chr12 (17956..19707) [1752 bp, 583 aa] {ON}  MMP1High-af...   164   7e-43
ZYRO0D09086g Chr4 complement(780326..781966) [1641 bp, 546 aa] {...   162   1e-42
SAKL0B08734g Chr2 complement(743379..745055) [1677 bp, 558 aa] {...   160   9e-42
KLLA0F01012g Chr6 complement(90772..92442) [1671 bp, 556 aa] {ON...   158   3e-41
TDEL0B00130 Chr2 (20136..21890) [1755 bp, 584 aa] {ON}                157   2e-40
CAGL0E01089g Chr5 complement(96819..99380) [2562 bp, 853 aa] {ON...   159   2e-40
SAKL0B04554g Chr2 complement(401845..403461) [1617 bp, 538 aa] {...   154   1e-39
KLLA0B06776g Chr2 (594172..595938) [1767 bp, 588 aa] {ON} simila...   154   2e-39
SAKL0H15092g Chr8 complement(1306212..1308764) [2553 bp, 850 aa]...   154   9e-39
Suva_16.18 Chr16 (17108..18859) [1752 bp, 583 aa] {ON} YLL061W (...   151   2e-38
Suva_16.31 Chr16 (39282..41042) [1761 bp, 586 aa] {ON} YLL061W (...   150   2e-38
SAKL0H10890g Chr8 complement(940629..943046) [2418 bp, 805 aa] {...   151   6e-38
ZYRO0D17952g Chr4 complement(1489975..1491732) [1758 bp, 585 aa]...   149   1e-37
Ecym_4758 Chr4 (1474661..1476424) [1764 bp, 587 aa] {ON} similar...   148   2e-37
KLTH0E00550g Chr5 (57109..58680) [1572 bp, 523 aa] {ON} similar ...   147   2e-37
TDEL0E00250 Chr5 (41958..43721) [1764 bp, 587 aa] {ON}                146   8e-37
YPL274W Chr16 (22938..24701) [1764 bp, 587 aa] {ON}  SAM3High-af...   146   1e-36
Smik_6.483 Chr6 (798526..800298) [1773 bp, 590 aa] {ON} YPL274W ...   145   2e-36
TDEL0F04660 Chr6 (877951..880473) [2523 bp, 840 aa] {ON} Anc_8.3...   142   5e-35
ZYRO0F13838g Chr6 (1139293..1141803) [2511 bp, 836 aa] {ON} simi...   142   6e-35
AGL171W Chr7 (377256..379811) [2556 bp, 851 aa] {ON} Syntenic ho...   142   7e-35
KLLA0D16830g Chr4 (1426856..1429354) [2499 bp, 832 aa] {ON} simi...   136   6e-33
Skud_4.418 Chr4 (745597..748152) [2556 bp, 851 aa] {ON} YDR160W ...   135   1e-32
NDAI0J00870 Chr10 complement(191679..194192) [2514 bp, 837 aa] {...   135   1e-32
KLTH0E11792g Chr5 (1047925..1050339) [2415 bp, 804 aa] {ON} simi...   134   2e-32
Smik_4.404 Chr4 (734205..736763) [2559 bp, 852 aa] {ON} YDR160W ...   134   3e-32
YDR160W Chr4 (776163..778721) [2559 bp, 852 aa] {ON}  SSY1Compon...   134   3e-32
Kwal_YGOB_27.11900 s27 (994323..996518,996909..997118) [2406 bp,...   133   5e-32
Kwal_27.11900 s27 (994323..996500) [2178 bp, 726 aa] {OFF} YDR16...   133   6e-32
KLTH0G11726g Chr7 complement(986837..989311) [2475 bp, 824 aa] {...   132   1e-31
Suva_2.323 Chr2 (570119..572674) [2556 bp, 851 aa] {ON} YDR160W ...   130   5e-31
NCAS0B03380 Chr2 complement(589351..591888) [2538 bp, 845 aa] {O...   130   7e-31
Skud_51.1 Chr51 (364..1407) [1044 bp, 348 aa] {ON} YKR039W (REAL)     124   1e-30
KNAG0A05040 Chr1 complement(733928..736432) [2505 bp, 834 aa] {O...   129   2e-30
Skud_7.4 Chr7 (9030..10079) [1050 bp, 349 aa] {ON} YKR039W (REAL)     124   2e-30
KLLA0B09922g Chr2 complement(867748..870141) [2394 bp, 797 aa] {...   128   3e-30
Kwal_53.19461 s53 complement(2918..4615) [1698 bp, 565 aa] {ON} ...   125   9e-30
Suva_78.1 Chr78 complement(3..695) [693 bp, 231 aa] {ON} YPL274W...    91   4e-20
Ecym_4230 Chr4 complement(478376..480949) [2574 bp, 857 aa] {ON}...    97   4e-20
Skud_47.1 Chr47 (1..987) [987 bp, 328 aa] {ON} YPL274W (REAL)          93   6e-20
NCAS0E01810 Chr5 complement(354074..354589) [516 bp, 171 aa] {ON...    81   5e-17
Skud_7.5 Chr7 (10082..10387) [306 bp, 102 aa] {ON} YKR039W (REAL)      77   1e-16
Skud_30.1 Chr30 (3097..3933) [837 bp, 279 aa] {ON} YPL274W (REAL)      70   2e-12
Suva_84.1 Chr84 (1..639) [639 bp, 213 aa] {ON} YPL274W (REAL)          69   2e-12
Skud_16.3 Chr16 (4274..5350) [1077 bp, 358 aa] {ON} YPL274W (REAL)     70   3e-12
Suva_13.516 Chr13 complement(902560..903123,903176..903289) [678...    56   4e-08
TDEL0C00100 Chr3 complement(1863..2399) [537 bp, 178 aa] {ON}          52   4e-07
Skud_7.6 Chr7 (10388..10840) [453 bp, 150 aa] {ON} YKR039W (REAL)      44   1e-04

>Kpol_2000.65 s2000 (134897..136684) [1788 bp, 595 aa] {ON}
           (134897..136684) [1788 nt, 596 aa]
          Length = 595

 Score =  914 bits (2363), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 471/595 (79%), Positives = 471/595 (79%)

Query: 1   MGQQNDELTQYELQSFNSSSSNGVNKTYNYITADAXXXXXXXXXYETGSSSIVVDXXXXX 60
           MGQQNDELTQYELQSFNSSSSNGVNKTYNYITADA         YETGSSSIVVD     
Sbjct: 1   MGQQNDELTQYELQSFNSSSSNGVNKTYNYITADAELKKLKKKEYETGSSSIVVDGSSRH 60

Query: 61  XXXXXXXXXXXXDEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLK 120
                       DEDEPYVDQGVVQDAEVKRELKQRH                  STPLK
Sbjct: 61  LHGSHGSHSVSGDEDEPYVDQGVVQDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLK 120

Query: 121 NAGPVGSLIAYLFMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWF 180
           NAGPVGSLIAYLFMATIVFSVTQSLGEMA                  PSIGAANGYMYWF
Sbjct: 121 NAGPVGSLIAYLFMATIVFSVTQSLGEMATFIPVTSSFTVFSSRFISPSIGAANGYMYWF 180

Query: 181 SWAITFALELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKV 240
           SWAITFALELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKV
Sbjct: 181 SWAITFALELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKV 240

Query: 241 IAIMGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAF 300
           IAIMGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAF
Sbjct: 241 IAIMGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAF 300

Query: 301 TYQGTELVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXX 360
           TYQGTELVGITAGEAANPRKTVPRAIKKVS                 VPFDDPKL     
Sbjct: 301 TYQGTELVGITAGEAANPRKTVPRAIKKVSFRILIFYILSLFFIGLLVPFDDPKLSSDDS 360

Query: 361 XXXXXPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFG 420
                PFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFG
Sbjct: 361 YVSSSPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFG 420

Query: 421 ITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFI 480
           ITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFI
Sbjct: 421 ITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFI 480

Query: 481 QTLEHRGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXX 540
           QTLEHRGISRDDLPFKAALMPWLAYYA          QGFTAFAPTFNGSDFVAAYI   
Sbjct: 481 QTLEHRGISRDDLPFKAALMPWLAYYAIFFMIIIIIIQGFTAFAPTFNGSDFVAAYISVF 540

Query: 541 XXXXXXXXXQLYFRCKLYWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
                    QLYFRCKLYWSLDEV             WEDSAPKTFWDRFWDVVA
Sbjct: 541 LFFFLWVSFQLYFRCKLYWSLDEVDIDTDRRDIDAIIWEDSAPKTFWDRFWDVVA 595

>TPHA0B04480 Chr2 (1050173..1051984) [1812 bp, 603 aa] {ON} Anc_1.83
           YEL063C
          Length = 603

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 385/603 (63%), Positives = 431/603 (71%), Gaps = 10/603 (1%)

Query: 3   QQNDELTQYELQSF---NSSSSNGVNKTYN-------YITADAXXXXXXXXXYETGSSSI 52
               +L+QYELQS+   N SS++ +NK  +         ++ +             S+S 
Sbjct: 1   MSQKDLSQYELQSYTSNNRSSASEMNKGSDAKEKVDVISSSGSLSKRKRINRSRANSNSD 60

Query: 53  VVDXXXXXXXXXXXXXXXXXDEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXX 112
           +                   D+D+ Y+D+GVV++AEVKR+LKQRH               
Sbjct: 61  LEGSAADGTARARDIDNADVDDDDYYMDEGVVKEAEVKRQLKQRHIGMIALGGTIGTGLF 120

Query: 113 XXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGA 172
              +TPL NAGPVG+LIAYLFMATIVFSVTQSLGEMA                  P+IGA
Sbjct: 121 IGIATPLGNAGPVGALIAYLFMATIVFSVTQSLGEMATFIPVTSSFTVFSSRFLSPAIGA 180

Query: 173 ANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFE 232
           ANGYMYWFSWA+TFALELSVVGQIIQFWT AVPLSAWIVIWW ILTIMN+FPVKFYGEFE
Sbjct: 181 ANGYMYWFSWAVTFALELSVVGQIIQFWTHAVPLSAWIVIWWVILTIMNLFPVKFYGEFE 240

Query: 233 FWVASIKVIAIMGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWV 292
           FWVASIKV+AI+GFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGPGIIS  V EGRFLGWV
Sbjct: 241 FWVASIKVLAIIGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWV 300

Query: 293 SSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDD 352
           SSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKV+                 VP+DD
Sbjct: 301 SSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVTFRILIFYILSLFFIGLLVPYDD 360

Query: 353 PKLXXXXXXXXXXPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKT 412
            KL          PFIIAI+NSGTK+LPHIFNAVILSTIISAGNSN+YVGSR++FGLAKT
Sbjct: 361 EKLTSTDSYISASPFIIAIENSGTKILPHIFNAVILSTIISAGNSNVYVGSRILFGLAKT 420

Query: 413 KLAPRWFGITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLI 472
           KLAP+WFG T++ GVPY +V FTS+FGALAFLEVSSGGAKAFNWLLNI+ VAGFFAWLLI
Sbjct: 421 KLAPKWFGYTSRGGVPYYSVFFTSSFGALAFLEVSSGGAKAFNWLLNIISVAGFFAWLLI 480

Query: 473 SIAHVRFIQTLEHRGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDF 532
           SIAHVRF+Q L+HRGISRDDLPFKA  MP LAYY+          QGFTAFAPTFNGSDF
Sbjct: 481 SIAHVRFMQALKHRGISRDDLPFKARFMPHLAYYSIFFMTIIIIIQGFTAFAPTFNGSDF 540

Query: 533 VAAYIXXXXXXXXXXXXQLYFRCKLYWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWD 592
           VAAYI            QLYFR KL W+++EV             WEDS PKTFWD+FWD
Sbjct: 541 VAAYISIFLFFFLWLCFQLYFRSKLLWTVEEVDIDTDRRDVDAIIWEDSGPKTFWDKFWD 600

Query: 593 VVA 595
           VVA
Sbjct: 601 VVA 603

>Skud_5.26 Chr5 complement(30850..32622) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  670 bits (1728), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 332/523 (63%), Positives = 378/523 (72%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           +E+    D+G VQ+AEVKRELKQRH                  STPL NAGPVG+LIAYL
Sbjct: 68  EENLQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLANAGPVGALIAYL 127

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
           FM ++ FSVTQSLGEMA                  P+ GAANGYMYWFSWAITFALELSV
Sbjct: 128 FMGSLAFSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSV 187

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
           VGQ+IQFWT  VPL+AWI I+W ++TIMN+FPVK+YGEFEFWVASIKVIAI+GFLIYC C
Sbjct: 188 VGQVIQFWTHKVPLAAWISIFWVLITIMNLFPVKYYGEFEFWVASIKVIAIIGFLIYCFC 247

Query: 253 MVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITA 312
           MVCGAGVTGPVGFRYWRNPG WGPGIIS    EGRFLGWVSSLINAAFT+QGTELVGITA
Sbjct: 248 MVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTFQGTELVGITA 307

Query: 313 GEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQ 372
           GEAANPRKTVPRAIKKV                  VP++DPKL          PFI+AIQ
Sbjct: 308 GEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTEATSYVSTSPFIVAIQ 367

Query: 373 NSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAV 432
           NSGTKVLPHIFNAVIL+TIISA NSNIYVGSR++FGL+K KLAP++   T+K GVPYIAV
Sbjct: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTSKGGVPYIAV 427

Query: 433 LFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDD 492
             T+ FGALA++E S+GG K F WLLNI GVAGFFAWL ISI+H+RF+Q L++RGISRD+
Sbjct: 428 FATAVFGALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDE 487

Query: 493 LPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLY 552
           LPFKA LMP LAYY+          QGFTAFAP FNGS F+AAYI            +  
Sbjct: 488 LPFKAKLMPGLAYYSSFFMIIIIIIQGFTAFAPKFNGSSFLAAYISIFLFIAVWILFECI 547

Query: 553 FRCKLYWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
           FRC+  W +++V             WED  PKTFWD+FW+VVA
Sbjct: 548 FRCRFIWKIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>TDEL0C06180 Chr3 (1120158..1121909) [1752 bp, 583 aa] {ON} Anc_1.83
           YEL063C
          Length = 583

 Score =  667 bits (1720), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/518 (63%), Positives = 378/518 (72%)

Query: 78  YVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATI 137
           +V +G V +AEVKR LKQRH                  STPL NAGPVG LIAYLFMAT+
Sbjct: 66  FVKEGQVHEAEVKRALKQRHIGMIALGGTIGTGLFIGISTPLSNAGPVGGLIAYLFMATL 125

Query: 138 VFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQII 197
           V+SV QSLGEMA                  P+ GAA+GYMYWFSWAITFALELSVVGQII
Sbjct: 126 VYSVVQSLGEMATFIPVTSAFTVFSSRFLSPAFGAASGYMYWFSWAITFALELSVVGQII 185

Query: 198 QFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGA 257
           +FWT AVP++AWI I+W +LT+ N+FPVK+YGEFEFW+A IKVIA++GF+IYCLCMVCGA
Sbjct: 186 EFWTTAVPMAAWITIFWVLLTVSNLFPVKYYGEFEFWIAFIKVIALVGFIIYCLCMVCGA 245

Query: 258 GVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 317
           G+TGPVGFRYWRNPG WGPGIIS    EGRFLGWVSSLINAAFTYQGTELVGITAGEAAN
Sbjct: 246 GITGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 305

Query: 318 PRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTK 377
           PRK+VPRAIKKV                  VP++DPKL          PFIIAI+NSGTK
Sbjct: 306 PRKSVPRAIKKVVFRILVFYYPIAVFIGLLVPYNDPKLNSSDSYVSSSPFIIAIENSGTK 365

Query: 378 VLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSA 437
           VLPHIFNAV+L+TIISAGNSN+YVGSR+M+GLAK KLAP +FG T   GVPY AV FTSA
Sbjct: 366 VLPHIFNAVVLTTIISAGNSNVYVGSRIMYGLAKIKLAPSFFGRTNAAGVPYFAVFFTSA 425

Query: 438 FGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKA 497
           FGALA++E+S+GGA AFNWLLNI GVAGFF W+LIS  H+RF+Q L++RGISRDDLPFKA
Sbjct: 426 FGALAYMELSTGGASAFNWLLNITGVAGFFTWVLISACHIRFMQALKYRGISRDDLPFKA 485

Query: 498 ALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKL 557
             MPWLAYYA          QGFTAFAPTF+G DF AAY+            Q++FRC++
Sbjct: 486 KFMPWLAYYALFFMVVIILIQGFTAFAPTFSGVDFAAAYVSVFLFIAIWLGAQIWFRCRI 545

Query: 558 YWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
           +  LDEV             W+D  PKT WD+FW++VA
Sbjct: 546 FHRLDEVDIDTDRRDIEAVVWDDEPPKTLWDKFWNIVA 583

>Smik_5.24 Chr5 complement(34087..35859) [1773 bp, 590 aa] {ON}
           YEL063C (REAL)
          Length = 590

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 328/516 (63%), Positives = 377/516 (73%)

Query: 80  DQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVF 139
           DQG V++AEVKRELKQRH                  S PL NAGPVG+LI+YLFM ++ +
Sbjct: 75  DQGEVRNAEVKRELKQRHIGMIALGGTIGTGLFIGLSKPLANAGPVGALISYLFMGSLAY 134

Query: 140 SVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQF 199
           SVTQSLGEMA                  P+ GAANGYMYWFSWAITFALELSVVGQ+I+F
Sbjct: 135 SVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIEF 194

Query: 200 WTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGV 259
           WT+ VPL+AWI I+W I+TIMN+FPVK+YGEFEFWVASIKV+AI+GFLIYC CMVCGAGV
Sbjct: 195 WTNKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGV 254

Query: 260 TGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 319
           TGPVGFRYWRNPG WGPGIIS    EGRFLGWVSSLINAAFT+QGTELVGITAGEAANPR
Sbjct: 255 TGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPR 314

Query: 320 KTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVL 379
           KTVPRAIKKV                  VP++DPKL          PFIIAI+NSGTKVL
Sbjct: 315 KTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTTATSYVSVSPFIIAIENSGTKVL 374

Query: 380 PHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFG 439
           PHIFNAVIL+TIISA NSNIYVGSR++FGL+K KLAP++   TTK GVPYIAV  T+ FG
Sbjct: 375 PHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFITAVFG 434

Query: 440 ALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAAL 499
           ALA++E S+GG K F WLLNI GVAGFFAWLLISI+H+RF+Q L++RGISRD+LPFKA L
Sbjct: 435 ALAYMETSTGGDKVFEWLLNITGVAGFFAWLLISISHIRFMQALKYRGISRDELPFKAKL 494

Query: 500 MPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYW 559
           MP LAY+A          QGFTAFAP F+G DF+AAYI            ++ FRC+  W
Sbjct: 495 MPGLAYFAATFMIIIILIQGFTAFAPKFDGIDFLAAYISIFLFLAIWILFEIIFRCRFIW 554

Query: 560 SLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
            +++V             WED  PKTFWD+FW+VVA
Sbjct: 555 KIEDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>Suva_5.4 Chr5 complement(7388..9160) [1773 bp, 590 aa] {ON} YEL063C
           (REAL)
          Length = 590

 Score =  666 bits (1719), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/523 (63%), Positives = 378/523 (72%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           +ED    D+G VQ+AEVKRELKQRH                  STPL NAGPVG+LI+YL
Sbjct: 68  EEDIQDEDEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYL 127

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
           FM ++ +SVTQSLGEMA                  P+ GAANGYMYWFSWA+TFALELSV
Sbjct: 128 FMGSLAYSVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAVTFALELSV 187

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
           VGQ+IQFWT AVPL+AWI I+W I+T MNMFPVK+YGEFEFWVASIKVIAI+GFLIYC C
Sbjct: 188 VGQVIQFWTYAVPLAAWISIFWVIITAMNMFPVKYYGEFEFWVASIKVIAIIGFLIYCFC 247

Query: 253 MVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITA 312
           MVCGAGVTGPVGFRYWRNPG WGPGIIS    E RFLGWVSSLINAAFT+QGTELVGITA
Sbjct: 248 MVCGAGVTGPVGFRYWRNPGAWGPGIISKNKNEARFLGWVSSLINAAFTFQGTELVGITA 307

Query: 313 GEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQ 372
           GEAANPRKTVPRAIKKV                  VP++DPKL          PFIIAI+
Sbjct: 308 GEAANPRKTVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTSATSYVSTSPFIIAIE 367

Query: 373 NSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAV 432
           NSGTKVLPHIFNAVIL+TIISA NSNIYVGSRV+FGL+K+KLAP++F  TTK GVPYIAV
Sbjct: 368 NSGTKVLPHIFNAVILTTIISAANSNIYVGSRVLFGLSKSKLAPKFFSKTTKGGVPYIAV 427

Query: 433 LFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDD 492
             TS FGALA++E S+GG K F WLLNI GVAGFFAWL IS++H+RF+Q L++RGISRD+
Sbjct: 428 FATSIFGALAYMETSTGGGKVFAWLLNITGVAGFFAWLFISVSHIRFMQALKYRGISRDE 487

Query: 493 LPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLY 552
           LPFKA LMP LAYYA          QGFT+F PTFNG +F+AAYI            +L 
Sbjct: 488 LPFKAKLMPGLAYYATFFMVVIILIQGFTSFTPTFNGVNFLAAYISVFLFLAIWILFELI 547

Query: 553 FRCKLYWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
           FRC+  W +++V             WE+  PKT WD+FW+VV 
Sbjct: 548 FRCRFVWKIEDVDIDSDRRDIEAIVWEEPEPKTLWDKFWNVVG 590

>NDAI0A00610 Chr1 complement(113913..115610) [1698 bp, 565 aa] {ON} 
          Length = 565

 Score =  665 bits (1716), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 330/523 (63%), Positives = 378/523 (72%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           +  E  +  G +++AEVKRELKQRH                  STPL NAGPVG+LIAYL
Sbjct: 43  ESQEEEIANGQIREAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALIAYL 102

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
           FM T+V+SVTQSLGEMA                  PS GAANGYMYWFSWAITFALELSV
Sbjct: 103 FMGTLVYSVTQSLGEMATFIPVTSSFTVFSQRFLSPSFGAANGYMYWFSWAITFALELSV 162

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
           VGQIIQFWT AVP+ AWI I+W +L  MNMFPV+FYGEFEFWVASIKV+AIMGFLIYCLC
Sbjct: 163 VGQIIQFWTSAVPIVAWISIFWVLLVAMNMFPVRFYGEFEFWVASIKVLAIMGFLIYCLC 222

Query: 253 MVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITA 312
           MVCGAGVTGPVGFRYWRNPGP GPGII+  + E +FLGWVSSLINAAFTYQGTELVGITA
Sbjct: 223 MVCGAGVTGPVGFRYWRNPGPMGPGIIAKNLNEAKFLGWVSSLINAAFTYQGTELVGITA 282

Query: 313 GEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQ 372
           GEAANPRK+VPRAIKKV                  VP++DPKL          PFII+IQ
Sbjct: 283 GEAANPRKSVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDPKLTSDDSYVAASPFIISIQ 342

Query: 373 NSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAV 432
           NSGT +LPHIFNAVILSTIISA NSN+YVGSR+MFGL+K+KLAPR    T K+GVP+++V
Sbjct: 343 NSGTPILPHIFNAVILSTIISAANSNVYVGSRIMFGLSKSKLAPRILSRTNKNGVPWVSV 402

Query: 433 LFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDD 492
           +FT  FGALA++E S+GG  AFNWLLNI GVAGFF+WL ISI+HVRF+Q LE+RGISRDD
Sbjct: 403 IFTGLFGALAYMETSTGGEAAFNWLLNITGVAGFFSWLFISISHVRFMQALEYRGISRDD 462

Query: 493 LPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLY 552
           LPFKA  MP LAYYA          QGFT+F P+F+G DF+AAYI            QL+
Sbjct: 463 LPFKAKFMPGLAYYAIFFMTLIIIIQGFTSFCPSFDGIDFLAAYISCFLFIAIWIVFQLW 522

Query: 553 FRCKLYWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
           FRC+L W +++V             WED  P TFWD+FW+VVA
Sbjct: 523 FRCRLIWKIEDVDIDTDRRDIEEVVWEDPPPVTFWDKFWNVVA 565

>YEL063C Chr5 complement(31694..33466) [1773 bp, 590 aa] {ON}
           CAN1Plasma membrane arginine permease, requires
           phosphatidyl ethanolamine (PE) for localization,
           exclusively associated with lipid rafts; mutation
           confers canavanine resistance
          Length = 590

 Score =  666 bits (1718), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/516 (64%), Positives = 373/516 (72%)

Query: 80  DQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVF 139
           D+G VQ+AEVKRELKQRH                  STPL NAGPVG+LI+YLFM ++ +
Sbjct: 75  DEGEVQNAEVKRELKQRHIGMIALGGTIGTGLFIGLSTPLTNAGPVGALISYLFMGSLAY 134

Query: 140 SVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQF 199
           SVTQSLGEMA                  P+ GAANGYMYWFSWAITFALELSVVGQ+IQF
Sbjct: 135 SVTQSLGEMATFIPVTSSFTVFSQRFLSPAFGAANGYMYWFSWAITFALELSVVGQVIQF 194

Query: 200 WTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGV 259
           WT  VPL+AWI I+W I+TIMN+FPVK+YGEFEFWVASIKV+AI+GFLIYC CMVCGAGV
Sbjct: 195 WTYKVPLAAWISIFWVIITIMNLFPVKYYGEFEFWVASIKVLAIIGFLIYCFCMVCGAGV 254

Query: 260 TGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 319
           TGPVGFRYWRNPG WGPGIIS    EGRFLGWVSSLINAAFT+QGTELVGITAGEAANPR
Sbjct: 255 TGPVGFRYWRNPGAWGPGIISKDKNEGRFLGWVSSLINAAFTFQGTELVGITAGEAANPR 314

Query: 320 KTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVL 379
           K+VPRAIKKV                  VP++DPKL          PFIIAI+NSGTKVL
Sbjct: 315 KSVPRAIKKVVFRILTFYIGSLLFIGLLVPYNDPKLTQSTSYVSTSPFIIAIENSGTKVL 374

Query: 380 PHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFG 439
           PHIFNAVIL+TIISA NSNIYVGSR++FGL+K KLAP++   TTK GVPYIAV  T+AFG
Sbjct: 375 PHIFNAVILTTIISAANSNIYVGSRILFGLSKNKLAPKFLSRTTKGGVPYIAVFVTAAFG 434

Query: 440 ALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAAL 499
           ALA++E S+GG K F WLLNI GVAGFFAWL ISI+H+RF+Q L++RGISRD+LPFKA L
Sbjct: 435 ALAYMETSTGGDKVFEWLLNITGVAGFFAWLFISISHIRFMQALKYRGISRDELPFKAKL 494

Query: 500 MPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYW 559
           MP LAYYA          QGFTAFAP FNG  F AAYI            Q  FRC+  W
Sbjct: 495 MPGLAYYAATFMTIIIIIQGFTAFAPKFNGVSFAAAYISIFLFLAVWILFQCIFRCRFIW 554

Query: 560 SLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
            + +V             WED  PKTFWD+FW+VVA
Sbjct: 555 KIGDVDIDSDRRDIEAIVWEDHEPKTFWDKFWNVVA 590

>CAGL0J08184g Chr10 (806631..808349) [1719 bp, 572 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
           or uniprot|P38971 Saccharomyces cerevisiae YNL270c ALP1
           or uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
          Length = 572

 Score =  646 bits (1667), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 319/522 (61%), Positives = 370/522 (70%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           ED       +++  +VKR LKQRH                  +TPL NAGPVG+L+AYLF
Sbjct: 51  EDLATEKDELLEHHDVKRSLKQRHIGMIALGGTIGTGLFIGIATPLANAGPVGALVAYLF 110

Query: 134 MATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVV 193
           M T+VFSVTQSLGEMA                  P++GAANGYMY+ SW  TFALELSVV
Sbjct: 111 MGTVVFSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGAANGYMYFLSWCFTFALELSVV 170

Query: 194 GQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCM 253
           GQIIQFWT  VPL+AWI I+W +LT  NMFPVKFYGEFEFW+ASIKV+A+MGFLIY LC+
Sbjct: 171 GQIIQFWTFKVPLAAWISIFWVLLTAFNMFPVKFYGEFEFWIASIKVLALMGFLIYSLCI 230

Query: 254 VCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAG 313
           VCGAG TGP+GFRYWRNPG  GPGIISS   E RFLGWVSSLINAAFTYQGTELVGITAG
Sbjct: 231 VCGAGKTGPIGFRYWRNPGAMGPGIISSNTGEARFLGWVSSLINAAFTYQGTELVGITAG 290

Query: 314 EAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQN 373
           EAANPRK VPRAI+KV                  VP++DPKL          PFII IQN
Sbjct: 291 EAANPRKAVPRAIRKVLIRILLFYIGSLFFIGLTVPYNDPKLTSTDSYVSSSPFIITIQN 350

Query: 374 SGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVL 433
           +GT+VLPHIFNAVIL+TIISAGNSN+YVGSR++F +AK  LAP++   TT  GVPY++VL
Sbjct: 351 AGTRVLPHIFNAVILTTIISAGNSNVYVGSRILFSMAKNGLAPKFLAKTTLQGVPYLSVL 410

Query: 434 FTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDL 493
             SAFG+L+++E+S+GGAKAFNWLLNI GVAGFFAWLLIS +HVRF+Q L+HRGISRDDL
Sbjct: 411 AISAFGSLSYMELSTGGAKAFNWLLNITGVAGFFAWLLISCSHVRFMQALKHRGISRDDL 470

Query: 494 PFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYF 553
           P+KA  MPWLAYYA          QGFT+FAP F+G DFVAAYI            Q+YF
Sbjct: 471 PYKALWMPWLAYYAIFFMVVIILIQGFTSFAPHFSGRDFVAAYISVGLFLVFWGFFQIYF 530

Query: 554 RCKLYWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
           RC++ W L++V             WED APKT WD+FWD VA
Sbjct: 531 RCRIIWKLEDVDIDTDRREIESVVWEDDAPKTLWDKFWDFVA 572

>TBLA0A05450 Chr1 complement(1345808..1347628) [1821 bp, 606 aa]
           {ON} Anc_1.83 YEL063C
          Length = 606

 Score =  643 bits (1659), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/521 (61%), Positives = 377/521 (72%), Gaps = 2/521 (0%)

Query: 75  DEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFM 134
           +E     GVV++A+VKRELK RH                  +TP++NAGPVGSLIAY+FM
Sbjct: 88  EEDIDATGVVEEAQVKRELKPRHIGMIALGGTIGTGLFIGIATPIQNAGPVGSLIAYIFM 147

Query: 135 ATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVG 194
            T+VFSVTQSLGEMA                     GAA GYMYWFSWAITFALELSVVG
Sbjct: 148 GTLVFSVTQSLGEMATFIPVTSSFTVFASRFVSDPFGAACGYMYWFSWAITFALELSVVG 207

Query: 195 QIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMV 254
           Q+I+FWT  VPL+AWI I+W ++ IMN FPVK YGEFEFWVASIKVIAI+GF+IYCLCMV
Sbjct: 208 QVIEFWTFKVPLAAWISIFWVLIVIMNFFPVKVYGEFEFWVASIKVIAIIGFIIYCLCMV 267

Query: 255 CGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGE 314
           CGAG+TGPVGFRYWR+PGPWGPGIIS    E RFLGWVSSLINAAFTYQGTELVGITAGE
Sbjct: 268 CGAGITGPVGFRYWRHPGPWGPGIISKDKNEARFLGWVSSLINAAFTYQGTELVGITAGE 327

Query: 315 AANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNS 374
           AANPRK+VPRAIKKVS                 VP++DPKL          PFIIAIQNS
Sbjct: 328 AANPRKSVPRAIKKVSVRILLFYILSLFFIGLLVPYNDPKLSSTDSYVSASPFIIAIQNS 387

Query: 375 GTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLF 434
           GTKVLPHIFNAVIL+TIISA NSN+YVGSR+++GL+  KLAP++F   T++GVP+IAVLF
Sbjct: 388 GTKVLPHIFNAVILTTIISAANSNVYVGSRILYGLSSAKLAPKFFQ-KTRNGVPFIAVLF 446

Query: 435 TSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLP 494
           T+AFGALA++E S+GG  AFNWLLNI GVAGFFAWL ISI+H+RF+QTL+HRG+SRDDLP
Sbjct: 447 TAAFGALAYMETSAGGQNAFNWLLNITGVAGFFAWLSISISHIRFMQTLKHRGMSRDDLP 506

Query: 495 FKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFR 554
           +KAALMP LAYY           QGFTAFAP F+ + F+ AYI            Q YFR
Sbjct: 507 YKAALMPGLAYYGAFFVTLIILIQGFTAFAPKFDSTAFLTAYISCFLFLFIYIVAQCYFR 566

Query: 555 CKLYWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
            +L+ +LD+V             WE+  P+TFWD+FW V+A
Sbjct: 567 TRLWRTLDDVDIDTDRRDIDTVIWEE-GPQTFWDKFWAVIA 606

>KNAG0C00790 Chr3 (138911..140650) [1740 bp, 579 aa] {ON} 
          Length = 579

 Score =  636 bits (1640), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 316/516 (61%), Positives = 364/516 (70%)

Query: 80  DQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVF 139
             G V DAEVKRELKQRH                  STPLK AGPVG+LI+Y+FM T+V+
Sbjct: 64  QTGYVHDAEVKRELKQRHIGMIALGATIGTGLFIGLSTPLKQAGPVGALISYIFMGTLVY 123

Query: 140 SVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQF 199
           SVTQSLGEMA                  PSIGAA GYMYWFSWA+TFALELSV+GQ+IQ+
Sbjct: 124 SVTQSLGEMATFIPVTSSFTVFAQRFLSPSIGAATGYMYWFSWAVTFALELSVIGQVIQY 183

Query: 200 WTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGV 259
           WT AVPL+AWI I+W ++T  NMFPVK+YGE EFW+A IKVIAI+GFL+YCLCMVCGAGV
Sbjct: 184 WTYAVPLAAWISIFWVVITAGNMFPVKYYGEVEFWIAFIKVIAIVGFLLYCLCMVCGAGV 243

Query: 260 TGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 319
           TGPVGFRYWRNPGPWGPGIIS    E RFLGWVSSLIN AFTYQGTELVGI+AGEAANPR
Sbjct: 244 TGPVGFRYWRNPGPWGPGIISKDKNEARFLGWVSSLINGAFTYQGTELVGISAGEAANPR 303

Query: 320 KTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVL 379
           K VPRAIKKV                  VP++D  L          PFIIAI+NSGT VL
Sbjct: 304 KAVPRAIKKVVFRILFFYIGSLFFIGLLVPYNDDALNNTDSYVASSPFIIAIKNSGTPVL 363

Query: 380 PHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFG 439
           PHIFNAVI  TI+SAGNSN+YVGSR++FGL+K KLAP+    TTK GVP+IAVL TS  G
Sbjct: 364 PHIFNAVIACTIVSAGNSNVYVGSRILFGLSKNKLAPKILSRTTKGGVPWIAVLVTSVVG 423

Query: 440 ALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAAL 499
           ALA++E S+GG  AFNWLLNI  VAGFF WL IS++H+RF+Q L++RGISRDDLPFKAAL
Sbjct: 424 ALAYMETSTGGQNAFNWLLNITAVAGFFTWLFISLSHIRFMQALKYRGISRDDLPFKAAL 483

Query: 500 MPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYW 559
           MP LAYYA          QGFTAFAP F+GSDF AAYI            Q+ FRC+   
Sbjct: 484 MPGLAYYASFLMFVIIIIQGFTAFAPKFSGSDFAAAYISIFLFIGIWCLFQIIFRCRFIH 543

Query: 560 SLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
            +++V             WED+ PKT WD+FW+++A
Sbjct: 544 KVEDVDIDTDRRDIEAVVWEDAEPKTVWDKFWNIIA 579

>NCAS0B08570 Chr2 (1644264..1645862) [1599 bp, 532 aa] {ON} 
          Length = 532

 Score =  620 bits (1598), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 313/512 (61%), Positives = 362/512 (70%), Gaps = 1/512 (0%)

Query: 84  VQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQ 143
           V+   V+RELKQRH                  STPL NAGPVG+LIAYLFMAT+ +SVTQ
Sbjct: 22  VEAETVRRELKQRHMGMIALGGTIGTGLFIGVSTPLMNAGPVGALIAYLFMATLAYSVTQ 81

Query: 144 SLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
           SLGEMA                  P+ GAANGYMYWFSW ITFALELSVVGQ+IQFWT A
Sbjct: 82  SLGEMATFIPVTSSFTVFSQRFVSPAFGAANGYMYWFSWCITFALELSVVGQVIQFWTFA 141

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPV 263
           VPL+AWI I+W +LT MNMFPVK+YGEFEFWVA +KV+AIMGFLIYC CMVCGAGVTGPV
Sbjct: 142 VPLAAWISIFWVLLTGMNMFPVKYYGEFEFWVALVKVVAIMGFLIYCFCMVCGAGVTGPV 201

Query: 264 GFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 323
           GFRYWR+PG +GPGII+    + RFLGWVSSLINAAFT+QGTELVGITAGEAANPRKTVP
Sbjct: 202 GFRYWRHPGAFGPGIIAKDKNQARFLGWVSSLINAAFTFQGTELVGITAGEAANPRKTVP 261

Query: 324 RAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLPHIF 383
           RAIKKV                  VP+DD KL          PFIIAI+NSGT VLPHIF
Sbjct: 262 RAIKKVVFRILFFYILSLFFIGLLVPYDDWKLTSTDSYVSASPFIIAIENSGTHVLPHIF 321

Query: 384 NAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAF 443
           NAVI++TIISAGNSNIYVGSR+M+GL+ ++LAP     TT+HGVP++AVL TS FGALA+
Sbjct: 322 NAVIVATIISAGNSNIYVGSRIMYGLSTSRLAPGILSRTTQHGVPWVAVLVTSLFGALAY 381

Query: 444 LEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWL 503
           +E S+GG KAFNWLLNI GVAGFF WL IS++H+RF+Q LE RGISRDDLPFKA  MP L
Sbjct: 382 METSTGGQKAFNWLLNITGVAGFFTWLFISLSHIRFMQALEMRGISRDDLPFKAKWMPGL 441

Query: 504 AYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYWSLDE 563
           AYY           QGFT+F P +NG DF+ AYI            Q +FRC+L W +++
Sbjct: 442 AYYGVFFMTLIIIIQGFTSFCP-WNGIDFLTAYISVFMFIAIWIAFQAWFRCRLIWRVED 500

Query: 564 VXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
           V             W +  P+ FWD+FW+VVA
Sbjct: 501 VDIDTDRRAVEEAVWIEQEPRGFWDKFWNVVA 532

>KAFR0D00700 Chr4 complement(120768..122492) [1725 bp, 574 aa] {ON} 
          Length = 574

 Score =  613 bits (1580), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 317/528 (60%), Positives = 370/528 (70%), Gaps = 6/528 (1%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           EDE  ++ G V DAEVKRELKQRH                  STPL+++GPVGSLIAY+F
Sbjct: 47  EDEEMLNSGSVHDAEVKRELKQRHIGMIALGGTIGTGLFIGISTPLEDSGPVGSLIAYIF 106

Query: 134 MATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVV 193
           + T+ ++VTQSLGEMA                  PSIGAA GYMYWFSWA+TFALELSVV
Sbjct: 107 VGTLTYAVTQSLGEMATFIPVTSSFTVFASRFLSPSIGAAVGYMYWFSWAVTFALELSVV 166

Query: 194 GQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCM 253
           GQI+ +WT AVP++AWI I+W ILT +NMFPVKFYGE EFWVA++KV+AI+GFLIYCLCM
Sbjct: 167 GQIVDYWTFAVPIAAWISIFWVILTALNMFPVKFYGEIEFWVAAVKVVAIVGFLIYCLCM 226

Query: 254 VCGAGVTGPVGFRYWRNPGPWGPGIISSQVA------EGRFLGWVSSLINAAFTYQGTEL 307
           VCGAGVTGPVGFRYWRNPGPWG G+ S+ V        GRFLGW +SLINAAFTYQGTEL
Sbjct: 227 VCGAGVTGPVGFRYWRNPGPWGDGLTSNGVEISKNKNTGRFLGWFNSLINAAFTYQGTEL 286

Query: 308 VGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPF 367
           VGITAGEAANPRKTVPRAIKKV                  VPFDDPKL          PF
Sbjct: 287 VGITAGEAANPRKTVPRAIKKVVFRILLFYIGSLFFIGLLVPFDDPKLSSDDSYVSSSPF 346

Query: 368 IIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGV 427
           IIAI+NSGTK+LP IFNA+IL TIISAGNSNIYVGSR++F LAKT LAP+    TTK GV
Sbjct: 347 IIAIENSGTKILPDIFNAIILITIISAGNSNIYVGSRILFSLAKTGLAPKILSRTTKKGV 406

Query: 428 PYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRG 487
           P+++VL T+ FG LA++E + GG   F+WL+NI  +AGF+AWL I I+H+RF+Q L+ RG
Sbjct: 407 PWVSVLATAVFGVLAYMETTQGGQTVFDWLVNITAIAGFWAWLFILISHIRFMQVLKFRG 466

Query: 488 ISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXX 547
           ISRDDLPFKA LMP LAYYA          QGFTAF PTF+ SDF AAYI          
Sbjct: 467 ISRDDLPFKANLMPGLAYYAVFCMVIIIIFQGFTAFTPTFDVSDFFAAYISVILFFLIWG 526

Query: 548 XXQLYFRCKLYWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
             QL+F+C+  W L++V             WED  PKTFWD+FW+VVA
Sbjct: 527 AFQLWFKCRWIWKLEDVDIDSNRRDVEKIIWEDPEPKTFWDKFWNVVA 574

>SAKL0C02684g Chr3 complement(251988..253754) [1767 bp, 588 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 588

 Score =  610 bits (1573), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 308/518 (59%), Positives = 355/518 (68%)

Query: 78  YVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATI 137
           Y+D+G VQDAEVKR LK RH                  S+PL +AGPVG+LIAY+FM TI
Sbjct: 71  YMDEGNVQDAEVKRALKPRHISMIALGGTIGTGLFIGISSPLADAGPVGALIAYMFMGTI 130

Query: 138 VFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQII 197
            + VTQSLGEMA                  P+ G ANGY+YWFSW ITFALELSVVGQII
Sbjct: 131 AYFVTQSLGEMATFIPVTSSFTVFTQRFLSPAFGVANGYLYWFSWCITFALELSVVGQII 190

Query: 198 QFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGA 257
           QFWT AVPL AWI I+W ILT  N+FPVK+YGE EFW+A IKV+AI+GF+IY   MVCGA
Sbjct: 191 QFWTFAVPLGAWIAIFWVILTTSNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGA 250

Query: 258 GVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 317
           G TGPVGFRYWRNPGPWGPGIIS  V EGRFLGWVSSLINAAFTYQGTELVGITAGE+ N
Sbjct: 251 GKTGPVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGESKN 310

Query: 318 PRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTK 377
           PR+TVPRAI KV                  VPF+DPKL          PF+IAI+NSGTK
Sbjct: 311 PRRTVPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYISSSPFVIAIENSGTK 370

Query: 378 VLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSA 437
           VLPHIFNAVILSTIISAGNSNIYVGSRV++GLAK KLAP+ F   TK GVPYI+VL T+A
Sbjct: 371 VLPHIFNAVILSTIISAGNSNIYVGSRVLYGLAKNKLAPKVFARATKDGVPYISVLGTAA 430

Query: 438 FGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKA 497
           FG LA+L +S+   K F+WLLNI  +AGFFAWL IS+AH+RF+Q L+ R +SR+DLPFKA
Sbjct: 431 FGFLAYLNLSNSAQKVFDWLLNITAIAGFFAWLFISLAHIRFMQVLKDRNMSRNDLPFKA 490

Query: 498 ALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKL 557
             MPW AYY+          QGFTAFAP FN S+F AAYI            Q+ FR + 
Sbjct: 491 KFMPWGAYYSAFFISLIIIIQGFTAFAPKFNVSNFFAAYISVFLFLAIWVVFQIRFRTRF 550

Query: 558 YWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
             + ++V             WE+  PK  WD+FW  +A
Sbjct: 551 ILTKNDVDIDTDRRDIDCIVWEEETPKNAWDKFWAAMA 588

>SAKL0C02662g Chr3 complement(249789..251435) [1647 bp, 548 aa] {ON}
           uniprot|Q875R1 Saccharomyces kluyveri CAN1 Plasma
           membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 548

 Score =  606 bits (1562), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 303/514 (58%), Positives = 353/514 (68%)

Query: 82  GVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSV 141
           G V++ +VKR LK RH                  STPL NAGPVG+LIAY+F+ T+ +SV
Sbjct: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYSV 94

Query: 142 TQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWT 201
           TQSLGEMA                  P++G+ANGY+YW SWAITFALELSVVGQIIQFWT
Sbjct: 95  TQSLGEMATFIPVTSSFTVFTQRFLSPALGSANGYLYWLSWAITFALELSVVGQIIQFWT 154

Query: 202 DAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTG 261
           DAVPL+AWI I+W ILTI N+FPVK+YGE EFW+A IKV+AI+GF+IY   MVCGAG TG
Sbjct: 155 DAVPLTAWIAIFWVILTISNLFPVKYYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214

Query: 262 PVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 321
           PVGFRYWRNPGPWGPGIIS  V EGRFLGWVSSLI+AAFTYQGTELVGITAGEAANPRKT
Sbjct: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274

Query: 322 VPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLPH 381
           VPRAI KV                  VPF+DPKL          PF+IAI+NSGTKVLPH
Sbjct: 275 VPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
           IFNAVILSTIISAGNSN+YVGSR+ + +A   LAP++   TTK G+PY AVL TS  G L
Sbjct: 335 IFNAVILSTIISAGNSNVYVGSRIAYSMAMNGLAPKYLTWTTKSGIPYAAVLTTSVLGFL 394

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
           A+LE SSG +  FNWLLNI  VAGFF W+LISI+H+RF+Q L+H+GISRDDLPFKA  MP
Sbjct: 395 AYLESSSGASAVFNWLLNITAVAGFFTWILISISHIRFMQALKHQGISRDDLPFKAKFMP 454

Query: 502 WLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYWSL 561
           W AYYA          QGFTAFAP F  SDF  AYI            Q++FR  L+   
Sbjct: 455 WGAYYAAFFIGVIIIIQGFTAFAPKFKVSDFFTAYISVMLFFVFWIGFQIWFRGPLFIKT 514

Query: 562 DEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
           +++             WE+  P+  W++FW  +A
Sbjct: 515 EDIDLDTDRREIDDVVWEEQKPRNLWEKFWAAIA 548

>NDAI0F04200 Chr6 (1016214..1017914) [1701 bp, 566 aa] {ON} 
          Length = 566

 Score =  604 bits (1557), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 300/508 (59%), Positives = 353/508 (69%)

Query: 88  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGE 147
           EVKR+L +RH                  + PL  +GPVGSLIAYLF+ T+V+SVTQSLGE
Sbjct: 59  EVKRDLSKRHIAMIALGGTIGTGLFLGIANPLMISGPVGSLIAYLFLGTVVYSVTQSLGE 118

Query: 148 MAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLS 207
           MA                  P++GAANGYMYWFSWA+TFALELSVVGQIIQFWT AVPL 
Sbjct: 119 MATFIPVTASFTIFSHRFLSPALGAANGYMYWFSWAMTFALELSVVGQIIQFWTFAVPLP 178

Query: 208 AWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVGFRY 267
           AWI I+W ILTI N+FPV+ YGE EFW+A +KV AI+GF+IYC C+VCGAG TGPVGFRY
Sbjct: 179 AWISIFWVILTISNLFPVRIYGEIEFWIAFLKVNAILGFIIYCFCIVCGAGKTGPVGFRY 238

Query: 268 WRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIK 327
           WRNPGPWG GIISS +AE RFLGW SSLINAAFT+QGTELVGITAGEAANPR+TVP+AI+
Sbjct: 239 WRNPGPWGTGIISSNIAEARFLGWASSLINAAFTFQGTELVGITAGEAANPRQTVPKAIR 298

Query: 328 KVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLPHIFNAVI 387
           KV                  VP+DD KL          PFIIAI+NSGTK+LPHIFN VI
Sbjct: 299 KVVFRILVFYILSLFFIGLLVPYDDVKLKSENSYVSSSPFIIAIENSGTKILPHIFNGVI 358

Query: 388 LSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLEVS 447
           L TIISAGNSN+Y+GSR++FGLAK    P+ F  TTK GVP  AV+FTS FGALAF+E S
Sbjct: 359 LVTIISAGNSNVYIGSRLLFGLAKNGTGPKLFAKTTKSGVPVFAVVFTSLFGALAFMETS 418

Query: 448 SGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAYYA 507
           +GG +AF WLLN+VGVAGFF+WLLIS AH+RF+Q L+ RGISR+DLPFKA  MP+LAYYA
Sbjct: 419 TGGDEAFQWLLNVVGVAGFFSWLLISFAHIRFMQCLQSRGISRNDLPFKAKFMPYLAYYA 478

Query: 508 XXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYWSLDEVXXX 567
                     QGFTAFAP F+  +F A+YI            QL+F+C+  W L ++   
Sbjct: 479 TIVMIIIIFFQGFTAFAPKFDVLNFFASYISVFLFFIFWGSFQLWFKCRYVWKLVDIDID 538

Query: 568 XXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
                     W+D+ P   W +FWD VA
Sbjct: 539 KDRREIEDRVWQDTTPANLWGKFWDFVA 566

>KNAG0C05920 Chr3 (1157993..1159792) [1800 bp, 599 aa] {ON} 
          Length = 599

 Score =  604 bits (1558), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/512 (57%), Positives = 359/512 (70%)

Query: 84  VQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQ 143
           V+   VKR LK RH                  + PL+NAGPVG+LIAY+F+ TI+FSVTQ
Sbjct: 88  VKHRSVKRALKPRHIAMIALGGTIGTGLFMGIAKPLRNAGPVGALIAYIFVGTIIFSVTQ 147

Query: 144 SLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
           SLGEM                   P+ GAANGYMYWFSWA+TFA+ELSV+G++IQFWT A
Sbjct: 148 SLGEMVTFIPVTSSFTVFSHRFLSPAFGAANGYMYWFSWAMTFAVELSVLGKVIQFWTTA 207

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPV 263
           VPL+AWIVI+WF+LT+ NMFPVK+YGE EFW+A +KV++++GFLI+CLC+  GAG  GP 
Sbjct: 208 VPLAAWIVIFWFLLTLSNMFPVKYYGEIEFWIAFLKVLSLVGFLIFCLCITSGAGPHGPF 267

Query: 264 GFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 323
           GFRYWR+PG WGPGII+   +E RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK VP
Sbjct: 268 GFRYWRDPGAWGPGIIAEDQSEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVP 327

Query: 324 RAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLPHIF 383
           +AIKKV                  VPF+DPKL          PFIIAIQNSG  +LP IF
Sbjct: 328 KAIKKVILRILFFYVGSLFFIGMLVPFNDPKLTSATSFVSSSPFIIAIQNSGVSLLPSIF 387

Query: 384 NAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAF 443
           N VIL TIISAGNSN+YVGSR++FGLA + LAP++F  TTK GVP++AVLFTS FG+LAF
Sbjct: 388 NGVILITIISAGNSNVYVGSRILFGLAHSNLAPQFFTRTTKTGVPFVAVLFTSLFGSLAF 447

Query: 444 LEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWL 503
           LE+++ G K FNWLL+IV +AGFFAWLLIS++H+RF++ LE+RGISR+ LPFKA  MPWL
Sbjct: 448 LELTTDGDKVFNWLLSIVAIAGFFAWLLISLSHIRFMKALEYRGISRNSLPFKAIFMPWL 507

Query: 504 AYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYWSLDE 563
           AYYA          QGFTAFAP FN SDFVA+YI            Q   +C+++W +++
Sbjct: 508 AYYATAFIILIILIQGFTAFAPRFNVSDFVASYISLLLFVIIWGVFQAMKKCRIFWKVED 567

Query: 564 VXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
           +             WED +PKTFW + W  +A
Sbjct: 568 IDLDSDRKDIEDIRWEDDSPKTFWTKVWQTLA 599

>KLLA0C02343g Chr3 complement(203552..205297) [1746 bp, 581 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 581

 Score =  600 bits (1546), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 304/525 (57%), Positives = 353/525 (67%), Gaps = 2/525 (0%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           D    +  +G +  AEVKR LK RH                  S PL NAGPVGSLIA++
Sbjct: 57  DSSRMFDPEGSIGQAEVKRALKPRHVSMIALGGTIGTGLFISISGPLWNAGPVGSLIAFM 116

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
            + T+ +SVTQSLGEMA                  P++GAANGYMYWFSWAITFALELS+
Sbjct: 117 LIGTLAYSVTQSLGEMATFIPVTSSFTVFSQRFISPAVGAANGYMYWFSWAITFALELSI 176

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
           VGQIIQ+WTDAVPL AWI I+W +L   NMFPVK+YGEFEFWVASIKVIAI+GFLIY LC
Sbjct: 177 VGQIIQYWTDAVPLEAWIAIFWVLLVSFNMFPVKWYGEFEFWVASIKVIAIIGFLIYSLC 236

Query: 253 MVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITA 312
           MVCGAG  GP+GFRYWR PGPWG GII+  V + RFLGWVSSLI+AAFTYQGTELVGITA
Sbjct: 237 MVCGAGPEGPIGFRYWRKPGPWGNGIIAKNVNKARFLGWVSSLISAAFTYQGTELVGITA 296

Query: 313 GEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX--XXXXXXPFIIA 370
           GE  NPRK VPRAI KV                  VP++DPKL            PF+IA
Sbjct: 297 GETKNPRKAVPRAINKVFFRILIFYIGSLFFIGLLVPYNDPKLEGSDNGSYIAQSPFLIA 356

Query: 371 IQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYI 430
           I N  T VLPHIFNAVIL+TIISAGNSN+YVGSR++FGL+K  LAP++F  TTKHGVP+I
Sbjct: 357 ILNCRTPVLPHIFNAVILTTIISAGNSNVYVGSRILFGLSKNNLAPKFFSKTTKHGVPFI 416

Query: 431 AVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISR 490
           AVL T+ FG LA+L VS+   + F+WLLNI  +AGF  WLLISI+H+RF+QTL+HRGISR
Sbjct: 417 AVLITAVFGFLAYLNVSNDAQEVFDWLLNITAIAGFITWLLISISHIRFMQTLKHRGISR 476

Query: 491 DDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQ 550
           DDLP+KA  MP+ AYYA          QGFTAFAP FN SDF AAYI            Q
Sbjct: 477 DDLPYKAKFMPYAAYYAAFFITVIIIIQGFTAFAPHFNVSDFFAAYISVFLFFIVWAIFQ 536

Query: 551 LYFRCKLYWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
             +R KL+ +LDEV             WE+  PK  W++FW V A
Sbjct: 537 TIYRTKLFRTLDEVDIDSDRRDIDVIIWEEEEPKNLWEKFWAVAA 581

>YNL270C Chr14 complement(135940..137661) [1722 bp, 573 aa] {ON}
           ALP1Arginine transporter; expression is normally very
           low and it is unclear what conditions would induce
           significant expression
          Length = 573

 Score =  597 bits (1540), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 305/559 (54%), Positives = 368/559 (65%), Gaps = 8/559 (1%)

Query: 45  YETGSSSIV-----VDXXXXXXXXXXXXXXXXXDEDE--PYVDQGVVQDAEVKRELKQRH 97
           YE  SSSI+     VD                  ED+     +    +  EVKR+LKQRH
Sbjct: 15  YEINSSSIIKEEEFVDEQYSGENVTKAITTERKVEDDAAKETESSPQERREVKRKLKQRH 74

Query: 98  XXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEMAXXXXXXXX 157
                               PL +AGPVG+LI+YLFM T+++SVTQSLGEM         
Sbjct: 75  IGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGEMVTFIPVTSS 134

Query: 158 XXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLSAWIVIWWFIL 217
                     P++GA NGYMYW SW  TFALELSV+G++IQ+WT+AVPL+AWIVI+W +L
Sbjct: 135 FSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGKVIQYWTEAVPLAAWIVIFWCLL 194

Query: 218 TIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVT-GPVGFRYWRNPGPWGP 276
           T MNMFPVK+YGEFEF +ASIKVIA++GF+I+  C+VCGAG + GP+GFRYWRNPG WGP
Sbjct: 195 TSMNMFPVKYYGEFEFCIASIKVIALLGFIIFSFCVVCGAGQSDGPIGFRYWRNPGAWGP 254

Query: 277 GIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKKVSXXXXXX 336
           GIISS   EGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK +PRAIKKV       
Sbjct: 255 GIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKALPRAIKKVVVRILVF 314

Query: 337 XXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLPHIFNAVILSTIISAGN 396
                      VP++DPKL          PF+I+I+NSGTKVLP IFNAV+L TI+SAGN
Sbjct: 315 YILSLFFIGLLVPYNDPKLDSDGIFVSSSPFMISIENSGTKVLPDIFNAVVLITILSAGN 374

Query: 397 SNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNW 456
           SN+Y+GSRV++ L+K  LAPR+    T+ GVPY +VL TS FG LAFLEVS+G  KAFNW
Sbjct: 375 SNVYIGSRVLYSLSKNSLAPRFLSNVTRGGVPYFSVLSTSVFGFLAFLEVSAGSGKAFNW 434

Query: 457 LLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAYYAXXXXXXXXX 516
           LLNI GVAGFFAWLLIS +H+RF+Q +  RGISRDDLP+KA +MP+LAYYA         
Sbjct: 435 LLNITGVAGFFAWLLISFSHIRFMQAIRKRGISRDDLPYKAQMMPFLAYYASFFIALIVL 494

Query: 517 XQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYWSLDEVXXXXXXXXXXXX 576
            QGFTAFAPTF   DFVAAYI            Q++F+C+L W L ++            
Sbjct: 495 IQGFTAFAPTFQPIDFVAAYISIFLFLAIWLSFQVWFKCRLLWKLQDIDIDSDRRQIEEL 554

Query: 577 XWEDSAPKTFWDRFWDVVA 595
            W +   KT W R WDV++
Sbjct: 555 VWIEPECKTRWQRVWDVLS 573

>Smik_14.67 Chr14 complement(114969..116690) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  595 bits (1533), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/512 (57%), Positives = 353/512 (68%), Gaps = 1/512 (0%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           +  EVKR+LKQRH                    PL +AGPVG+LI+YLFM T+++SVTQS
Sbjct: 62  KGGEVKRKLKQRHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQS 121

Query: 145 LGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAV 204
           LGEMA                  P++GA NGYMYW SW  TFALELSV+GQIIQ+WTDAV
Sbjct: 122 LGEMATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTDAV 181

Query: 205 PLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTG-PV 263
           PL AWIVI+W +LT+MNMFPVK+YGEFEF +ASIKVIA++GF+ +  C+VCGAG +G P+
Sbjct: 182 PLVAWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVIALLGFIFFSFCIVCGAGQSGGPI 241

Query: 264 GFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 323
           GFRYWRNPG WGPGIIS    EGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR+ VP
Sbjct: 242 GFRYWRNPGAWGPGIISKNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRRAVP 301

Query: 324 RAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLPHIF 383
           RAIKKV                  VP++DPKL          PF+I+I+NSGTKVLP IF
Sbjct: 302 RAIKKVVVRILVFYILSLFFIGLLVPYNDPKLDSEGTFVSSSPFMISIENSGTKVLPDIF 361

Query: 384 NAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAF 443
           NAV+L TI+SAGNSN+Y+GSRV++ L+K  LAPR+    TK GVPY AVL TSAFG LAF
Sbjct: 362 NAVVLITILSAGNSNVYIGSRVLYSLSKNSLAPRFLSNVTKGGVPYFAVLSTSAFGFLAF 421

Query: 444 LEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWL 503
           LE S+G  K FNWLLNI GVAGFFAWLLIS++H+RF+Q ++ RGISRDDLP++A +MP+L
Sbjct: 422 LETSAGSGKVFNWLLNITGVAGFFAWLLISLSHIRFMQAIKKRGISRDDLPYRARMMPFL 481

Query: 504 AYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYWSLDE 563
           AYYA          QGFTAFAPTF   DF+AAYI            Q++F+C+  W L +
Sbjct: 482 AYYASFFIALIVLIQGFTAFAPTFQPIDFIAAYISVFLFIAIWLLFQVWFKCRFVWKLQD 541

Query: 564 VXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
           V             W +   KT W   WD+++
Sbjct: 542 VDIDSDRRDIEEQVWIEPECKTRWQHVWDILS 573

>SAKL0C02640g Chr3 complement(247651..249297) [1647 bp, 548 aa] {ON}
           highly similar to uniprot|Q875R1 Saccharomyces kluyveri
           CAN1 and similar to YEL063C uniprot|P04817 Saccharomyces
           cerevisiae YEL063C CAN1 Plasma membrane arginine
           permease requires phosphatidyl ethanolamine (PE) for
           localization exclusively associated with lipid rafts
           mutation confers canavanine resistance
          Length = 548

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 295/514 (57%), Positives = 349/514 (67%)

Query: 82  GVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSV 141
           G V++ +VKR LK RH                  STPL NAGPVG+LIAY+F+ T+ + V
Sbjct: 35  GSVKETQVKRALKPRHISMIALGGTIGTGLFISISTPLSNAGPVGALIAYMFIGTLAYMV 94

Query: 142 TQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWT 201
           +QSLGEMA                  P++GAANGYMY+ SW+ITFALELSVVGQ+IQFWT
Sbjct: 95  SQSLGEMATFIPVTSSFMVFTQRFLSPALGAANGYMYFLSWSITFALELSVVGQVIQFWT 154

Query: 202 DAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTG 261
           DAVPL+AWI+I W +L   N+ PVKFYGE EFW+A IKV+AI+GF+IY   MVCGAG TG
Sbjct: 155 DAVPLTAWIIILWVVLVSANLAPVKFYGEVEFWIACIKVLAIVGFIIYAFIMVCGAGKTG 214

Query: 262 PVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 321
           PVGFRYWRNPGPWGPGIIS  V EGRFLGWVSSLI+AAFTYQGTELVGITAGEAANPRKT
Sbjct: 215 PVGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLISAAFTYQGTELVGITAGEAANPRKT 274

Query: 322 VPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLPH 381
           VPRAI KV                  VPF+DPKL          PF+IAI+NSGTKVLPH
Sbjct: 275 VPRAINKVFFRILFFYILSLLFIGLLVPFNDPKLKSEDSYISSSPFVIAIENSGTKVLPH 334

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
           IFNAVILSTIISAGNS++Y+ SRV++ +    LAP++   TTK G+PY AVL TS  G L
Sbjct: 335 IFNAVILSTIISAGNSDVYISSRVLYSMGLNGLAPKYLTWTTKSGIPYAAVLTTSLVGFL 394

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
           A+LE S G +  F+WLLNI  VAGFFAW+LIS+AH+RF+Q L+H+GISRDDLPFKA  MP
Sbjct: 395 AYLESSHGASVVFDWLLNITAVAGFFAWMLISVAHIRFMQALKHQGISRDDLPFKAKFMP 454

Query: 502 WLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYWSL 561
           W AYYA          QGFTAFAP FN SDF  AY+            Q++FR  L+   
Sbjct: 455 WGAYYAAFFIGVIIIIQGFTAFAPKFNVSDFFTAYVSVILFFAVWIGFQIWFRGPLFKKT 514

Query: 562 DEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
           +++             WE+  PK  W++FW  VA
Sbjct: 515 EDIDLDTDRREIDNDVWEEDEPKNLWEKFWSAVA 548

>Skud_14.70 Chr14 complement(124390..126111) [1722 bp, 573 aa] {ON}
           YNL270C (REAL)
          Length = 573

 Score =  591 bits (1523), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 294/509 (57%), Positives = 351/509 (68%), Gaps = 1/509 (0%)

Query: 88  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGE 147
           EV+R+LK+RH                    PL +AGPVG+LI+YLFM T+++SVTQSLGE
Sbjct: 65  EVQRKLKERHIGMIALGGTIGTGLIIGIGPPLAHAGPVGALISYLFMGTVIYSVTQSLGE 124

Query: 148 MAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLS 207
           MA                  P++GA NGYMYW SW  TFALELSV+GQIIQ+WT AVPL+
Sbjct: 125 MATFIPVTSSFSVFAQRFLSPALGATNGYMYWLSWCFTFALELSVLGQIIQYWTHAVPLA 184

Query: 208 AWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGV-TGPVGFR 266
           AWIVI+W +LT+MNMFPVK+YGEFEF +ASIKVI ++GF+I+  C+VCGAG   GP+GFR
Sbjct: 185 AWIVIFWCLLTLMNMFPVKYYGEFEFCIASIKVITLLGFIIFSFCIVCGAGQPDGPIGFR 244

Query: 267 YWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAI 326
           YWRNPG WGPGIISS   EGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK VPRAI
Sbjct: 245 YWRNPGAWGPGIISSNKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKAVPRAI 304

Query: 327 KKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLPHIFNAV 386
           KKV                  VP++DPKL          PF+I+I+NSGTKVLP IFNAV
Sbjct: 305 KKVVIRILVFYILSLFFIGLLVPYNDPKLDSDGTFVSASPFMISIENSGTKVLPDIFNAV 364

Query: 387 ILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLEV 446
           +L TI SAGNSN+Y+GSRV++ L+K  LAP+     T+ GVPY+AVL TS FG LAFLE 
Sbjct: 365 VLITIFSAGNSNVYIGSRVLYSLSKNSLAPKCLSNVTRGGVPYLAVLLTSLFGFLAFLET 424

Query: 447 SSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAYY 506
           S+G  KAFNWLLNI GVAGFFAWLLIS +H+RF+Q ++ RGISRDDLP+KA +MP+LAYY
Sbjct: 425 SAGSGKAFNWLLNITGVAGFFAWLLISFSHIRFMQAIKKRGISRDDLPYKARMMPFLAYY 484

Query: 507 AXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYWSLDEVXX 566
           A          QGFTAFAPTF   DFVAAYI            QL+F+C+L   L ++  
Sbjct: 485 ASFFIALIVLIQGFTAFAPTFQPVDFVAAYISVFLFAIIWLSFQLWFKCRLICKLQDIDI 544

Query: 567 XXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
                      W +   KT W R WD+++
Sbjct: 545 DSDRREIEEQVWIEPECKTRWQRVWDILS 573

>NCAS0A00600 Chr1 complement(109246..110880) [1635 bp, 544 aa] {ON} 
          Length = 544

 Score =  587 bits (1513), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 301/520 (57%), Positives = 361/520 (69%), Gaps = 3/520 (0%)

Query: 79  VDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIV 138
           +D    +  +VKRELK+RH                  + PL  AGP+G+LIAYLFM T+V
Sbjct: 25  LDDDQEKQQDVKRELKKRHISMIALGGTIGTGLFLGIARPLIIAGPIGALIAYLFMGTVV 84

Query: 139 FSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQ 198
           FSVTQSLGEM                   P+ GAANGYMYWFSWA+TFALELSVVGQIIQ
Sbjct: 85  FSVTQSLGEMCTFIPVTASFTVFAQRFLSPAFGAANGYMYWFSWAMTFALELSVVGQIIQ 144

Query: 199 FWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAG 258
           FWT AVPL+AWI I W +LTI N+FPV+ YGE EFW+AS+KV+AI+GF+IY +C++CGAG
Sbjct: 145 FWTMAVPLAAWISIVWVLLTISNLFPVRIYGEIEFWIASVKVLAILGFIIYGICIICGAG 204

Query: 259 VTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 318
           VTGPVGFRYW+NPGPWG GIISS V E RF GWVSSLINAAFT+QGTELVGITAGE   P
Sbjct: 205 VTGPVGFRYWKNPGPWGMGIISSNVNEARFFGWVSSLINAAFTFQGTELVGITAGEVQEP 264

Query: 319 RKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKV 378
           RKTVP+AIKKV                  VP++DPKL          PFII IQN+GTK+
Sbjct: 265 RKTVPKAIKKVVFRILVFYIGSLLVIGLLVPYNDPKLQSNDSYVSSSPFIITIQNAGTKI 324

Query: 379 LPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAF 438
           LPHIFNAVIL TIISAGNSN+Y+GSR+++GLAK K AP++F  T+K GVPY+ VLFTS F
Sbjct: 325 LPHIFNAVILITIISAGNSNVYIGSRILYGLAKNKAAPKFFTNTSKAGVPYVTVLFTSMF 384

Query: 439 GALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAA 498
           G+LA++E ++GG KAF WLLNIVGVAGFFAWLLIS +H+RF++ L+ RGISR+DLP+KA 
Sbjct: 385 GSLAYMETTTGGDKAFTWLLNIVGVAGFFAWLLISCSHIRFMKALKQRGISRNDLPYKAM 444

Query: 499 LMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLY 558
           LMPWLAYYA          QGFT+FAP F  ++F AAYI            Q++F+C+L 
Sbjct: 445 LMPWLAYYAVFFMVIIIVIQGFTSFAPKFKVANFFAAYISVFLFIIFWVAFQIWFKCRLV 504

Query: 559 WSLDEVXXXXXXXXXXXXXWEDSAP---KTFWDRFWDVVA 595
           W L +V             W D      K +WDRFW+ VA
Sbjct: 505 WKLQDVDLDTDRRDIEEEVWSDDVEDKNKNWWDRFWNYVA 544

>Suva_14.73 Chr14 complement(130474..131967) [1494 bp, 497 aa] {ON}
           YNL268W (REAL)
          Length = 497

 Score =  583 bits (1502), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 293/479 (61%), Positives = 342/479 (71%), Gaps = 1/479 (0%)

Query: 118 PLKNAGPVGSLIAYLFMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYM 177
           PL +AGPVG+LI+Y+FM T+++SVTQSLGEMA                  P++GA NGYM
Sbjct: 19  PLAHAGPVGALISYIFMGTVIYSVTQSLGEMATFIPVTSSFSVFAQRFLSPALGATNGYM 78

Query: 178 YWFSWAITFALELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVAS 237
           YW SW  TFALELSV+GQIIQ+WTDAVPLSAWIVI+W +LT+MNMFPVK+YGEFEF +AS
Sbjct: 79  YWLSWCFTFALELSVLGQIIQYWTDAVPLSAWIVIFWCLLTLMNMFPVKYYGEFEFCIAS 138

Query: 238 IKVIAIMGFLIYCLCMVCGAGV-TGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLI 296
           IKVIA++GF+IY  CMVCGAG   GP+GFRYWRNPG WGPGIISS   EGRFLGWVSSLI
Sbjct: 139 IKVIALLGFIIYSFCMVCGAGQPDGPIGFRYWRNPGAWGPGIISSDKNEGRFLGWVSSLI 198

Query: 297 NAAFTYQGTELVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX 356
           NAAFTYQGTELVGITAGEAANPRK VPRAIKKV                  VP++DPKL 
Sbjct: 199 NAAFTYQGTELVGITAGEAANPRKAVPRAIKKVVVRILVFYIMSLFFIGLLVPYNDPKLD 258

Query: 357 XXXXXXXXXPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAP 416
                    PF+I+I+NSGTKVLP IFNAV+L TI+SAGNSN+Y+GSRV++ L+K  LAP
Sbjct: 259 SDGSFVSASPFMISIENSGTKVLPDIFNAVVLITIVSAGNSNVYIGSRVLYSLSKNDLAP 318

Query: 417 RWFGITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAH 476
           R+  I TK GVPY AVL TS FG LAFLE S+G  KAFNWLLNI GVAGFFAWLLIS +H
Sbjct: 319 RFLSIVTKGGVPYFAVLATSVFGFLAFLETSAGSGKAFNWLLNITGVAGFFAWLLISFSH 378

Query: 477 VRFIQTLEHRGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAY 536
           +RF+Q +  RGISR+DLP+KA +MP+LAYYA          QGFTAFAP+F   DFVAAY
Sbjct: 379 IRFMQAISKRGISRNDLPYKARMMPYLAYYASFFIALIVLIQGFTAFAPSFQPVDFVAAY 438

Query: 537 IXXXXXXXXXXXXQLYFRCKLYWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
           I            QL+F+C +   L +V             W +   KT W   WDV+A
Sbjct: 439 ISVFLFVAIWFSFQLWFKCPIILKLQDVDIDSDRREIEEQVWIEPLRKTKWQCVWDVLA 497

>KLTH0F02398g Chr6 complement(202746..204413) [1668 bp, 555 aa] {ON}
           similar to uniprot|P04817 Saccharomyces cerevisiae
           YEL063C CAN1 Plasma membrane arginine permease requires
           phosphatidyl ethanolamine (PE) for localization
           exclusively associated with lipid rafts mutation confers
           canavanine resistance
          Length = 555

 Score =  582 bits (1501), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/522 (55%), Positives = 350/522 (67%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           E +  +D    Q+  ++R LK RH                  + PL++AGPVGSLI+YLF
Sbjct: 34  EQQSQIDTASSQERGIQRALKPRHVSMIALGGTIGTGLFVGIANPLRDAGPVGSLISYLF 93

Query: 134 MATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVV 193
           M ++ F VTQSLGEMA                  P++GAANGYMY FSW ITFALELS+V
Sbjct: 94  MGSLAFFVTQSLGEMATFIPVASSFTVFTRRFLSPALGAANGYMYCFSWCITFALELSIV 153

Query: 194 GQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCM 253
           G+IIQ+WT  VP +AWI+I+W  +++ N+  VKFYGEF+FW+A IKVIAI+GFLIYCLCM
Sbjct: 154 GEIIQYWTLGVPNAAWIIIFWVPISLSNLVSVKFYGEFQFWIALIKVIAIVGFLIYCLCM 213

Query: 254 VCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAG 313
           VCGAG TGPVGFRYWRNPGPWG GIIS   +EGRFLGWVSSL+NAAFTYQGTELVG++AG
Sbjct: 214 VCGAGKTGPVGFRYWRNPGPWGDGIISKSKSEGRFLGWVSSLVNAAFTYQGTELVGVSAG 273

Query: 314 EAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQN 373
           E+ANPRKTVP+AI+KV                  VPF+DPKL          PFIIAIQN
Sbjct: 274 ESANPRKTVPKAIRKVFLRILLFYVGSLFFIGLLVPFNDPKLDSTANYSASSPFIIAIQN 333

Query: 374 SGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVL 433
           SGT+ LP IFNAVIL+TIISA NSN+YVGSRV++GLAK  LAP+  G   +HGVPYI V 
Sbjct: 334 SGTRALPDIFNAVILTTIISAANSNVYVGSRVLYGLAKEGLAPKIIGRINRHGVPYICVG 393

Query: 434 FTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDL 493
             S FG L +L VSSG AKAF+WLLNI  +AGFFAWL IS+ H+RF+Q L+++GISRDDL
Sbjct: 394 IVSLFGFLGYLSVSSGSAKAFDWLLNITAIAGFFAWLFISLCHIRFMQALKYQGISRDDL 453

Query: 494 PFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYF 553
           PFKA LMPW AYYA          QGFTAFAP FN S+F AAY+            Q+ F
Sbjct: 454 PFKAKLMPWGAYYAAFFILLIIIIQGFTAFAPKFNVSNFFAAYVSVFLFIAVWVIFQVIF 513

Query: 554 RCKLYWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
           + +L   +++V             WED  P   W +FW  +A
Sbjct: 514 KSRLIHKVEDVDIDSDRREIEAEVWEDDEPTNLWGKFWAAMA 555

>Kpol_2000.64 s2000 complement(130912..132744) [1833 bp, 610 aa]
           {ON} complement(130912..132744) [1833 nt, 611 aa]
          Length = 610

 Score =  583 bits (1503), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/523 (54%), Positives = 348/523 (66%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           D++E   ++   QD  VKR LKQRH                  +TPL NAGPVGSLIAY+
Sbjct: 88  DDEESDTEEAQYQDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYI 147

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
           FM ++V+ VTQSLGEMA                  P+ G ANGYMYWF+WAIT+A+E+SV
Sbjct: 148 FMGSVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISV 207

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
           +GQ+IQ+WT AVPL+AWI I+W I+T+MN FPVK YGEFEFW+ASIKV+AIMG+LIY L 
Sbjct: 208 IGQVIQYWTKAVPLAAWIGIFWVIVTLMNFFPVKVYGEFEFWIASIKVLAIMGYLIYALI 267

Query: 253 MVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITA 312
           +VCG    GP+GFRYWRNPGPWGPGIIS +  E RFLGWVSSLINAAFTYQGTELVGITA
Sbjct: 268 IVCGGSHQGPIGFRYWRNPGPWGPGIISDKTGEARFLGWVSSLINAAFTYQGTELVGITA 327

Query: 313 GEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQ 372
           GEAANPRK+VPRAI KV                  VPF+D +L          PF+I+IQ
Sbjct: 328 GEAANPRKSVPRAINKVVFRIALFYIMSLFFIGLLVPFNDDRLANDSAVIASSPFVISIQ 387

Query: 373 NSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAV 432
           N+GT+ LP IFNAV+L TIISA NSN+YVGSRV++ LA T  AP+ F   TK+GVPY+ V
Sbjct: 388 NAGTRALPDIFNAVVLLTIISAANSNVYVGSRVLYALALTGNAPKIFSYVTKYGVPYMGV 447

Query: 433 LFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDD 492
           + T+A G LAFL V++    AFNWL+NI  +AG  AWL IS++H+RF+Q L++RGISRDD
Sbjct: 448 ICTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKYRGISRDD 507

Query: 493 LPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLY 552
           LPFKA LMPW AYYA          QGF AF P F+ S F  +YI            QLY
Sbjct: 508 LPFKAKLMPWGAYYASFFVTVIIFIQGFQAFTPKFDVSTFFTSYISLILLAVLFSGCQLY 567

Query: 553 FRCKLYWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
           +RC+  W ++++             WE+  PK  W++FW  VA
Sbjct: 568 YRCRFIWKVEDIDIDSDRREIEAIIWEEDEPKNLWEKFWAWVA 610

>Kwal_33.13401 s33 complement(206763..208442) [1680 bp, 559 aa] {ON}
           YEL063C (CAN1) - arginine permease [contig 118] FULL
          Length = 559

 Score =  579 bits (1492), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/507 (56%), Positives = 349/507 (68%)

Query: 89  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEM 148
           V+R+LK RH                   +PL+NAGPVG+LI+YLFM +I + VTQSLGEM
Sbjct: 53  VQRQLKPRHVSMIALGGTIGTGLFIGIESPLRNAGPVGALISYLFMGSIAYCVTQSLGEM 112

Query: 149 AXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLSA 208
           A                    +GAANGYMY FSW++T+ALELS+VGQII++WT AVP +A
Sbjct: 113 ATFIPVTSSFTVFTRRFLSLPLGAANGYMYCFSWSVTYALELSIVGQIIEYWTSAVPNAA 172

Query: 209 WIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVGFRYW 268
           WI I+W  +T+ N+ PVKFYGEF+FW+A IKV+AI+GFL+YCLCMVCGAG TGPVGFRYW
Sbjct: 173 WIAIFWVPITLSNLVPVKFYGEFQFWIALIKVVAIIGFLVYCLCMVCGAGKTGPVGFRYW 232

Query: 269 RNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIKK 328
           RNPGPWG GIIS  + EGRFLGWVSSL+NAAFTYQGTELVGI+AGE+ANPRKTVP+AI K
Sbjct: 233 RNPGPWGDGIISHDIHEGRFLGWVSSLVNAAFTYQGTELVGISAGESANPRKTVPKAINK 292

Query: 329 VSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLPHIFNAVIL 388
           V                  VPF+D KL          PFIIAIQNSGTK+LP IFNAVIL
Sbjct: 293 VFFRILLFYVGSLFFIGLLVPFNDEKLTSSDSYSAGSPFIIAIQNSGTKILPDIFNAVIL 352

Query: 389 STIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLEVSS 448
           +TIISA NSN+YVGSRV++GLAK +LAPR+F  T +HGVP +AVLF + FG L +L VS+
Sbjct: 353 ATIISAANSNVYVGSRVLYGLAKERLAPRFFARTNRHGVPDVAVLFVANFGFLGYLSVSN 412

Query: 449 GGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAYYAX 508
           G +KAF+WLLNI  +AGFF+WL IS+ HVRF+Q L+ +GISRDDLPFKA LMPW AYY+ 
Sbjct: 413 GASKAFDWLLNITAIAGFFSWLFISLCHVRFMQALKLQGISRDDLPFKAKLMPWGAYYSA 472

Query: 509 XXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYWSLDEVXXXX 568
                    QGFT+ APTFN S+F AAYI            Q ++R ++   ++ V    
Sbjct: 473 FFITLIIIIQGFTSLAPTFNVSNFFAAYISVFMFLVIWAVFQCWYRTRIIHRIEHVDIDS 532

Query: 569 XXXXXXXXXWEDSAPKTFWDRFWDVVA 595
                    W+++ P T W +FW  +A
Sbjct: 533 DRREVDAQQWDNTEPTTLWGKFWAAMA 559

>YNL268W Chr14 (138550..140385) [1836 bp, 611 aa] {ON}  LYP1Lysine
           permease; one of three amino acid permeases (Alp1p,
           Can1p, Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 611

 Score =  578 bits (1491), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 285/523 (54%), Positives = 349/523 (66%), Gaps = 4/523 (0%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           +EDE   ++   +D  VKR LKQRH                  STPL NAGPVGSLIAY+
Sbjct: 93  NEDE---EEAHYEDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYI 149

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
           FM TIV+ VTQSLGEMA                  P+ G +NGYMYWF+WAIT+A+E+SV
Sbjct: 150 FMGTIVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSV 209

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
           +GQ+I++WTD VPL+AWI I+W I+T+MN FPVK YGEFEFWVAS+KV+AIMG+LIY L 
Sbjct: 210 IGQVIEYWTDKVPLAAWIAIFWVIITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALI 269

Query: 253 MVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITA 312
           +VCG    GP+GFRYWRNPG WGPGIISS  +EGRFLGWVSSLINAAFTYQGTELVGITA
Sbjct: 270 IVCGGSHQGPIGFRYWRNPGAWGPGIISSDKSEGRFLGWVSSLINAAFTYQGTELVGITA 329

Query: 313 GEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQ 372
           GEAANPRKTVPRAI KV                  VP++D +L          PF+I+IQ
Sbjct: 330 GEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPYNDSRLSASSAVIASSPFVISIQ 389

Query: 373 NSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAV 432
           N+GT  LP IFNAV+L T++SA NSN+YVGSRV++ LA+T  AP+ FG  T+ GVPY+ V
Sbjct: 390 NAGTYALPDIFNAVVLITVVSAANSNVYVGSRVLYSLARTGNAPKQFGYVTRQGVPYLGV 449

Query: 433 LFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDD 492
           + T+A G LAFL V++    AFNWL+NI  +AG  AWL IS+AH+RF+Q L+HRGISRDD
Sbjct: 450 VCTAALGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKHRGISRDD 509

Query: 493 LPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLY 552
           LPFKA LMP+ AYYA          QGF AF P F  S+F  +YI            Q+Y
Sbjct: 510 LPFKAKLMPYGAYYAAFFVTVIIFIQGFQAFCP-FKVSEFFTSYISLILLAVVFIGCQIY 568

Query: 553 FRCKLYWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
           ++C+  W L+++             WED  PK  W++FW  VA
Sbjct: 569 YKCRFIWKLEDIDIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>TDEL0C06170 Chr3 complement(1117792..1119513) [1722 bp, 573 aa]
           {ON} Anc_1.84 YNL268W
          Length = 573

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/521 (54%), Positives = 348/521 (66%)

Query: 75  DEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFM 134
           +E   ++    D  VKR LKQRH                  +TPL NAGPVGSLIAYLFM
Sbjct: 53  EEEDAEEAGYHDTRVKRALKQRHIGMIALGGTIGTGLFVGIATPLSNAGPVGSLIAYLFM 112

Query: 135 ATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVG 194
            +IV+ +TQSLGEMA                  P+ G ANGYMYWF+WAIT+A+E+SV+G
Sbjct: 113 GSIVYFITQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIG 172

Query: 195 QIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMV 254
           Q+IQFWT AVPL+AWI I+W  ++++N FPVK YGE EFWVASIKVIAI+G+LIY L +V
Sbjct: 173 QVIQFWTSAVPLAAWIAIFWVFVSLLNFFPVKVYGEIEFWVASIKVIAIVGYLIYALVIV 232

Query: 255 CGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGE 314
           CG    GP+GFRYWRNPGPWGPGIIS    EGRFLGWVSSLINAAFTYQGTELVGITAGE
Sbjct: 233 CGGSSQGPIGFRYWRNPGPWGPGIISDDKNEGRFLGWVSSLINAAFTYQGTELVGITAGE 292

Query: 315 AANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNS 374
           AANPRK+VPRAI KV                  VPF+DP+L          PF+I+IQN+
Sbjct: 293 AANPRKSVPRAINKVVFRIVIFYIMSLFFVGMLVPFNDPRLASNVAVIASSPFVISIQNA 352

Query: 375 GTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLF 434
           GT+VLPHIFNAV++ TIISA NSN+YVGSRV++ L++T  AP+ FG  T+HGVPY+ V+ 
Sbjct: 353 GTRVLPHIFNAVVMLTIISAANSNVYVGSRVLYALSQTGNAPKQFGYVTRHGVPYLGVIA 412

Query: 435 TSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLP 494
           TS  G LAFL V++    AFNWL+NI  +AG  AWL IS++H+RF+Q L+ RGISRDDLP
Sbjct: 413 TSLLGLLAFLVVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALKFRGISRDDLP 472

Query: 495 FKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFR 554
           FKA LMPW AYYA          QGF AF+P F+ S F  AYI            QLY+R
Sbjct: 473 FKAKLMPWGAYYAAFFVTVIIFIQGFEAFSPKFDVSGFFTAYISLIILVVLLIGCQLYYR 532

Query: 555 CKLYWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
           C+  W L+++             WE+  P+  W++FW ++A
Sbjct: 533 CRFLWKLEDIDIDTDRREIECIIWEEEEPQNLWEKFWSIMA 573

>Skud_14.71 Chr14 (127310..129148) [1839 bp, 612 aa] {ON} YEL063C
           (REAL)
          Length = 612

 Score =  577 bits (1486), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 283/511 (55%), Positives = 340/511 (66%), Gaps = 1/511 (0%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           +D  VKR LKQRH                  STPL  AGPVGSLI+Y+FM T+V+ +TQS
Sbjct: 103 EDKHVKRALKQRHIGMIALGGTIGTGLFVGISTPLSKAGPVGSLISYIFMGTVVYFITQS 162

Query: 145 LGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAV 204
           LGEMA                  P+ G ANGYMYWF+WAIT+A+E+SV+GQ+IQ+WTD V
Sbjct: 163 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTDKV 222

Query: 205 PLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVG 264
           PL+ WI I+W ++T+MN FPVK YGEFEFWVAS+KV+AIMG+LIY L +VCG    GP+G
Sbjct: 223 PLAVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSHQGPIG 282

Query: 265 FRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 324
           FRYWRNPG WGPGIISS   EGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR
Sbjct: 283 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 342

Query: 325 AIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLPHIFN 384
           AI KV                  VP+++P+L          PF+I+IQN+GT  LP IFN
Sbjct: 343 AINKVVFRIVLFYIMSLFFIGLLVPYNEPRLSASSAVIASSPFVISIQNAGTYALPDIFN 402

Query: 385 AVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFL 444
           AV+L T+ISA NSN+YVGSRV++ LA+T  AP+ FG  TK GVPY+ VL T+A G LAFL
Sbjct: 403 AVVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFL 462

Query: 445 EVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLA 504
            V++    AFNWL+NI  +AG  AWL IS+AH+RF+Q LE RGISRDDLPFKA LMP+ A
Sbjct: 463 VVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALEQRGISRDDLPFKAKLMPYGA 522

Query: 505 YYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYWSLDEV 564
           YYA          QGF AF P F  SDF  +YI            QLY++C+  W L+++
Sbjct: 523 YYAAFFVTVIIFIQGFQAFCP-FKVSDFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDI 581

Query: 565 XXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
                        WED  PK  W++FW  VA
Sbjct: 582 DIDTDRREIEAIIWEDDEPKNLWEKFWAAVA 612

>NCAS0A00610 Chr1 (111522..113345) [1824 bp, 607 aa] {ON} 
          Length = 607

 Score =  574 bits (1479), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 276/511 (54%), Positives = 339/511 (66%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
            D EVKR LKQRH                  S PL N+GPVGSLIAYLFM +I++S+TQS
Sbjct: 97  HDTEVKRALKQRHIGMIALGGTIGTGLFVGISVPLTNSGPVGSLIAYLFMGSIIYSITQS 156

Query: 145 LGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAV 204
           LGEMA                  P+ G ANGYMYWF+WAIT+A+E+SVVGQ+I++WT  V
Sbjct: 157 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVVGQVIEYWTKKV 216

Query: 205 PLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVG 264
           PL+AWI I+W  +T+MN FPVK YGE EFW+A +KV+AI G+L+Y L +VCG    GP+G
Sbjct: 217 PLAAWIAIFWVFVTLMNFFPVKVYGEIEFWIAFMKVLAIAGYLLYALIIVCGGSSQGPIG 276

Query: 265 FRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 324
           FRYWRNPGPWG GIIS      RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VPR
Sbjct: 277 FRYWRNPGPWGAGIISKDKNTSRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVPR 336

Query: 325 AIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLPHIFN 384
           AI KV                  VP+DDP+L          PF+I+IQN+GTK+LP IFN
Sbjct: 337 AINKVVFRIALFYIMSLFFIGLLVPYDDPRLSSDSAVVASSPFVISIQNAGTKILPDIFN 396

Query: 385 AVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFL 444
           A+++ T+ISA NSN+YVGSRV++ LA+T  AP+ F   T+HGVPY+ VL T+A G LAFL
Sbjct: 397 AIVMITVISAANSNVYVGSRVLYALAQTGNAPKQFAYVTRHGVPYLGVLCTAALGLLAFL 456

Query: 445 EVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLA 504
            V++    AFNWL+NI  +AG  AWL ISI+H+RF+Q L+ RGISRDDLPFKA  MPW A
Sbjct: 457 VVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKFMPWAA 516

Query: 505 YYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYWSLDEV 564
           YYA          QGF AF+P F+ + F  AYI            Q+Y+RC+ +W L+++
Sbjct: 517 YYATFFVTVIIFIQGFQAFSPHFDVTAFFTAYISLIILAVLFIGCQIYYRCRFFWKLEDI 576

Query: 565 XXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
                        WED  PKT+WD+FW  VA
Sbjct: 577 DIDTDRREIEEVIWEDDEPKTYWDKFWAAVA 607

>NDAI0F04190 Chr6 complement(1012142..1013941) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  573 bits (1476), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/511 (53%), Positives = 343/511 (67%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
            D +VKR LKQRH                  +TPL N+GPVGSLIAYLFM +I++ +TQS
Sbjct: 89  HDTQVKRALKQRHLGMIALGGTIGTGLFIGIATPLTNSGPVGSLIAYLFMGSIIYFITQS 148

Query: 145 LGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAV 204
           LGEMA                  P+ G ANGYMYWF+WAITFA+E+SVVGQ+I++WTD V
Sbjct: 149 LGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITFAVEISVVGQVIEYWTDKV 208

Query: 205 PLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVG 264
           PL+AWI I+W ++T++N FPVK YGE EFW+A IKV+AIMG+L+Y L +VCG    GP+G
Sbjct: 209 PLAAWIAIFWVLITLLNFFPVKVYGEIEFWIAFIKVLAIMGYLLYALIIVCGGSSQGPIG 268

Query: 265 FRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 324
           FRYWRNPGPWGPGIIS  V  GRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR
Sbjct: 269 FRYWRNPGPWGPGIISKDVNTGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 328

Query: 325 AIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLPHIFN 384
           AI KV                  VP++D +L          PF+I+IQN+GTKVLP IFN
Sbjct: 329 AINKVVFRIALFYIMSLFFIGMLVPYNDERLASTSAVIASSPFVISIQNAGTKVLPDIFN 388

Query: 385 AVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFL 444
           A+++ TIISA NSN+YVGSRV++ LA +  AP+ F   T++GVPY+ V+ TSA G LAFL
Sbjct: 389 AIVMITIISAANSNVYVGSRVLYALALSGNAPKQFAFVTRYGVPYLGVIVTSALGLLAFL 448

Query: 445 EVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLA 504
            V++    AFNWL+NI  +AG  AWL ISI+H+RF+Q L+ RGISRDDLPFKA LMP+ A
Sbjct: 449 VVNNNANTAFNWLINISTLAGLCAWLFISISHIRFMQALKFRGISRDDLPFKAKLMPFGA 508

Query: 505 YYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYWSLDEV 564
           YYA          QGF AF+P ++ + F  +YI            Q+++RC+ +W ++++
Sbjct: 509 YYATFFVTVIIFIQGFQAFSPHWDTTAFFTSYISLIILAVLFIGCQIFYRCRFFWRVEDI 568

Query: 565 XXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
                        WED  PKT WD+FW  VA
Sbjct: 569 DIDSDRREIEAVIWEDDEPKTLWDKFWAAVA 599

>CAGL0J08162g Chr10 complement(803679..805472) [1794 bp, 597 aa]
           {ON} highly similar to uniprot|P32487 Saccharomyces
           cerevisiae YNL268w LYP1 or uniprot|P04817 Saccharomyces
           cerevisiae YEL063c CAN1 or uniprot|P38971 Saccharomyces
           cerevisiae YNL270c ALP1
          Length = 597

 Score =  572 bits (1475), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 281/512 (54%), Positives = 340/512 (66%)

Query: 84  VQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQ 143
           V D  VKR LKQRH                  STPL N+GPVG+LIAY+FM TI++ VTQ
Sbjct: 86  VHDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNSGPVGALIAYIFMGTIIYFVTQ 145

Query: 144 SLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
           SLGEMA                  P+ G ANGYMYWF+WAIT+A+E+SV+GQ+IQ+WT  
Sbjct: 146 SLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEVSVIGQVIQYWTFK 205

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPV 263
           VPL+AWI I+W ++T+MN FPVK YGEFEFWVASIKVIAI+G+LIY L +VCG    GP+
Sbjct: 206 VPLAAWIGIFWVLITLMNFFPVKIYGEFEFWVASIKVIAIVGYLIYALIIVCGGSHQGPI 265

Query: 264 GFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 323
           GFRYWRNPG  G GIISS + E RFLGWVSSLINAAFTYQGTELVGITAGEAANPRK+VP
Sbjct: 266 GFRYWRNPGAMGAGIISSDLGEARFLGWVSSLINAAFTYQGTELVGITAGEAANPRKSVP 325

Query: 324 RAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLPHIF 383
           RAI KV                  VP++DP+L          PF+I+IQN+GTKVLP IF
Sbjct: 326 RAINKVVFRIVLFYIMSLFFVGLLVPYNDPRLSASSAVIASSPFVISIQNAGTKVLPDIF 385

Query: 384 NAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAF 443
           NAV+L T+ISA NSN+YVGSRV++ LA++  AP+ F   T+HGVPY+ V+ T+  G LAF
Sbjct: 386 NAVVLVTVISAANSNVYVGSRVLYALAQSGNAPKQFAYVTRHGVPYLGVICTALLGLLAF 445

Query: 444 LEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWL 503
           L V+     AFNWL+NI  +AG  AWL IS+AH+RF+Q L+ RGISRDDLPFKA  MPW 
Sbjct: 446 LVVNHNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKFMPWG 505

Query: 504 AYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYWSLDE 563
           AYYA          QGF AFAP F+ S+F  AYI            QLY+RC+  W L++
Sbjct: 506 AYYASFFVTVIIFIQGFQAFAPKFDVSEFFTAYISLILLVVLFAGCQLYYRCRFLWKLED 565

Query: 564 VXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
           +             WED  P+  W++FW  VA
Sbjct: 566 IDIDSDRREIDAIVWEDDEPQNLWEKFWAAVA 597

>SAKL0C02728g Chr3 (255022..256710) [1689 bp, 562 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1
           lysine-specific high-affinity permease
          Length = 562

 Score =  571 bits (1472), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 284/515 (55%), Positives = 347/515 (67%)

Query: 81  QGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFS 140
           +G  ++ EVKR LK RH                  ++PL  +GPVG+LIAY+F+ +IV+ 
Sbjct: 48  EGDCRETEVKRALKPRHISMIALGGTIGTGLFVGIASPLSESGPVGALIAYIFIGSIVYF 107

Query: 141 VTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW 200
           VTQSLGEMA                  P+ G ANGYMYWF+WAIT+A+E++VVGQ+IQ+W
Sbjct: 108 VTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEIAVVGQVIQYW 167

Query: 201 TDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVT 260
           TDAVPL+AWI I+W ++T+ N FPVKFYGE EFWVAS+KVIAI+G+LIY L +VCG    
Sbjct: 168 TDAVPLAAWIAIFWVLVTLANFFPVKFYGEVEFWVASVKVIAIVGYLIYALVIVCGGSHQ 227

Query: 261 GPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 320
           GP+GFRYWRNPGPWGPGIIS  V EGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK
Sbjct: 228 GPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 287

Query: 321 TVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLP 380
           TVPRAI KV                  VP+DD +L          PF+I+IQN+GTKVLP
Sbjct: 288 TVPRAINKVFFRILFFYILSLFFIGLLVPYDDLRLSNTTAVIASSPFVISIQNAGTKVLP 347

Query: 381 HIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGA 440
           HIFNA+++ TIISA NSN+YVGSRV++ LA +  AP+ FG  TK GVPY+ V+ T+  G 
Sbjct: 348 HIFNAIVMITIISAANSNVYVGSRVLYSLALSGNAPKQFGYVTKQGVPYLGVIVTALLGL 407

Query: 441 LAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALM 500
           LAFL V++   +AFNWL+NI  +AG  AWL IS++HVRF+Q L+HRGISR+DLPFKA LM
Sbjct: 408 LAFLVVNNNANEAFNWLVNISTLAGLCAWLFISLSHVRFMQCLKHRGISREDLPFKAKLM 467

Query: 501 PWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYWS 560
           PW AYYA          QGF AF P F  SDF  +YI            QL++RC+  WS
Sbjct: 468 PWGAYYAAFFIGVIIIIQGFKAFTPKFRVSDFFTSYISLILLAVLFLGCQLFYRCRFIWS 527

Query: 561 LDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
           LD++             WED  PK  W++FW  VA
Sbjct: 528 LDDIDIDSDRREIDAIVWEDDEPKNLWEKFWVAVA 562

>ZYRO0F16654g Chr6 (1374093..1375835) [1743 bp, 580 aa] {ON} similar
           to uniprot|P04817 Saccharomyces cerevisiae YEL063C CAN1
           Plasma membrane arginine permease requires phosphatidyl
           ethanolamine (PE) for localization exclusively
           associated with lipid rafts mutation confers canavanine
           resistance
          Length = 580

 Score =  569 bits (1466), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 290/522 (55%), Positives = 347/522 (66%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           +D    ++G V+  EVKR LK RH                  S PL+NAGPVG LIAYLF
Sbjct: 59  DDSVDGEKGEVRSTEVKRALKPRHIGMIALGGTIGTGLFVGISEPLQNAGPVGMLIAYLF 118

Query: 134 MATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVV 193
           MATI FSV QSLGEMA                  P+ GAANGYMYWFSW+ITFALELSV+
Sbjct: 119 MATIAFSVMQSLGEMATYIPVTSAFSVFSQRFLSPAFGAANGYMYWFSWSITFALELSVI 178

Query: 194 GQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCM 253
           GQI+Q+WT  VP++AWI I+W ++  +N  PVKFYGEFEFW+A IKV+AI+GF+IYC  M
Sbjct: 179 GQIVQYWTFKVPVAAWISIFWVLIAGLNFCPVKFYGEFEFWIAFIKVVAIVGFIIYCFIM 238

Query: 254 VCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAG 313
           VCGAG TGPVGFRYWR+   +G GIIS    E RFLGWVSSLINAAFTYQGTELVGITAG
Sbjct: 239 VCGAGKTGPVGFRYWRHGYAFGDGIISKNKNEARFLGWVSSLINAAFTYQGTELVGITAG 298

Query: 314 EAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQN 373
           EAANPRKTVP++IK+                   VPF+D  L          PFI+AI+N
Sbjct: 299 EAANPRKTVPKSIKRTLWRILIFYIFSLLFVGLLVPFNDHGLQDSRSYAASSPFILAIKN 358

Query: 374 SGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVL 433
           SGTK LP IFNAVIL+T+ISA NS++YVGSRVM+ +A+ +LAP      +K GVPY AVL
Sbjct: 359 SGTKALPDIFNAVILTTVISAANSDVYVGSRVMYSMARNRLAPPILAKASKGGVPYAAVL 418

Query: 434 FTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDL 493
           FTSA GALA+LE SS GA  FNWL+NI GVAGFF+W LIS +H+RF++ L+ RGISR+DL
Sbjct: 419 FTSAIGALAYLETSSSGANVFNWLMNITGVAGFFSWWLISWSHLRFMKALKQRGISRNDL 478

Query: 494 PFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYF 553
           PFKA+ MPW+A Y+          QGFT F P F  SDFVA+YI            Q++F
Sbjct: 479 PFKASFMPWIAIYSFFFMTLIILVQGFTCFTPHFQASDFVASYISVGLFFVIWAVFQIWF 538

Query: 554 RCKLYWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
           RC L   + E+             WED  PKT WD+FW++VA
Sbjct: 539 RCPLLVPIAEIDIDTDRRDVDAEVWEDEPPKTLWDKFWNIVA 580

>Smik_14.68 Chr14 (117603..119438) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  568 bits (1465), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/508 (54%), Positives = 341/508 (67%), Gaps = 1/508 (0%)

Query: 88  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGE 147
            VKR LKQRH                  STPL NAGPVGSLIAY+FM T+++ +TQSLGE
Sbjct: 105 HVKRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVIYFITQSLGE 164

Query: 148 MAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLS 207
           MA                  P+ G +NGYMYWF+WAIT+A+E+SV+GQ+IQ+WTD VPL+
Sbjct: 165 MATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIQYWTDKVPLA 224

Query: 208 AWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVGFRY 267
           AWI I+W ++T+MN FPVK YGEFEFWVAS+KV+AI+G+LIY L +VCG    GP+GFRY
Sbjct: 225 AWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIVGYLIYALVIVCGGSHQGPIGFRY 284

Query: 268 WRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIK 327
           WRNPG WGPGIIS   +EGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAI 
Sbjct: 285 WRNPGAWGPGIISKNKSEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIN 344

Query: 328 KVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLPHIFNAVI 387
           KV                  VP+++P+L          PF+I+IQN+GT  LP IFNAV+
Sbjct: 345 KVVFRIVIFYIMSLFFIGLLVPYNEPRLSPSSAVIASSPFVISIQNAGTYALPDIFNAVV 404

Query: 388 LSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLEVS 447
           L T+ISA NSN+YVGSRV++ LA++  AP+ FG  TK GVPY+ VL T+A G LAFL V+
Sbjct: 405 LITVISAANSNVYVGSRVLYSLAQSGNAPKQFGYVTKQGVPYMGVLSTAALGLLAFLVVN 464

Query: 448 SGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAYYA 507
           +    AFNWL++I  +AG  AWL IS+AH+RF+Q L+ RGISRDDLPFKA LMP+ AYYA
Sbjct: 465 NNANTAFNWLISISTLAGLCAWLFISLAHIRFMQALKQRGISRDDLPFKAKLMPYGAYYA 524

Query: 508 XXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYWSLDEVXXX 567
                     QGF AF P F+ S+F  +YI            QLY++C+  W L+++   
Sbjct: 525 SFFVTIIIFIQGFQAFCP-FSVSEFFTSYISLILLAVVFISCQLYYKCRFIWKLEDIDID 583

Query: 568 XXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
                     WED  PK  W++FW  VA
Sbjct: 584 SDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>Suva_14.75 Chr14 (133164..134999) [1836 bp, 611 aa] {ON} YEL063C
           (REAL)
          Length = 611

 Score =  567 bits (1460), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 277/511 (54%), Positives = 336/511 (65%), Gaps = 1/511 (0%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           +D  V+R LKQRH                  STPL NAGPVGSLIAY+FM T+V+ VTQS
Sbjct: 102 EDKHVRRALKQRHIGMIALGGTIGTGLFVGISTPLSNAGPVGSLIAYIFMGTVVYFVTQS 161

Query: 145 LGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAV 204
           LGEMA                  P+ G +NGYMYWF+WAIT+A+E+SV+GQ+I++WT  V
Sbjct: 162 LGEMATFIPVTSSITVFSKRFLSPAFGVSNGYMYWFNWAITYAVEVSVIGQVIEYWTTKV 221

Query: 205 PLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVG 264
           PL  WI I+W ++T+MN FPVK YGEFEFWVAS+KV+AIMG+LIY L +VCG    GP+G
Sbjct: 222 PLGVWIAIFWVLITLMNFFPVKVYGEFEFWVASVKVLAIMGYLIYALVIVCGGSKQGPIG 281

Query: 265 FRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 324
           FRYWRNPG WGPGIISS   EGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR
Sbjct: 282 FRYWRNPGAWGPGIISSDKNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 341

Query: 325 AIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLPHIFN 384
           AI KV                  VP+ DP+L          PF+I+IQN+GT  LP IFN
Sbjct: 342 AINKVVFRIVLFYIMSLFFIGLLVPYTDPRLSASSAVIASSPFVISIQNAGTYALPDIFN 401

Query: 385 AVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFL 444
           A++L T+ISA NSN+YVGSRV++ LA+T  AP+ FG  TK GVPY+ VL T+A G LAFL
Sbjct: 402 AIVLITVISAANSNVYVGSRVLYSLAQTGNAPKQFGYVTKQGVPYLGVLSTAALGLLAFL 461

Query: 445 EVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLA 504
            V++    AFNWL+NI  +AG  AWL IS++H+RF+Q L  RGISRDDLPFKA  MP+ A
Sbjct: 462 VVNNNANTAFNWLINISTLAGLCAWLFISLSHIRFMQALNQRGISRDDLPFKAKFMPYGA 521

Query: 505 YYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYWSLDEV 564
           YYA          QGF +F P F  +DF  +YI            QLY++C+  W L+++
Sbjct: 522 YYASFFVTVIIFIQGFQSFCP-FRVADFFTSYISLILLAVVFTGCQLYYKCRFIWKLEDI 580

Query: 565 XXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
                        WED  PK  W++FW  VA
Sbjct: 581 DIDSDRREIEAIIWEDDEPKNLWEKFWAAVA 611

>TPHA0B04470 Chr2 complement(1047097..1048896) [1800 bp, 599 aa]
           {ON} Anc_1.84 YNL268W
          Length = 599

 Score =  560 bits (1443), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 275/516 (53%), Positives = 341/516 (66%), Gaps = 1/516 (0%)

Query: 80  DQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVF 139
           + G VQD  VKR LKQRH                  STPL NAGPVG+LIAY+FM +I++
Sbjct: 85  EAGHVQDTRVKRALKQRHIGMIALGGTIGTGLFVGISTPLGNAGPVGALIAYIFMGSIIY 144

Query: 140 SVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQF 199
            +TQSLGEMA                  P+ G  NGYMYWF+WAIT+A+E+SVVGQ+IQ+
Sbjct: 145 FITQSLGEMATFIPVTSSITVFSKRFLSPAFGVTNGYMYWFNWAITYAVEISVVGQVIQY 204

Query: 200 WTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGV 259
           WTDAVPL+AWI I+W  +T++N FPVK YGE EFWVASIKV+AI+G+LIY L +VCG   
Sbjct: 205 WTDAVPLAAWIAIFWVFVTLLNFFPVKVYGEVEFWVASIKVLAIIGYLIYALVIVCGGSS 264

Query: 260 TGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 319
            GP+GFRYWRNPGPWGPGIIS  V EGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR
Sbjct: 265 QGPIGFRYWRNPGPWGPGIISKDVNEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 324

Query: 320 KTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVL 379
           K+VPRAI KV                  VP++D  L          PF+I+IQN+GT  L
Sbjct: 325 KSVPRAINKVVFRIALFYIMSLFFIGLLVPYNDHTLSSGDSYIASSPFVISIQNAGTYAL 384

Query: 380 PHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFG 439
           P IFNAV++ TIISA NSN+YVGSRV++ LA+T  AP+ F   TKHGVP++ V+ T++ G
Sbjct: 385 PDIFNAVVMLTIISAANSNVYVGSRVLYALAQTGNAPKQFAYVTKHGVPWLGVIVTASLG 444

Query: 440 ALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAAL 499
            LAFL V++    AFNWL+NI  +AG  AW  I+++H+RF+Q L++RGISRDDLPFKA L
Sbjct: 445 LLAFLVVNNNANTAFNWLINISTLAGLCAWFFIALSHIRFMQALKYRGISRDDLPFKAKL 504

Query: 500 MPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYW 559
           MPW AYY+          QGF AF P ++ + F  +YI            QLY+RC+   
Sbjct: 505 MPWGAYYSAFFVFVIIFIQGFEAFTP-WDTTTFFTSYISLILLVVVFIGCQLYYRCRFLL 563

Query: 560 SLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
            ++++             WED  PK  W++FW  VA
Sbjct: 564 KVEDIDIDTDRREIEAIIWEDDEPKNLWEKFWAWVA 599

>Ecym_1088 Chr1 (184038..185741) [1704 bp, 567 aa] {ON} similar to
           Ashbya gossypii AFR667C
          Length = 567

 Score =  554 bits (1428), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/521 (50%), Positives = 337/521 (64%), Gaps = 1/521 (0%)

Query: 76  EPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMA 135
           E +  +G   + EVKR LK RH                  ++PL+ AGPVGSLIAY+FM 
Sbjct: 47  EEHEQEGDYHETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLIAYIFMG 106

Query: 136 TIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQ 195
           T+V+S+TQSLGEMA                  P+ G ANGYMYWF+WAITFA+ELSVVGQ
Sbjct: 107 TVVYSITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQ 166

Query: 196 IIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVC 255
           II +WT  VPL AWI I+W I+T++N FPV+FYGE EFW+AS+KVI I+G+LIY   +VC
Sbjct: 167 IINYWTSVVPLGAWITIFWIIVTLLNFFPVRFYGEIEFWIASVKVITIVGYLIYAFIVVC 226

Query: 256 GAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEA 315
           G    GP+GFR WRNPGPWG G+ISS   E RFLGWVSSLI AAFTYQGTELVGITAGE+
Sbjct: 227 GGSSQGPIGFRNWRNPGPWGTGVISSNQTEARFLGWVSSLIKAAFTYQGTELVGITAGES 286

Query: 316 ANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKL-XXXXXXXXXXPFIIAIQNS 374
            NPRKTVP+AI KV                  VP++DP++           PF+I+I+N+
Sbjct: 287 KNPRKTVPKAINKVFFRILFFYILSLFFVGLLVPYNDPRMDNTSDTDVNASPFVISIRNA 346

Query: 375 GTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLF 434
           GTK+LP IFNAV+L T++SA NSN+Y+GSRV++ LA++  AP+ FG   +HGVP + V+ 
Sbjct: 347 GTKILPDIFNAVVLVTVVSAANSNVYIGSRVIYSLAQSGNAPKQFGYVNRHGVPVLGVMV 406

Query: 435 TSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLP 494
           T+  G +AFL V++    AFNWL+NI  +AG  AWL IS+AH+RF+Q L+ RGISRD LP
Sbjct: 407 TALMGLMAFLVVNNNAKAAFNWLVNISTLAGLCAWLFISLAHIRFMQCLKQRGISRDALP 466

Query: 495 FKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFR 554
           FKA  MPW AYYA          QG+TAF+P F+ + F  AYI            Q+Y++
Sbjct: 467 FKAKFMPWAAYYAASFVFVIIFIQGYTAFSPKFDVTQFFTAYISLMLMLVVFIGCQIYYK 526

Query: 555 CKLYWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
           C+  W L+++             WED  PK  WD+FW  +A
Sbjct: 527 CRFLWKLEDIDIDTNRREIDAIVWEDDEPKNLWDKFWSTIA 567

>KAFR0D03940 Chr4 complement(767673..769466) [1794 bp, 597 aa] {ON}
           Anc_1.84 YNL268W
          Length = 597

 Score =  555 bits (1431), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 278/530 (52%), Positives = 344/530 (64%), Gaps = 10/530 (1%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           DED    D    +D +VKRELKQRH                  +TPL +AGPVG+LIAY+
Sbjct: 71  DEDAEEADY---EDKQVKRELKQRHIGMIALGGTIGTGLFVGIATPLADAGPVGALIAYI 127

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
           FM +IV+ VTQ+LGEMA                  P+ G ANGYMYWF+WAITFA+E+SV
Sbjct: 128 FMGSIVYFVTQALGEMATFIPVTSSITVFSQRFLSPAFGVANGYMYWFNWAITFAVEISV 187

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
           VGQ+IQ+WTDAVPL+AWI I+W ++T+MN FPVK YGE EFWVA +KVIAI+G+L+Y L 
Sbjct: 188 VGQVIQYWTDAVPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWVAFMKVIAIVGYLLYALI 247

Query: 253 MVCG-AGVTGPVGFRYWRNPGPWGPGIIS------SQVAEGRFLGWVSSLINAAFTYQGT 305
           +VCG +   GP+GFRYWRNPG WG G+ S      S   EGRFLGWV+SLINAAFTYQGT
Sbjct: 248 IVCGGSKKQGPIGFRYWRNPGAWGNGLTSDGEPIYSSKYEGRFLGWVASLINAAFTYQGT 307

Query: 306 ELVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXX 365
           ELVGITAGEAANPRKTVPRAI KV                  VPF D +L          
Sbjct: 308 ELVGITAGEAANPRKTVPRAINKVVFRIVLFYIMSLFFIGLLVPFTDSRLSDDTTVIASS 367

Query: 366 PFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKH 425
           PF+I+I+N+GTK+LP IFNA+++ T++SA NSN+YVGSRV++ LA TK+AP+ F   T+ 
Sbjct: 368 PFVISIENAGTKILPDIFNAIVMVTVLSAANSNVYVGSRVLYSLAHTKVAPKIFARVTRQ 427

Query: 426 GVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEH 485
           GVP++ V+ TS  G LAFL V +    AFNWL++I  +AG  AWL IS+AHVRF+Q L+ 
Sbjct: 428 GVPFMGVICTSLLGLLAFLVVDNNANTAFNWLVDISTLAGLCAWLFISLAHVRFMQVLKQ 487

Query: 486 RGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXX 545
           RGISRDDLPFKA  MPW +YYA          QGF AF+P F+ + F   YI        
Sbjct: 488 RGISRDDLPFKAKFMPWGSYYAAFWVFVIIFVQGFQAFSPHFDVTTFFTDYISLILLAVV 547

Query: 546 XXXXQLYFRCKLYWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
               QLY+RC+  W L++V             WED  PKT WD+FW  +A
Sbjct: 548 FIGAQLYYRCRFLWKLEDVDIDSDRREIEDAIWEDDEPKTIWDKFWAAIA 597

>KLTH0F02420g Chr6 (205827..207692) [1866 bp, 621 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 621

 Score =  548 bits (1412), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 271/532 (50%), Positives = 341/532 (64%), Gaps = 9/532 (1%)

Query: 73  DEDEPYVD---------QGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAG 123
            +DEP  D         +G +Q+ +VKR LK RH                  ++PL  +G
Sbjct: 90  SQDEPSTDPLGSDTESGEGDMQEGKVKRALKPRHVSMIALGGTIGTGLFVGIASPLSYSG 149

Query: 124 PVGSLIAYLFMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWA 183
           PVG+LIAY+FM T+V+ VTQS+GEMA                  P+ G ANGYMYWF+WA
Sbjct: 150 PVGALIAYIFMGTVVYFVTQSMGEMATFIPVTSSITVFSSRFLSPAFGVANGYMYWFNWA 209

Query: 184 ITFALELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAI 243
           ITFA+ELSV GQ+I++WT+AVP +AWI I+W ++T+ N FPV+FYGE EFWVASIKV+AI
Sbjct: 210 ITFAVELSVTGQVIEYWTEAVPRAAWIAIFWVLVTLANFFPVQFYGEVEFWVASIKVLAI 269

Query: 244 MGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQ 303
           +G+LIY L +VCG    GP+GFRYWRNPGPWG GIIS    EGRFLGWV+SLINA+FTYQ
Sbjct: 270 VGYLIYALVIVCGGSKQGPIGFRYWRNPGPWGAGIISKDKDEGRFLGWVASLINASFTYQ 329

Query: 304 GTELVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXX 363
           GTELVGITAGEAANPR+TVPRAI KV                  VP++   L        
Sbjct: 330 GTELVGITAGEAANPRRTVPRAINKVFFRILFFYILSLFFVGLLVPYNHSSLDKTTTVIA 389

Query: 364 XXPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITT 423
             PF+I+IQN+GT+ LP IFNAV+L TIISA NSN+YVGSRV+F LA T +AP+ F   T
Sbjct: 390 SSPFVISIQNAGTRALPDIFNAVVLVTIISAANSNVYVGSRVLFSLAHTGIAPKVFSSVT 449

Query: 424 KHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTL 483
             GVP++ V+ TS  G LAFL V+    +AFNWL+NI  +AG  AWL ISI+H+RF+Q L
Sbjct: 450 PQGVPFMGVIVTSLLGLLAFLVVNHNANEAFNWLINISTLAGLCAWLFISISHIRFMQCL 509

Query: 484 EHRGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXX 543
           + RGISRDDLPFK+ LMP+ AYYA          QGF AF+P F  ++F  +YI      
Sbjct: 510 KQRGISRDDLPFKSKLMPYGAYYAAFWVTVIIFVQGFQAFSPHFKVTEFFTSYISLMLLV 569

Query: 544 XXXXXXQLYFRCKLYWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
                 QL++RC+ +  L+++             WED  P T W +FW  VA
Sbjct: 570 VVFCGAQLFYRCRFFNRLEDIDIDSDRREADALIWEDDEPTTLWGKFWTAVA 621

>Kwal_33.13411 s33 (210461..212143) [1683 bp, 560 aa] {ON} YNL268W
           (LYP1) - lysine permease [contig 117] FULL
          Length = 560

 Score =  545 bits (1404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 266/516 (51%), Positives = 336/516 (65%)

Query: 80  DQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVF 139
           D+G +Q+ +VKR LK RH                  ++PL +AGPVG+LIAY+FM +IV+
Sbjct: 45  DEGDLQEGQVKRALKPRHVSMIALGGTIGTGLFVGIASPLSSAGPVGALIAYIFMGSIVY 104

Query: 140 SVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQF 199
            VTQS+GEMA                  P+ G ANGYMYWF+WAIT+A+E+SV+GQ+IQ+
Sbjct: 105 FVTQSMGEMATFIPVTSSITVFSNRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQY 164

Query: 200 WTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGV 259
           WT AVPL+AWI I+W  +T+ N FPV+FYGE EFWVASIKVIAI+G+L+Y L +VCG   
Sbjct: 165 WTKAVPLAAWIGIFWVAITLANFFPVRFYGEVEFWVASIKVIAIVGYLLYALIIVCGGSK 224

Query: 260 TGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 319
            GP+GFRYWRNPGPWG GIIS    +GRFLGWV+SLINA+FTYQGTELVGITAGEAANPR
Sbjct: 225 QGPIGFRYWRNPGPWGDGIISGDKDKGRFLGWVASLINASFTYQGTELVGITAGEAANPR 284

Query: 320 KTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVL 379
           KTVP+AI KV                  VP++ P L          PF+I+IQ++GT++L
Sbjct: 285 KTVPKAINKVFFRILFFYILSLFFVGLLVPYNHPGLDKHTSVIASSPFVISIQSAGTRIL 344

Query: 380 PHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFG 439
           P IFNAV+L TIISA NSN+YVGSR++F LA T +AP+ F   T  GVPY+ V+ T+  G
Sbjct: 345 PDIFNAVVLVTIISAANSNVYVGSRILFSLAHTGIAPKQFSYVTNQGVPYLGVICTALLG 404

Query: 440 ALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAAL 499
            LAFL V     + FNWL+NI  +AG  AWL ISI+H+RF+Q L+ RGISRDDLPFK+ L
Sbjct: 405 LLAFLVVDDNANEGFNWLINISTLAGLCAWLFISISHIRFMQCLKQRGISRDDLPFKSKL 464

Query: 500 MPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYW 559
           MP+ AYYA          QGF AF P F  ++F   YI            QLY+RC+ + 
Sbjct: 465 MPYGAYYAAFWVAVIIFVQGFQAFCPKFKVAEFFTGYISLILLAVVFCLAQLYYRCRFFN 524

Query: 560 SLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
            L+++             WE+  P T W +FW  VA
Sbjct: 525 RLEDIDIDSDRREIDALIWEEEEPTTLWGKFWVAVA 560

>Ecym_1087 Chr1 complement(180832..182544) [1713 bp, 570 aa] {ON}
           similar to Ashbya gossypii AFR668W
          Length = 570

 Score =  538 bits (1387), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/510 (52%), Positives = 331/510 (64%), Gaps = 2/510 (0%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
            D +VKR+LK RH                  ++P++ AGPVGSL+AYLFM TI F VTQS
Sbjct: 58  DDPDVKRDLKPRHMSMISLGGTIGTGLFMGIASPIRVAGPVGSLLAYLFMGTIAFCVTQS 117

Query: 145 LGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAV 204
           LGEMA                  P++GAANGY+YWFSW +TFALELS++GQ+IQ+WT AV
Sbjct: 118 LGEMATFIPVTSSFTMYTQRFLSPALGAANGYLYWFSWCVTFALELSIIGQLIQYWTFAV 177

Query: 205 PLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVG 264
           PLS WIV++W +LT  NM PV+FYGE EFW+A++KV++I GFLIY L MVCG    G +G
Sbjct: 178 PLSVWIVVFWILLTASNMIPVRFYGEIEFWIAALKVLSIFGFLIYALVMVCGGSSEGALG 237

Query: 265 FRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 324
           FRYW+NPGPWG G+ISS   E RFLGWVSSLI AAFTYQGTELVGITAGE+ NPRKTVP+
Sbjct: 238 FRYWKNPGPWGMGMISSNKYEARFLGWVSSLIKAAFTYQGTELVGITAGESKNPRKTVPK 297

Query: 325 AIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX-XXXXXXPFIIAIQNSGTKVLPHIF 383
           AI KV                  VP+ DP+L           PF++AIQNSGTKVLP +F
Sbjct: 298 AINKVFFRILFFYILSLFFVGLLVPYTDPRLSTTSDSDINTSPFVMAIQNSGTKVLPSVF 357

Query: 384 NAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAF 443
           N VIL TI+SAGNSNIY+GSRV++GL+K+ LAP  F  T K GVP+ AVL +S FG LA+
Sbjct: 358 NGVILVTILSAGNSNIYIGSRVLYGLSKSGLAPSLFKKTNKQGVPFYAVLTSSIFGCLAY 417

Query: 444 LEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWL 503
           L +S    K F+WLL I  VAGFFAWLLIS++H+RF+Q L+ RGISR+DLPFKA  MPW 
Sbjct: 418 LNISQNAKKVFDWLLTITAVAGFFAWLLISLSHIRFMQVLKDRGISRNDLPFKAKFMPWG 477

Query: 504 AYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYWSLDE 563
           AYYA          QGF +FAP F  S+F+A YI            Q+ F+ +L    ++
Sbjct: 478 AYYAAFFITVIILIQGFDSFAPEFVFSEFIADYISVFLFIVCWLGFQVLFKTRLILRKED 537

Query: 564 VXXXXXXXXXXXXXW-EDSAPKTFWDRFWD 592
           V             W +D  PKT   + W 
Sbjct: 538 VDIDTDRREIDALVWSDDDEPKTLLQKLWQ 567

>KNAG0F00480 Chr6 (73545..75338) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  537 bits (1384), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 265/508 (52%), Positives = 334/508 (65%), Gaps = 1/508 (0%)

Query: 84  VQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQ 143
           V + +VKR LKQRH                  STPL  AGPVGSLIAY+FM TI++ VTQ
Sbjct: 87  VHETKVKRALKQRHIGMIALGGTIGTGLFVGISTPLSVAGPVGSLIAYIFMGTIIYFVTQ 146

Query: 144 SLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
           SLGEMA                  P+ G ANGYMYWF+WAIT+A+E+SV+GQ+IQ+WT A
Sbjct: 147 SLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVEISVIGQVIQYWTKA 206

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPV 263
           VPL+AWI I+W ++T+MN FPVK YGE EFW+A +KV+AI+G+LIY L +VCG    GP+
Sbjct: 207 VPLAAWIAIFWVLVTLMNFFPVKVYGEVEFWIAFVKVLAIVGYLIYALVIVCGGSHQGPI 266

Query: 264 GFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 323
           GFRYWR+PG +GPGIIS     G+FLGWV+SLINAAFTYQGTELVGITAGEAANPRKTVP
Sbjct: 267 GFRYWRHPGAFGPGIISKNKNTGKFLGWVASLINAAFTYQGTELVGITAGEAANPRKTVP 326

Query: 324 RAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLPHIF 383
           RAI KV                  +P++D +L          PF+I+I+N+ TKVLP IF
Sbjct: 327 RAINKVVFRIVLFYIMSLFFIGMLLPYNDKRLSAQDAVIASSPFVISIKNAHTKVLPDIF 386

Query: 384 NAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAF 443
           NAV++ T++SA NSN+YVGSRV++ LA T  AP+ F   T++GVPY+ V+ T++ G LAF
Sbjct: 387 NAVVMVTVMSAANSNVYVGSRVLYALALTGNAPKQFSYVTRYGVPYLGVVCTASLGLLAF 446

Query: 444 LEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWL 503
           L V++    AFNWL+NI  +AG  AWL IS+AH+RF+Q L+ RGISRDDLPFKA LMPW 
Sbjct: 447 LVVNNNANTAFNWLINISTLAGLCAWLFISLAHIRFMQALKFRGISRDDLPFKAKLMPWG 506

Query: 504 AYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYWSLDE 563
           AYYA          QG+ AF P ++ S F  +YI            QLY+R +    L++
Sbjct: 507 AYYAAFFVTVIIFIQGYQAFCP-WDVSTFFTSYISLILLAVLVVGCQLYYRGRFLLKLED 565

Query: 564 VXXXXXXXXXXXXXWEDSAPKTFWDRFW 591
           +             WED  PKT WD+FW
Sbjct: 566 IDIDTDRREIESIVWEDDEPKTLWDKFW 593

>KLLA0C02365g Chr3 (208462..210201) [1740 bp, 579 aa] {ON} similar
           to uniprot|P32487 Saccharomyces cerevisiae YNL268W LYP1
           Lysine permease one of three amino acid permeases (Alp1p
           Can1p Lyp1p) responsible for uptake of cationic amino
           acids
          Length = 579

 Score =  535 bits (1378), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 272/523 (52%), Positives = 335/523 (64%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           D  E    +G   + EVKR LK RH                  + PL  +GPVGSLIAY+
Sbjct: 57  DHAESEEGEGDFHETEVKRALKPRHVSMIALGGTIGTGLFVGIAKPLSLSGPVGSLIAYI 116

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
           FM ++V+ VTQSLGEMA                  P+ G ANGYMYWF+WAIT+A+ELSV
Sbjct: 117 FMGSVVYFVTQSLGEMATFIPVTSSITVFSKRFLSPAFGVANGYMYWFNWAITYAVELSV 176

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
           +GQII +WTDAVPL+AWI I+W +LT  N FPVK+YGEFEF VASIKVIAI+G+L+Y L 
Sbjct: 177 LGQIINYWTDAVPLAAWIAIFWVLLTAANFFPVKWYGEFEFCVASIKVIAIVGYLLYALI 236

Query: 253 MVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITA 312
           +VCG    GP+GFRYWRNPGPWG G I+  V + RFLGWV SL+NA+FTYQGTELVGITA
Sbjct: 237 IVCGGSSQGPIGFRYWRNPGPWGTGTIAKNVNKARFLGWVGSLVNASFTYQGTELVGITA 296

Query: 313 GEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQ 372
           GEA+NPRKTVP+AI KV                  VP++ P+L          PF+I+IQ
Sbjct: 297 GEASNPRKTVPKAINKVFFRILVFYIGSLFFVGLLVPYNSPQLESNSAVIASSPFVISIQ 356

Query: 373 NSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAV 432
           N+GTKVLP IFNAV+L TI+SAGNSN+YVGSRV++ LA +  AP+ F   TK GVPY+ V
Sbjct: 357 NAGTKVLPDIFNAVVLVTILSAGNSNVYVGSRVLYSLALSGNAPKQFSYVTKQGVPYLGV 416

Query: 433 LFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDD 492
           + T+  G LAFL  +     AFNWL+NI  +AG  AW  IS+AH+RF+Q L+ RGISRD 
Sbjct: 417 ICTALLGLLAFLATNENANTAFNWLINISTLAGLCAWFFISVAHIRFMQCLKLRGISRDS 476

Query: 493 LPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLY 552
           LPFKA LMPW AYYA          QGFTAFAP F+ S+F  AYI            QLY
Sbjct: 477 LPFKAKLMPWGAYYAAFFVGLIVFIQGFTAFAPRFDVSEFFTAYISLILLVVLFILCQLY 536

Query: 553 FRCKLYWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
           +RC+    ++++             WED  PK  W++FW  +A
Sbjct: 537 YRCRFLTKIEDIDIDSDRREIDAIIWEDDEPKNLWEKFWVALA 579

>TBLA0A05460 Chr1 (1348452..1350278) [1827 bp, 608 aa] {ON} Anc_1.84
           YNL268W
          Length = 608

 Score =  535 bits (1379), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 270/586 (46%), Positives = 353/586 (60%), Gaps = 2/586 (0%)

Query: 10  QYELQSFNSSSSNGVNKTYNYITADAXXXXXXXXXYETGSSSIVVDXXXXXXXXXXXXXX 69
           ++E+QS +S++    + TY Y               E   S    D              
Sbjct: 25  EFEMQSIHSNAEKLRSTTYAYDDKKDMTVTYDNEILEKKDSK--SDIFTSVNRYASHPSE 82

Query: 70  XXXDEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLI 129
                DE    +   +D +VKR LK RH                  S PL+ +GPVGSLI
Sbjct: 83  ARISSDEYDHQEAEFKDTKVKRALKPRHIGMIALGGTIGTGLFIGISDPLQKSGPVGSLI 142

Query: 130 AYLFMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALE 189
           AY+FM T+V+ VTQ+LGEMA                  P+ G +NGY+YWF+WAIT+A+E
Sbjct: 143 AYIFMGTVVYFVTQALGEMATFIPVTSSITVFSSRFLSPAFGVSNGYLYWFNWAITYAVE 202

Query: 190 LSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIY 249
           +SVVGQ+I+FWT  VPL+AWI I+W ++T +N FPV  YGE EFWVAS+KV+AI+G+LIY
Sbjct: 203 ISVVGQVIEFWTTKVPLAAWISIFWVLVTALNFFPVSVYGEIEFWVASVKVLAIVGYLIY 262

Query: 250 CLCMVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVG 309
            L +VCG    GP+GFRYWR+    G G+IS    E RFLGWV+SLINAAFTYQGTELVG
Sbjct: 263 ALVIVCGGSKQGPIGFRYWRHGYAMGGGMISKDKNEARFLGWVASLINAAFTYQGTELVG 322

Query: 310 ITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFII 369
           ITAGEAANPRK+VPRAI KV                  VP++DPKL          PF+I
Sbjct: 323 ITAGEAANPRKSVPRAINKVVFRIVIFYILSLFFIGLLVPYNDPKLNSATSYIASSPFVI 382

Query: 370 AIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPY 429
           +I+N+GT+ LPHIFNA+I+ TIISA NSN+YV SRV++ LA +  AP+ F   T  GVP+
Sbjct: 383 SIENAGTRALPHIFNAIIMITIISAANSNVYVSSRVLYSLALSGHAPKIFARVTPQGVPF 442

Query: 430 IAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGIS 489
           + V+ T+  G LAFL V++   +AFNWL+NI  +AG  AWL IS++H+RF++ L++RGIS
Sbjct: 443 LGVIVTALMGLLAFLVVNNNANEAFNWLINISTLAGLCAWLFISMSHLRFMEALKYRGIS 502

Query: 490 RDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXX 549
           RDDLPFKA  MP+ +YYA          QGFTAF+P F+ + F  AYI            
Sbjct: 503 RDDLPFKARFMPYGSYYACFFITVIIFIQGFTAFSPKFDVASFFTAYISLILLAVLFIGC 562

Query: 550 QLYFRCKLYWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
           QLY+RC+ +W ++++             WED  PKT WD+FW  VA
Sbjct: 563 QLYYRCRFFWKVEDIDIDTDRREIDEIVWEDDEPKTAWDKFWAAVA 608

>AFR667C Chr6 complement(1657505..1659196) [1692 bp, 563 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YNL268W
           (LYP1)
          Length = 563

 Score =  508 bits (1309), Expect = e-175,   Method: Compositional matrix adjust.
 Identities = 254/529 (48%), Positives = 329/529 (62%), Gaps = 16/529 (3%)

Query: 76  EPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMA 135
           E + ++G  Q+ EVKR LK RH                  ++PL+ AGPVGSL+AY+F+ 
Sbjct: 42  EDHTEEGDYQETEVKRALKARHISMIALGGTIGTGLFIVIASPLRTAGPVGSLLAYIFIG 101

Query: 136 TIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQ 195
           T+V+S+TQSLGEMA                  P+ G ANGYMYWF+WAITFA+ELSVVGQ
Sbjct: 102 TVVYSITQSLGEMATFIPVTSSVTVFSKRFLSPAFGVANGYMYWFNWAITFAVELSVVGQ 161

Query: 196 IIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVC 255
           IIQ+WTD VP++AWIVI+W ++T++N FPV+FYGE EFW+AS+KV+ I+G+LIY   +VC
Sbjct: 162 IIQYWTDRVPIAAWIVIFWVLVTLVNFFPVRFYGEIEFWIASVKVLTIVGYLIYAFIIVC 221

Query: 256 GAGVTGPVGFRYWRNPGPWGPGI------ISSQVAEGR--FLGWVSSLINAAFTYQGTEL 307
           G    GP+G        P   GI       SS+    R  FLGWVSSLI AAFTYQGTEL
Sbjct: 222 GGSKQGPIGL-------PATGGIPARGARASSRTTRKRHGFLGWVSSLIKAAFTYQGTEL 274

Query: 308 VGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXX-XXXXP 366
           VGITAGE+ NPRK VP+AI KV                  VP+DDP+L           P
Sbjct: 275 VGITAGESTNPRKNVPKAINKVFFRILFFYIGSLLFVGLLVPYDDPRLNSESSTDVNASP 334

Query: 367 FIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHG 426
           F+I+I+N+GTK+LP IFNAV+L T+ISA NSN+Y+GSRV + LA    AP+     TK G
Sbjct: 335 FVISIKNAGTKILPDIFNAVVLITVISAANSNVYIGSRVAYSLALAGNAPKQLAFVTKQG 394

Query: 427 VPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHR 486
           VPY  VL TS  G ++FL ++   + AF+WL+NI  +AG  AWL IS+AH+RF+Q L+HR
Sbjct: 395 VPYFGVLITSLMGLMSFLVLNHNASTAFDWLVNISTLAGLCAWLFISLAHIRFMQCLKHR 454

Query: 487 GISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXX 546
           GISRDDLPFKA  MPW AYYA          QG+TAF P F+ + F  +YI         
Sbjct: 455 GISRDDLPFKAKFMPWAAYYATFFVTVIIFIQGYTAFTPKFDVTTFFTSYISLFLMLLVF 514

Query: 547 XXXQLYFRCKLYWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
              Q+Y++C+  W+++++             WE+  PK  WD+FW  VA
Sbjct: 515 IGCQIYYKCRFLWAVEDIDIDSDRREIDAIVWEEDEPKNIWDKFWSAVA 563

>AFR668W Chr6 (1659910..1661580) [1671 bp, 556 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL063C (CAN1) and
           YNL270C (ALP1)
          Length = 556

 Score =  507 bits (1306), Expect = e-174,   Method: Compositional matrix adjust.
 Identities = 256/509 (50%), Positives = 329/509 (64%), Gaps = 3/509 (0%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
             ++VKRELK RH                  ++P++NAGPVGSL+AY+F+AT+ + VTQS
Sbjct: 45  NQSDVKRELKPRHVTMISLGGTIGTGLFIGIASPIRNAGPVGSLLAYIFVATMAYCVTQS 104

Query: 145 LGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAV 204
           LGEMA                  P++GAANGY+YW SW ITFALE+SV+G++I +W+DAV
Sbjct: 105 LGEMATFIPVTSSFTVFASRFVSPALGAANGYLYWLSWCITFALEISVIGRLILYWSDAV 164

Query: 205 PLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVG 264
           P++AW+ I+W +LT +N+ PVKFYGEFEFW+AS+KVIAI+ FL Y L +VCG    G +G
Sbjct: 165 PITAWMAIFWVLLTAINLIPVKFYGEFEFWIASLKVIAILCFLFYGLVVVCGGSKLGRIG 224

Query: 265 FRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 324
           FRYW++PGPWG GI+S ++   +FLGWVSSLI AAFT+QGTELVG+TAGE  NPR+TVP+
Sbjct: 225 FRYWKDPGPWGVGIVSQEIHTAQFLGWVSSLIKAAFTFQGTELVGVTAGETKNPRRTVPK 284

Query: 325 AIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXX--XXXXXXXXPFIIAIQNSGTKVLPHI 382
           AI  V                  V +DDP+L            PF++AI  +GTKVLP I
Sbjct: 285 AINTVFFRILLFYIGSLLVIGLLVRYDDPQLIQDGSTTNANASPFVVAINAAGTKVLPDI 344

Query: 383 FNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALA 442
            N VI+ TIISAGNSNIYVGSRV++GL ++ LAP +   TT  GVPY+AVL TS FGAL 
Sbjct: 345 MNGVIMVTIISAGNSNIYVGSRVLYGLGRSGLAPAFISRTTSRGVPYVAVLATSMFGALG 404

Query: 443 FLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPW 502
           +L VSS     F+WLL+I  V+GFF WLLIS++H+RF+Q L+ RGISRDDLPFKA  MP+
Sbjct: 405 YLNVSSKSGSVFDWLLSITAVSGFFTWLLISVSHIRFMQCLKKRGISRDDLPFKAKFMPY 464

Query: 503 LAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYWSLD 562
            AYYA          QGFTAF P F+  DFVA YI            Q  F+ + + ++D
Sbjct: 465 GAYYAAFFVIVIILVQGFTAFTP-FSAVDFVAYYISAFIFVVIWLLFQFLFKGRWFHTVD 523

Query: 563 EVXXXXXXXXXXXXXWEDSAPKTFWDRFW 591
           E+             W+D  P T W + W
Sbjct: 524 EIDIDTDRRDIDAIIWDDDKPTTLWGKIW 552

>ZYRO0F16632g Chr6 complement(1371112..1372935) [1824 bp, 607 aa]
           {ON} similar to uniprot|P32487 Saccharomyces cerevisiae
           YNL268W LYP1 Lysine permease one of three amino acid
           permeases (Alp1p Can1p Lyp1p) responsible for uptake of
           cationic amino acids
          Length = 607

 Score =  491 bits (1265), Expect = e-167,   Method: Compositional matrix adjust.
 Identities = 250/515 (48%), Positives = 318/515 (61%), Gaps = 1/515 (0%)

Query: 81  QGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFS 140
           +G   D +VKR LK RH                  S PL  +GPVGSLIAY+FM ++V+ 
Sbjct: 94  KGKFHDTQVKRALKPRHLGMIALGGTIGTGLFVGISEPLSRSGPVGSLIAYIFMGSVVYF 153

Query: 141 VTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW 200
           VTQSLGEMA                  P++G +NGYMYWF+WAITFA ELSV GQIIQ+W
Sbjct: 154 VTQSLGEMATFIPVTSSITVFTKRFLSPALGVSNGYMYWFNWAITFATELSVTGQIIQYW 213

Query: 201 TDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVT 260
           T  VPL+AWI I+W I+ ++N FPVK YGE EFWV+S+KV+AI+G+LIY L +VCG    
Sbjct: 214 TYKVPLAAWIPIFWVIVAVLNFFPVKIYGEIEFWVSSVKVLAIVGYLIYALVIVCGGSRQ 273

Query: 261 GPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 320
           GP+GFRYWR+   +G G IS    E RFLGWVSSLINAAFTYQGTELVGI+AGEAANPRK
Sbjct: 274 GPIGFRYWRHGYAFGDGYISKNKDEARFLGWVSSLINAAFTYQGTELVGISAGEAANPRK 333

Query: 321 TVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLP 380
           TVPRAI KV                  VP++D +L          PF+I++ N+GT  LP
Sbjct: 334 TVPRAINKVIFRIALFYILSLFFIGLLVPYNDKRLSDGSAIIASSPFVISMLNAGTSALP 393

Query: 381 HIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGA 440
            IFNAVIL T++SA NS++Y+ SRV++ LA    AP+ F    ++GVPY+ V  T   G 
Sbjct: 394 DIFNAVILITVLSAANSDVYIASRVLYALAGQGNAPKQFTYVNRYGVPYLGVFVTCLVGW 453

Query: 441 LAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALM 500
           LAFL VS+    AFNWL+NI  +AG  AW  I  AH+RF+Q L+H+GISRDDLPFKA  M
Sbjct: 454 LAFLVVSNNANTAFNWLINISTLAGLTAWFFICFAHIRFMQALKHKGISRDDLPFKARFM 513

Query: 501 PWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLYWS 560
           PW AYYA          QG+ AF P ++   F  +YI             +Y+R +L   
Sbjct: 514 PWGAYYAAFFVGLIIFIQGYDAFTP-WDTKSFFTSYISLILFGVLYLGCLIYYRGRLLIK 572

Query: 561 LDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWDVVA 595
           ++++             WE+ AP+ +W++FW  VA
Sbjct: 573 IEDIDIDTDRKEVEAYVWEEDAPRNWWEKFWAAVA 607

>CAGL0A01199g Chr1 (121067..122908) [1842 bp, 613 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265w DIP5
           dicarboxylic amino acid permease
          Length = 613

 Score =  284 bits (727), Expect = 4e-87,   Method: Compositional matrix adjust.
 Identities = 159/472 (33%), Positives = 245/472 (51%), Gaps = 8/472 (1%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           ++ + Y+D G  +   ++++LK RH                     L  AGP+   IAY 
Sbjct: 70  EKQDDYMDDGKDEHTRLRKDLKARHISMIAIGGSIGTGLLIGTGNSLYTAGPMSMFIAYA 129

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
           F+  +VF    +LGEMA                  P++G A GY Y   + I    +L+ 
Sbjct: 130 FVGVLVFFTMAALGEMASYIPLDGFTSYASRYCD-PALGFAVGYAYLCKYLILPPNQLTA 188

Query: 193 VGQIIQFWTD--AVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYC 250
              +IQ+W D   V    WI I+  I+  MN   VKF+GEFEFW+++ KVI ++G +I  
Sbjct: 189 AALVIQYWLDREQVNPGVWITIFLVIIVAMNFIGVKFFGEFEFWLSTFKVIVMIGLIILL 248

Query: 251 LCMVCGAGVTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVG 309
             ++ G G T   +GFR++ +PG + P   S   ++G+F+ +V+ L+ A F Y G EL G
Sbjct: 249 FVIMLGGGPTHDRLGFRFYDHPGAFKPYSKSIDGSKGKFVAFVAVLVYALFAYLGIELTG 308

Query: 310 ITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXX---XXXXP 366
           I A EAANPRK++P+AIK                    V +DDP L             P
Sbjct: 309 IVAAEAANPRKSIPKAIKLTMYRIIVFYLVTIFLLGMCVAYDDPLLKKAKTSGTGAAASP 368

Query: 367 FIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHG 426
           +++AI NSG K LPHIFNA +L  + SA NS++YV SR ++GLA    AP+ F +T + G
Sbjct: 369 YVVAIINSGIKALPHIFNACVLMFVFSACNSDLYVASRTLYGLAIDNKAPKIFAVTNRWG 428

Query: 427 VPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHR 486
           VPY ++L +S F  LA++ VSSG AK FN+ +N+V + G  +W+ I I ++ F + ++ +
Sbjct: 429 VPYYSLLMSSCFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWISILITYLCFFRAVKAQ 488

Query: 487 GISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFA-PTFNGSDFVAAYI 537
            + R    ++A   P+ +Y+           + FT F    F+  +F+  YI
Sbjct: 489 NVDRSRFAYRAPFQPYGSYFTLAFCILIAFIKNFTVFLNHHFDYKNFITGYI 540

>Kpol_358.3 s358 (7369..9096) [1728 bp, 575 aa] {ON} (7369..9096)
           [1728 nt, 576 aa]
          Length = 575

 Score =  276 bits (707), Expect = 1e-84,   Method: Compositional matrix adjust.
 Identities = 155/471 (32%), Positives = 236/471 (50%), Gaps = 7/471 (1%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           ++D   +  G      +K+ELK RH                   T L+  GP   LIAY 
Sbjct: 34  EDDSNKISDGKEDGVRLKKELKARHISMIAIGGSLGTGLLIGTGTALRTGGPASILIAYS 93

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
           F+  +VF V   LGEMA                  P++G A GY Y F + I    +L+ 
Sbjct: 94  FVGILVFFVMACLGEMATYIPLDGFTSYATRYCD-PALGFAVGYCYLFKYFIITPNQLTA 152

Query: 193 VGQIIQFWTD--AVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYC 250
              +IQ+W D   V    WI I+  ++ I+N   V+++GEFEFW++S K++ + G +++ 
Sbjct: 153 GALVIQYWIDRETVNPGVWITIFLVVIVIINTVGVRYFGEFEFWLSSFKIMVMFGVILFL 212

Query: 251 LCMVCGAGVT-GPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVG 309
             ++ G G     +GFRYW+NPG + P   S   ++G+F+ +V+  + A F Y G EL G
Sbjct: 213 FIIMLGGGPNHDRLGFRYWKNPGAFKPYSESITGSKGKFVSFVAVFVYALFAYLGIELTG 272

Query: 310 ITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXX---P 366
           I A EA NPR+ +PRAIK                    V ++DP+L             P
Sbjct: 273 IVAAEAENPRRNIPRAIKLTMYRIILFYIVTIFLLGMCVAYNDPRLLAAAHASTSAAASP 332

Query: 367 FIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHG 426
           F++AIQNSG + LPHIFN  +L  + SA NS++YVG+R ++ LA    AP+ F  T + G
Sbjct: 333 FVVAIQNSGVRALPHIFNVCVLIFVFSACNSDLYVGTRSLYSLAIDGKAPKLFAKTNRWG 392

Query: 427 VPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHR 486
           VPY A+     F  LA++ VSSG A+ FN+ +N+V + G  +W+ I I ++ F +    +
Sbjct: 393 VPYNALFGCFLFCLLAYMNVSSGSAQIFNYFVNVVSIFGILSWISILITYIFFYRACIAQ 452

Query: 487 GISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYI 537
            + R+   ++A   P+ AY            + FT F   F+   F+  YI
Sbjct: 453 NVDRNSFAYRAPFQPYGAYITLFFCVLIAFIKNFTVFIGEFDYKSFITGYI 503

>TPHA0M00130 Chr13 complement(25769..27604) [1836 bp, 611 aa] {ON} 
          Length = 611

 Score =  269 bits (688), Expect = 1e-81,   Method: Compositional matrix adjust.
 Identities = 160/488 (32%), Positives = 241/488 (49%), Gaps = 11/488 (2%)

Query: 79  VDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIV 138
           V  G      +K++LK RH                   T L+ AGP   LIAY F+ T+V
Sbjct: 72  VMDGKDDGTRLKKDLKARHISMIAIGGSLGTGLLIGTGTALRTAGPASILIAYTFVGTLV 131

Query: 139 FSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQ 198
           F    +LGEMA                  P++G A GY Y F + I    +L+    +IQ
Sbjct: 132 FFTMAALGEMAAYIPLDGFTSYASRYCD-PALGFAVGYSYLFKYFIITPNQLTAAALVIQ 190

Query: 199 FWTD--AVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG 256
           +W D   V    WI I+  ++  +N   VK++GEFEFW++S K++ ++G +I+   ++ G
Sbjct: 191 YWVDRDTVNPGVWITIFLVVIIAINTIGVKYFGEFEFWLSSFKIMVMIGVMIFLFVIMLG 250

Query: 257 AGVTGP-VGFRYWRNPG---PWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITA 312
            G     +GFRYW+ PG   P+   +++ + + G+F+ +V+  + A F Y G EL GI A
Sbjct: 251 GGPNHDRLGFRYWKTPGAFKPYSSSVVNIEGSTGKFVAFVNVFVYALFAYLGIELTGIVA 310

Query: 313 GEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXX---XPFII 369
            EA NPR+ +PRAIK                    V +DDP L             PF++
Sbjct: 311 AEAENPRRNIPRAIKLTVWRILFFYVATIFLLGMCVAYDDPLLLAAANAQTSAAASPFVV 370

Query: 370 AIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPY 429
           AIQNSG  VLPHIFN  +L  + SA NS++YVG+R ++ LA    AP+ F  T + GVPY
Sbjct: 371 AIQNSGVDVLPHIFNVCVLMFVFSACNSDLYVGTRSLYSLAVDGKAPKIFAKTNRWGVPY 430

Query: 430 IAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGIS 489
            A+     F  LA++ VSSG A+ FN+ +N+V + G  +W  I I  + F + +  +GI 
Sbjct: 431 NAMGGCVLFCLLAYMNVSSGSAEIFNYFVNVVSIFGVLSWSSILITFIYFDRAVRAQGID 490

Query: 490 RDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAF-APTFNGSDFVAAYIXXXXXXXXXXX 548
           R    + A   P+ +Y+A          + F+ F    F+   F+  YI           
Sbjct: 491 RSTFAYVAPFQPYGSYFALFFCVLLALIKNFSVFLGNEFDYKTFITGYIGLPVYAFSFIG 550

Query: 549 XQLYFRCK 556
            +LY++ K
Sbjct: 551 YKLYYKTK 558

>KAFR0B06430 Chr2 complement(1333415..1335196) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  267 bits (683), Expect = 6e-81,   Method: Compositional matrix adjust.
 Identities = 154/473 (32%), Positives = 239/473 (50%), Gaps = 11/473 (2%)

Query: 75  DEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFM 134
           D    D G  +   +K+ LK RH                   T L  AGP    I Y F+
Sbjct: 50  DRDIFDDGKTEGFRLKKNLKARHVSMIAIGGSLGTGLLIGTGTSLAAAGPGSLFITYSFV 109

Query: 135 ATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVG 194
             +VF     LGEMA                  P++G A GY Y   + I  A +L+   
Sbjct: 110 GVLVFFTMSCLGEMAAFIPLDGFTSYASRYVD-PALGFAVGYSYLCKYLILPANQLTAGA 168

Query: 195 QIIQFWTDAVPLS--AWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
            ++Q+W D   L+   +I I+  ++  +N+F VK +GEFEFW++S KV+ ++G ++    
Sbjct: 169 MVVQYWVDRDTLNPGVFITIFLILIVTINIFGVKIFGEFEFWLSSFKVLVMLGLILLMFI 228

Query: 253 MVCGAGVTGP-VGFRYWRNPG---PWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELV 308
           ++ G G     +GFRYWR+PG   P+   IIS   + G+F+ + S  + A F Y G EL 
Sbjct: 229 IMLGGGPNHDRLGFRYWRDPGSFKPYSSSIISISGSTGKFVSFTSCFVYALFCYLGIELT 288

Query: 309 GITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDP---KLXXXXXXXXXX 365
           GI A EA NPRK +P+AIK                    V ++DP   K           
Sbjct: 289 GIVAAEAQNPRKNIPKAIKLTMYRIIIFYVITILLLTMCVAYNDPLLLKATGQSTSAAAS 348

Query: 366 PFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKH 425
           PF++AI+NSG  +LPHIFN  +L+ ++SA NS++YV SR ++ LA    AP++FG T K 
Sbjct: 349 PFVVAIENSGINILPHIFNVCVLAFVLSAANSDLYVASRSLYSLAIDNKAPKFFGKTNKW 408

Query: 426 GVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEH 485
           G+PY ++ F++AF  LA++ VSS  +  FN+ +N V + G  +W+ I + ++ F +  + 
Sbjct: 409 GIPYWSLAFSTAFSCLAYMNVSSSASNVFNYFVNAVSIFGVISWICILVTYIHFDKACKA 468

Query: 486 RGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAF-APTFNGSDFVAAYI 537
           +G+ + +  + A   P+ AY+A          + FT F    F+  +F+  YI
Sbjct: 469 QGMDKSNFTYVAPWQPYGAYFALFFCCVLALVKNFTVFLGGQFDYKNFITGYI 521

>Kwal_26.6940 s26 (133377..135089) [1713 bp, 570 aa] {ON} YOR348C
           (PUT4) - 1:1 [contig 46] FULL
          Length = 570

 Score =  266 bits (679), Expect = 1e-80,   Method: Compositional matrix adjust.
 Identities = 166/522 (31%), Positives = 253/522 (48%), Gaps = 21/522 (4%)

Query: 89  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEM 148
           +K+ L+ RH                  S+ L   GP G L +Y+ ++ +++ V  +LGEM
Sbjct: 49  LKQGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNALGEM 108

Query: 149 -----AXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
                                   PS+G A G+ Y++ + I  A E +    ++ +WT  
Sbjct: 109 VCYLPGSGTDSGGSISKLVSRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTV 168

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGP- 262
           VP +AWI I+  ++T++N  PVKFYGE EFW A +K++ I+G L     +  G G +   
Sbjct: 169 VPKAAWITIFLGVVTMLNFGPVKFYGESEFWFAILKILCIVGLLFVSFILFWGGGPSHDR 228

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKT 321
           +GFRYW+ PG +   I +     GRFL   + +I   F +  G ELV +T+ EA + R+ 
Sbjct: 229 LGFRYWQKPGAFAYHITTGNT--GRFLDVWTGVIKGGFAFILGPELVAVTSSEAMDQRRN 286

Query: 322 VPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDP----KLXXXXXXXXXXPFIIAIQNSGTK 377
           + +A ++ +                 V  +DP     L          PF+IAIQN+  K
Sbjct: 287 IEKASRRFAYRLIFFYVASALAIGVIVAQNDPVLRDALASGKAGAASSPFVIAIQNAHIK 346

Query: 378 VLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSA 437
           +LPHI NA ILS+  S+GNS ++  SR +  +A+  +AP+ F    + GVPY AV  ++A
Sbjct: 347 ILPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGVAPKMFKKINRAGVPYNAVAVSAA 406

Query: 438 FGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKA 497
           F  LA+L VSSG AKAF W  NI  ++GF  W+ I +A++RF + +  RG+  D +PFK+
Sbjct: 407 FSCLAYLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLRFRKAIFFRGL-YDRVPFKS 465

Query: 498 ALMPWLAYYAXXXXXXXXXXQGFTAFAPTF-NGSDFVAAYIXXXXXXXXXXXXQLYFRCK 556
              P+  Y+            G+  F P F  G+DFVAAYI            ++Y R  
Sbjct: 466 PFQPYGTYFFIIVVSIICLTNGYATFIPRFWKGADFVAAYITLPVFVVLWVGHKIYTRTL 525

Query: 557 LYWSLD--EVXXXXXXXXXXXXXWEDSA----PKTFWDRFWD 592
             W +   EV              E  A    P + W++F D
Sbjct: 526 STWVIPVAEVDVTTGLAEIEELTKELDALRVPPNSAWEKFMD 567

>KLTH0D01474g Chr4 (139116..140990) [1875 bp, 624 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 624

 Score =  264 bits (674), Expect = 2e-79,   Method: Compositional matrix adjust.
 Identities = 163/484 (33%), Positives = 241/484 (49%), Gaps = 15/484 (3%)

Query: 89  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEM 148
           +K+ L+ RH                  S+ L   GP G L +Y+ ++ +++ V  SLGEM
Sbjct: 105 LKKGLQSRHIQLIALGGVIGTGLFVGTSSTLSTCGPAGLLTSYIIISLVIYPVMNSLGEM 164

Query: 149 -----AXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
                                   PS+G A G+ Y++ + I  A E +    ++ +WT A
Sbjct: 165 VCFLPGSNGQSGGSISKIVTRYADPSLGFATGWNYYYCYVILIAAECTAASGVVTYWTTA 224

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGP- 262
           VP  AWI I+  ++T++N  PVK YGE EFW A +K++ I+G L     +  G G T   
Sbjct: 225 VPKGAWIAIFLGVVTVLNFSPVKIYGETEFWFAILKILCIVGLLFVSFILFWGGGPTHDR 284

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKT 321
           +GFRYW++PG +   I +     GRFL   + +I   F +  G ELV IT+ EA + R+ 
Sbjct: 285 LGFRYWQHPGAFAYHITTGNT--GRFLDIWTGVIKGGFAFILGPELVAITSSEALDARRN 342

Query: 322 VPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDP----KLXXXXXXXXXXPFIIAIQNSGTK 377
           + +A ++ +                 V   DP     L          PF+IAIQN+  K
Sbjct: 343 IEKASRRFAYRLVFFYVASALAIGVIVSRTDPVLKNALAEGKAGAGSSPFVIAIQNAHIK 402

Query: 378 VLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSA 437
           VLPHI NA ILS+  S+GNS ++  SR +  +A+   APR  G   + GVPY AV  ++A
Sbjct: 403 VLPHIINACILSSAWSSGNSFMFAASRSLLSMAEDGNAPRILGRINRQGVPYYAVALSAA 462

Query: 438 FGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKA 497
           F  LAFL VSSG AKAF W  NI  ++GF  W+ I +A+++F + +  RG+  + +PFK+
Sbjct: 463 FSCLAFLNVSSGSAKAFTWFSNISTISGFIGWICIGVAYLQFRKAVFFRGL-YERVPFKS 521

Query: 498 ALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKL 557
            L P+  Y+            G+ +F   +N SDFVAAYI            ++Y R   
Sbjct: 522 PLQPYGTYFFIVVVSLICLTNGYASFV-NWNASDFVAAYITLPIFVVLWVGHKIYTRTWS 580

Query: 558 YWSL 561
            W L
Sbjct: 581 TWLL 584

>TBLA0A07060 Chr1 complement(1737650..1739527) [1878 bp, 625 aa]
           {ON} 
          Length = 625

 Score =  262 bits (670), Expect = 1e-78,   Method: Compositional matrix adjust.
 Identities = 153/456 (33%), Positives = 236/456 (51%), Gaps = 8/456 (1%)

Query: 89  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEM 148
           +K+ L+ RH                   T L  AGP    IAY F+  +VF    ++GEM
Sbjct: 99  LKKNLQARHVSMIAIGGSLGTGLLIGTGTSLSAAGPASMFIAYSFVGILVFFTMAAIGEM 158

Query: 149 AXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW--TDAVPL 206
           A                  P++G A GY Y F + I    +L+    +IQ+W   D V  
Sbjct: 159 ASYIPMDGFTSYASRYVD-PALGFAVGYCYLFKYLILCPNQLTAASLVIQYWIDRDTVNP 217

Query: 207 SAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGP-VGF 265
             WI I+  ++ I+N+  VKF+GEFEFW++S KV+ ++G ++    ++ G G     +GF
Sbjct: 218 GVWITIFLVVIVIINVAGVKFFGEFEFWLSSFKVLVMLGLILLMFILMLGGGPDHDRLGF 277

Query: 266 RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRA 325
           RYW++PG + P   +   + G+F+ +VS  + A F Y G EL GI A EA NPRK+VPRA
Sbjct: 278 RYWQHPGAFKPYSDAIDGSVGKFVAFVSVFVYALFAYLGIELTGIVAAEAYNPRKSVPRA 337

Query: 326 IKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX---XXXXXXPFIIAIQNSGTKVLPHI 382
           +K                    V ++DP+L             PF++AIQNSG +VLPHI
Sbjct: 338 VKLTVWRIVIFYLVTIFLLGMCVAYNDPRLLAAKGAGTSAAASPFVVAIQNSGIRVLPHI 397

Query: 383 FNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALA 442
           FNA +L  + SA NS++YVGSR ++ LA    AP  F  TT  G+P+ ++     F  LA
Sbjct: 398 FNACVLIFVFSACNSDLYVGSRSLYSLAVDGKAPAIFKRTTSWGLPHYSLGVCVLFALLA 457

Query: 443 FLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPW 502
           ++ VSSG A+ FN+ +N+V + G  +W+ I I ++ F++ ++ +G+ R    + A   P+
Sbjct: 458 YMNVSSGSAQVFNYFVNVVSIFGLLSWICIFITYIGFMRAVKVQGVDRSKFAYSAPFQPY 517

Query: 503 LAYYAXXXXXXXXXXQGFTAF-APTFNGSDFVAAYI 537
             Y++          + FT F   +F+  +F+  YI
Sbjct: 518 GTYFSLAWCVFIAFIKNFTVFLGHSFDYKNFITGYI 553

>Smik_6.473 Chr6 complement(778327..780147) [1821 bp, 606 aa] {ON}
           YPL265W (REAL)
          Length = 606

 Score =  261 bits (667), Expect = 2e-78,   Method: Compositional matrix adjust.
 Identities = 164/496 (33%), Positives = 246/496 (49%), Gaps = 8/496 (1%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           +D   +  G  ++  +K+ELK RH                   T L   GPV  LIAY F
Sbjct: 65  DDSFAIADGKDENTRLKKELKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAF 124

Query: 134 MATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVV 193
           +  +VF     LGEMA                  P++G A GY Y F + I    +L+  
Sbjct: 125 VGLLVFFTMACLGEMASYIPLDGFTSYASRYVD-PALGFAIGYTYLFKYFILPPNQLTAA 183

Query: 194 GQIIQFW--TDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCL 251
             +IQ+W   D V    WI I+  ++  +N+  VKF+GEFEFW++S KV+ ++G ++   
Sbjct: 184 ALVIQYWISRDRVNPGVWITIFLVVIVAINIVGVKFFGEFEFWLSSFKVMVMLGLILLLF 243

Query: 252 CMVCGAGVT-GPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGI 310
            ++ G G     +GFRYWR+PG +     +   + G+F  +V+  + + F+Y G EL GI
Sbjct: 244 IIMLGGGPDHDRLGFRYWRDPGAFKEYSTAITGSTGKFTSFVAVFVYSLFSYTGIELTGI 303

Query: 311 TAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXX---XXXXXXXPF 367
              EA NPRK+VP+AIK                    V ++DP+L             PF
Sbjct: 304 VCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPF 363

Query: 368 IIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGV 427
           ++AIQNSG KVLPHIFNA +L  + SA NS++YV SR ++ LA    AP+ F  T+K GV
Sbjct: 364 VVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGV 423

Query: 428 PYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRG 487
           PY A++ +  F  LA++ VSSG AK FN+ +N+V + G  +W+ I I ++ F +    +G
Sbjct: 424 PYNALILSVLFCCLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQG 483

Query: 488 ISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAF-APTFNGSDFVAAYIXXXXXXXXX 546
           I +    + A    + AY+A          + FT F    F+   F+  YI         
Sbjct: 484 IDKSKFAYVAPGQRYGAYFALSFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYILSW 543

Query: 547 XXXQLYFRCKLYWSLD 562
              +L ++ K+  S D
Sbjct: 544 AGYKLIYKTKVIKSTD 559

>Kwal_33.15545 s33 complement(1149997..1151727) [1731 bp, 576 aa]
           {ON} YPL265W (DIP5) - dicarboxylic amino acid permease
           [contig 290] FULL
          Length = 576

 Score =  259 bits (662), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 161/489 (32%), Positives = 247/489 (50%), Gaps = 11/489 (2%)

Query: 79  VDQGVVQDAE---VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMA 135
           V +GV    E   +K+EL+ RH                   + L +AGPV  LI+Y F+ 
Sbjct: 37  VSEGVDGKHEGIRLKKELEARHVSMIAIGGSLGTGLLIGTGSSLASAGPVSILISYSFVG 96

Query: 136 TIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQ 195
            +V++V   LGEMA                  P++G A GY Y F + I    +L+    
Sbjct: 97  LLVYTVMSCLGEMAAFIPLDGFTSYASRYVD-PAVGFAVGYSYLFKYFIVTPNQLTAGAM 155

Query: 196 IIQFWT--DAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCM 253
           ++QFW   D V    WI I+  ++ ++N   V+F+GEFEFW++S+KV+ ++G ++    +
Sbjct: 156 VMQFWVSRDRVNPGVWITIFLALIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFII 215

Query: 254 VCGAGVT-GPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITA 312
           + G G      GFR+WR+PG + P   +   ++G+F+ + S    A F Y GTEL GI A
Sbjct: 216 MLGGGPNHDRTGFRFWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVA 275

Query: 313 GEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKL---XXXXXXXXXXPFII 369
            EA NPR++VPRAIK                    V ++DP+L             PF++
Sbjct: 276 AEAKNPRRSVPRAIKLTLYRIVVFYVITILLLGMTVAYNDPRLLKAKKMATSAAASPFVV 335

Query: 370 AIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPY 429
           AI+N+   VLPHIFN  +L  + SA NS++YV SR ++GLA    APR F  T K GVPY
Sbjct: 336 AIENASIPVLPHIFNVCVLVFVFSACNSDLYVASRSLYGLAIDGKAPRIFATTNKWGVPY 395

Query: 430 IAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGIS 489
            ++  +  F  LA++ VSSG A+ FN+ +N+V + G  +W+ I I ++RF + +  +   
Sbjct: 396 YSLGLSVLFCLLAYMNVSSGSAQVFNYFVNVVSIFGLLSWITILITYIRFDKAIRVQFGD 455

Query: 490 RDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAF-APTFNGSDFVAAYIXXXXXXXXXXX 548
           +  L + AA  PW  Y A          + +T F    F+   F++ YI           
Sbjct: 456 KSSLSYTAAFQPWSTYVALFFCCLIGLIKNYTVFLGHKFDYKTFISGYIGIPVYLICYVG 515

Query: 549 XQLYFRCKL 557
            ++ +R KL
Sbjct: 516 YKVVYRTKL 524

>SAKL0G14916g Chr7 complement(1277225..1278970) [1746 bp, 581 aa]
           {ON} uniprot|Q875Q9 Saccharomyces kluyveri DIP5
          Length = 581

 Score =  259 bits (662), Expect = 4e-78,   Method: Compositional matrix adjust.
 Identities = 154/457 (33%), Positives = 236/457 (51%), Gaps = 8/457 (1%)

Query: 88  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGE 147
            +K+EL+ RH                   T L  AGPV  LIAY F+  +V+ V   LGE
Sbjct: 54  RLKKELEARHVSMIAIGGSLGTGLLIGTGTSLSLAGPVSILIAYSFVGFLVYIVMTCLGE 113

Query: 148 MAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWT--DAVP 205
           MA                  P++G A GY Y F + I    +L+    ++Q+W   + V 
Sbjct: 114 MATYIPLDGFTSYASRYCD-PALGFAVGYSYLFKYLIITPNQLTAAALVLQYWVSREKVN 172

Query: 206 LSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGP-VG 264
              WI I+  I+  +N+  VKF+GEFEFW++S KV+ ++  ++    ++ G G +   +G
Sbjct: 173 PGVWITIFLVIIVTINVVGVKFFGEFEFWLSSFKVLVMLCLIVLLFVIMLGGGPSHDRLG 232

Query: 265 FRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 324
           FR++++PG + P   +   ++G+F+ +V+  + A F Y GTEL GI A E  NPR+ VPR
Sbjct: 233 FRFYKDPGAFRPYSEAISGSKGKFVSFVAVFVYALFAYLGTELCGIVAAECKNPRRNVPR 292

Query: 325 AIKKVSXXXXXXXXXXXXXXXXXVPFDDPKL---XXXXXXXXXXPFIIAIQNSGTKVLPH 381
           AIK                    V ++DP L             PF++AI+N+G  VLPH
Sbjct: 293 AIKLTLYRIVVFYLVTIFLLGMTVAYNDPLLLQAKKKSTSAAASPFVVAIKNAGIPVLPH 352

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
           IFNA +L  + SA NS++YV SR ++GLA    AP+ F  T K GVPY +++    F  L
Sbjct: 353 IFNACVLMFVFSACNSDLYVASRSLYGLAIDNKAPKIFAKTNKWGVPYNSLILCILFCLL 412

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
           A++ VSSG A+ FN+ +N+V + G  +W+ I I ++ F + L  +G+ +  L + A L  
Sbjct: 413 AYMNVSSGSAQVFNYFVNVVSIFGLMSWIAILITYIYFDRALRAQGVDKSTLAYAAPLAS 472

Query: 502 WLAYYAXXXXXXXXXXQGFTAF-APTFNGSDFVAAYI 537
             AY+A          + FT F    F+  +F+  YI
Sbjct: 473 KGAYFALFFCCLIALIKNFTVFLGHKFDYKNFITGYI 509

>TPHA0H02850 Chr8 complement(676524..678329) [1806 bp, 601 aa] {ON}
           Anc_7.44 YOR348C
          Length = 601

 Score =  259 bits (663), Expect = 6e-78,   Method: Compositional matrix adjust.
 Identities = 160/527 (30%), Positives = 254/527 (48%), Gaps = 26/527 (4%)

Query: 89  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEM 148
           +K+ LK RH                  S+ L   GP G  IAY  ++++++ +  ++GEM
Sbjct: 75  LKQGLKSRHVQLIALGGCIGTGLFVGTSSTLHTCGPAGLFIAYCIISSVIYPIMNAVGEM 134

Query: 149 AXX-----XXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
                                    S+  A G+ Y++ + I  A E +    ++++WT A
Sbjct: 135 VCYLPGDGHDSAGSVTHLVKRYVDESLAFATGWNYFYCYVILVAAECTAAAGVVEYWTLA 194

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGP- 262
           VP +AWI I+  I+ ++NM  VK++GE EFW ASIK++ IMG +I    +  G G +   
Sbjct: 195 VPKAAWITIFLAIIFLLNMSSVKYFGETEFWFASIKILCIMGLIILSFILFWGGGPSHDR 254

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKT 321
           +GFRYW+NPG +   +    +  G FL   S +I  AF +  G ELV +T+ E ++ R+ 
Sbjct: 255 LGFRYWKNPGAFAHHVTDGSL--GNFLDIYSGIIKGAFAFILGPELVALTSSECSDQRRN 312

Query: 322 VPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXX----XXPFIIAIQNSGTK 377
           + +A K+                   V ++DP L              PF+I IQN+G +
Sbjct: 313 IAKASKRFIYRLMFFYILGTLAIGVIVAWNDPVLASALSNNTPGAGSSPFVIGIQNAGIE 372

Query: 378 VLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSA 437
           VLPHI NA IL++  S+GN+ ++  SR +F +A+   AP+ FG   K+GVPY+AV+ ++ 
Sbjct: 373 VLPHIINACILTSAWSSGNAFMFASSRSLFTMAQNGTAPKIFGRINKYGVPYMAVILSTL 432

Query: 438 FGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKA 497
              LA+L  SS  A+ F WL NI  ++GF  W+   IA++RF + + +  +  D +PFK 
Sbjct: 433 ISCLAYLNASSSAARVFTWLSNISTISGFLGWICACIAYLRFRKAIFYNNL-YDRMPFKT 491

Query: 498 ALMPWLAYYAXXXXXXXXXXQGFTAFAPTF-NGSDFVAAYIXXXXXXXXXXXXQLYFR-- 554
              P+L  ++           G+  F P F N SDF+AAYI            ++Y    
Sbjct: 492 WGQPYLILWSLTVVSIITITNGYQTFIPKFWNVSDFIAAYITLPIFLALYVGHKVYNHFK 551

Query: 555 -----CKLYWSLDEVXXXXXXXXXXXXXWEDSA----PKTFWDRFWD 592
                 KL +S++++              E       P   W+RF D
Sbjct: 552 NDYPLMKLAYSVEDIDVITGLDEIETKTCELDENRILPTNRWERFID 598

>SAKL0F09790g Chr6 (750158..751834) [1677 bp, 558 aa] {ON} similar
           to uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline-specific permease (also capable of transporting
           alanine and glycine) putative proline- specific permease
          Length = 558

 Score =  256 bits (655), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 163/527 (30%), Positives = 251/527 (47%), Gaps = 12/527 (2%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           ++ E  ++     +  +++ L  RH                  S+ L N GP+   ++++
Sbjct: 30  NQLESQLEGTKCDENNLEKGLSSRHIQLIALGGCIGTGLFVGTSSTLHNCGPLPLFLSFV 89

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
            ++ IV+ V  +L EM                   PS+G A G+ Y +S++I  A ELS 
Sbjct: 90  IISFIVYPVMNTLAEMICYLPQQGTVPELTSRYVDPSLGFAAGWNYAYSYSILVATELSA 149

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
              ++Q+WTD V ++ WI I+  I+  +N  PVKFYGE EFW AS+K+I I+G LI  + 
Sbjct: 150 AAGVVQYWTDKVHVAVWITIFLVIVVGLNFAPVKFYGESEFWFASLKIICILGLLIVSIV 209

Query: 253 MVCGAGVTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY-QGTELVGI 310
           +  G   +   +GFRYW NPGP+   I       GRFL   +++I + F +    EL+G+
Sbjct: 210 IFFGGAPSHDRLGFRYWNNPGPFAYHITGGNT--GRFLDIWTAIIKSGFAFILSPELIGL 267

Query: 311 TAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXX----XXXXP 366
              EA + R+ + +A ++                   +  DDPKL              P
Sbjct: 268 ACVEAKDTRRNIEKASRRFIWRIIFFYITSTLCIGFILSRDDPKLIQALTSDAPGAASSP 327

Query: 367 FIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHG 426
           F+  I N+G  VL HI NAVILS+  S+ NS +Y  SR +  LAK   AP+ F    + G
Sbjct: 328 FVQGISNAGIPVLNHIINAVILSSAWSSANSFMYASSRSILALAKQGDAPKVFTRINRLG 387

Query: 427 VPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHR 486
           VPY AV  ++A   L +L  SS  A+ F WL NI  ++GF  W LI I ++RF + + + 
Sbjct: 388 VPYNAVALSTAVSCLTYLNASSSSAQVFTWLSNICTISGFIGWALIGITYLRFRKAIFYN 447

Query: 487 GISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTF-NGSDFVAAYIXXXXXXXX 545
            +  + +PFK+AL P+  Y+            G+  F P + N SDFVAAYI        
Sbjct: 448 NL-YERVPFKSALQPYFTYFFVVFVVLLCLTNGYATFIPKYWNASDFVAAYITLPIFFLL 506

Query: 546 XXXXQLYFRCKLYWSLDE--VXXXXXXXXXXXXXWEDSAPKTFWDRF 590
               +++F+ + Y    E  V              +   PK  W++F
Sbjct: 507 YLGHKIWFKTRWYIPFREIDVITGLADAEEEAKMTQPRTPKNMWEKF 553

>YPL265W Chr16 (41043..42869) [1827 bp, 608 aa] {ON}
           DIP5Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-glutamate
           and L-aspartate; also a transporter for Gln, Asn, Ser,
           Ala, and Gly
          Length = 608

 Score =  258 bits (658), Expect = 3e-77,   Method: Compositional matrix adjust.
 Identities = 161/496 (32%), Positives = 247/496 (49%), Gaps = 8/496 (1%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           +D   V  G  ++  ++++LK RH                   T L   GPV  LIAY F
Sbjct: 67  DDSFAVPDGKDENTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVAMLIAYAF 126

Query: 134 MATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVV 193
           +  +VF     LGEMA                  P++G A GY Y F + I    +L+  
Sbjct: 127 VGLLVFYTMACLGEMASYIPLDGFTSYASRYVD-PALGFAIGYTYLFKYFILPPNQLTAA 185

Query: 194 GQIIQFW--TDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCL 251
             +IQ+W   D V    WI I+  ++  +N+  VKF+GEFEFW++S KV+ ++G ++   
Sbjct: 186 ALVIQYWISRDRVNPGVWITIFLVVIVAINVVGVKFFGEFEFWLSSFKVMVMLGLILLLF 245

Query: 252 CMVCGAGVTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGI 310
            ++ G G     +GFRYWR+PG +     +    +G+F+ +V+  + + F+Y G EL GI
Sbjct: 246 IIMLGGGPNHDRLGFRYWRDPGAFKEYSTAITGGKGKFVSFVAVFVYSLFSYTGIELTGI 305

Query: 311 TAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXX---XXXXXXXPF 367
              EA NPRK+VP+AIK                    V ++DP+L             PF
Sbjct: 306 VCSEAENPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKSMSAAASPF 365

Query: 368 IIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGV 427
           ++AIQNSG +VLPHIFNA +L  + SA NS++YV SR ++ LA    AP+ F  T++ GV
Sbjct: 366 VVAIQNSGIEVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSRWGV 425

Query: 428 PYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRG 487
           PY A++ +  F  LA++ VSSG AK FN+ +N+V + G  +W+ I I ++ F +    +G
Sbjct: 426 PYNALILSVLFCGLAYMNVSSGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQG 485

Query: 488 ISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAF-APTFNGSDFVAAYIXXXXXXXXX 546
           I +    + A    + AY+A          + FT F    F+   F+  YI         
Sbjct: 486 IDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHKFDYKTFITGYIGLPVYIISW 545

Query: 547 XXXQLYFRCKLYWSLD 562
              +L ++ K+  S D
Sbjct: 546 AGYKLIYKTKVIKSTD 561

>Skud_16.12 Chr16 (20144..21967) [1824 bp, 607 aa] {ON} YPL265W
           (REAL)
          Length = 607

 Score =  257 bits (657), Expect = 5e-77,   Method: Compositional matrix adjust.
 Identities = 162/496 (32%), Positives = 246/496 (49%), Gaps = 8/496 (1%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           +D   V  G  +   ++++LK RH                   T L   GPV  LIAY F
Sbjct: 66  DDSFAVPDGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALMTGGPVAMLIAYAF 125

Query: 134 MATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVV 193
           +  +VF     LGEMA                  P++G A GY Y F + I    +L+  
Sbjct: 126 VGLLVFFTMACLGEMASYIPLDGFTSYASRYVD-PALGFAIGYTYLFKYFILPPNQLTAA 184

Query: 194 GQIIQFWT--DAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCL 251
             +IQ+W   D V    WI I+  ++  +N+  VKF+GEFEFW++S KV+ ++G ++   
Sbjct: 185 ALVIQYWVSRDRVNPGVWITIFMVVIVAINVIGVKFFGEFEFWLSSFKVLVMLGLILLLF 244

Query: 252 CMVCGAGVTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGI 310
            ++ G G     +GFRYWR+PG +     +    +G+F+ +++  + + F+Y G EL GI
Sbjct: 245 IIMLGGGPDHDRLGFRYWRDPGAFKEYSAAIGGGKGKFVSFLAVFVYSLFSYTGIELTGI 304

Query: 311 TAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXX---XXXXXXXPF 367
              EA NPRK+VP+AIK                    V ++DP+L             PF
Sbjct: 305 VCSEAQNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLISTKGKALSAAASPF 364

Query: 368 IIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGV 427
           ++AIQNSG KVLPHIFNA +L  + SA NS++YV SR ++ LA    AP+ F  T K GV
Sbjct: 365 VVAIQNSGIKVLPHIFNACVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFSKTNKWGV 424

Query: 428 PYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRG 487
           PY A++F+  F  LA++ VS+G AK FN+ +N+V + G  +W+ I I ++ F +    +G
Sbjct: 425 PYNALIFSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDKACRAQG 484

Query: 488 ISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAF-APTFNGSDFVAAYIXXXXXXXXX 546
           I +    + A    + AY+A          + FT F    F+   F+  YI         
Sbjct: 485 IDKSKFAYVAPGQRYGAYFALVFCIFIALIKNFTVFLGHKFDYKTFITGYIGLPVYVFSW 544

Query: 547 XXXQLYFRCKLYWSLD 562
              +L ++ K+  S D
Sbjct: 545 VGYKLIYKTKVIKSTD 560

>KLLA0E16281g Chr5 (1455271..1457088) [1818 bp, 605 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 605

 Score =  256 bits (653), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 158/477 (33%), Positives = 235/477 (49%), Gaps = 8/477 (1%)

Query: 88  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGE 147
            +K+ L+ RH                   + L  AGP   LIAY F+  +VF V   LGE
Sbjct: 78  RLKKALEARHVSMIAIGGSLGTGLLIGTGSSLALAGPAAILIAYAFVGLLVFFVMSCLGE 137

Query: 148 MAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTD--AVP 205
           MA                  P++G A GY Y F + I    +L+    +IQ+W D   V 
Sbjct: 138 MAAYIPLDGFTSYSTRYAD-PALGFAVGYAYLFKYWIIVPNQLTAGALVIQYWVDRDKVN 196

Query: 206 LSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPV-G 264
              WI I    +  +N   V+F+GE E++++++K+  ++G +I  L + CG G    V G
Sbjct: 197 PGVWITILLVAIITINFLGVRFFGEIEYYISAVKITVMLGLIILLLVLACGGGPNHEVLG 256

Query: 265 FRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 324
           F+YW+NPG +     +   A+GRF+ + S  + A F Y GTEL GI   E  NPRK VP+
Sbjct: 257 FKYWKNPGAFKEYSTAITGAKGRFVSFASVFVLALFAYLGTELCGIVVSECKNPRKAVPK 316

Query: 325 AIKKVSXXXXXXXXXXXXXXXXXVPFDDPKL---XXXXXXXXXXPFIIAIQNSGTKVLPH 381
           AIK                    VPF+DP L             PF++AI N+G  VLPH
Sbjct: 317 AIKLTMYRIIVFYLISIFLLGMCVPFNDPLLISAKSAKTSASASPFVVAIVNAGIPVLPH 376

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
           I NA IL  + SA NS++YV SR ++GLA    APR F  T K GVPY ++L    F  L
Sbjct: 377 IMNACILIFVFSAANSDLYVASRSLYGLAIDNKAPRIFAKTNKQGVPYWSLLVGVLFALL 436

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
           A++ VSSG ++ F + +N V + G  +W+ I I ++RF +    +GI +  L +++ L P
Sbjct: 437 AYMNVSSGSSEVFTYFVNCVSIFGLLSWISILITYIRFDKAFRVQGIDKSTLAYQSPLQP 496

Query: 502 WLAYYAXXXXXXXXXXQGFTAF-APTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKL 557
           + A+++          + F AF   TF+   F+  YI            +L+++ K+
Sbjct: 497 YGAWFSLFFCILIGLIKNFPAFLGDTFDYKSFITGYIGIPTYIISYIGYKLWYKTKI 553

>KNAG0E00390 Chr5 (61730..63529) [1800 bp, 599 aa] {ON} Anc_7.44
           YOR348C
          Length = 599

 Score =  255 bits (652), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 154/476 (32%), Positives = 233/476 (48%), Gaps = 20/476 (4%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           + +P+ ++G +Q       LK RH                  S+ L   GP G  I+Y+ 
Sbjct: 67  DADPFANEGSLQQG-----LKSRHIQMIALGGAIGTGLFVGTSSTLALCGPAGLFISYII 121

Query: 134 MATIVFSVTQSLGEMAXXX-----XXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFAL 188
           ++++V+ +    GEM                         S+G A  + Y++ + I  A 
Sbjct: 122 ISSVVYPIMCGFGEMVCYLPGNGNDASGSAAHLVARYVDKSLGFATAWNYYYCYIILVAA 181

Query: 189 ELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLI 248
           E +    ++++WT AVP   WI+I+  I+ I+N  PVK+YGE EFW ASIK++ I+G +I
Sbjct: 182 ECTAASGVVEYWTVAVPKGVWILIFLGIVVILNFGPVKYYGEAEFWFASIKILCIVGLII 241

Query: 249 YCLCMVCGAGVT-GPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY-QGTE 306
               +  G G     +GFRYW+ PG +   I+      GRFL   S +I   F +  G E
Sbjct: 242 LSFILFWGGGPNHDRLGFRYWQRPGAFTEHIMKGGF--GRFLDIYSGVIKGGFAFILGPE 299

Query: 307 LVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXX----X 362
           LV +T+ E  + R+ + +A ++                   V ++DP L           
Sbjct: 300 LVCLTSAECEDQRRNIAKAARRFIWRLMFFYVLGTLAISVIVAYNDPSLVSALASGKPGA 359

Query: 363 XXXPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGIT 422
              PF+I IQN+G +VLPHI NA ILS+  SAGN+ ++  +R +  +A+   APR FG  
Sbjct: 360 GSSPFVIGIQNAGIRVLPHIINACILSSAWSAGNAFMFASTRSLLTMARNGDAPRVFGKI 419

Query: 423 TKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQT 482
            + GVPY+A+  +     LAFL VSS  A  FNW  NI  ++GF  W+   +A++RF + 
Sbjct: 420 NRFGVPYVAISLSGGLSCLAFLNVSSSTADVFNWFSNISTISGFIGWICGCVAYIRFRKA 479

Query: 483 LEHRGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP-TFNGSDFVAAYI 537
           +   G+  D LPFK    P+  YY+           G+  F P  + GSDFVAAYI
Sbjct: 480 IFFNGM-YDRLPFKTWGQPYAVYYSLFVISLITLTNGYATFIPKNWKGSDFVAAYI 534

>Suva_16.40 Chr16 (56664..58484) [1821 bp, 606 aa] {ON} YPL265W
           (REAL)
          Length = 606

 Score =  255 bits (652), Expect = 2e-76,   Method: Compositional matrix adjust.
 Identities = 156/471 (33%), Positives = 238/471 (50%), Gaps = 8/471 (1%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           +D   V  G  +   ++++LK RH                   T L   GPV  LIAY F
Sbjct: 65  DDSFAVPDGKDETTRLRKDLKARHISMIAIGGSLGTGLLIGTGTALLTGGPVSMLIAYGF 124

Query: 134 MATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVV 193
           +  +VF     LGEMA                  P++G A GY Y F + I    +L+  
Sbjct: 125 VGLLVFFTMACLGEMASYIPLDGFTSYASRYVD-PALGFAIGYTYLFKYFILPPNQLTAA 183

Query: 194 GQIIQFWT--DAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCL 251
             +IQ+W   D V    WI I+  ++  +N+  V+F+GEFEFW++S KV+ ++G ++   
Sbjct: 184 ALVIQYWVSRDRVNPGVWITIFLVVIVAINIVGVRFFGEFEFWLSSFKVMVMLGLILLLF 243

Query: 252 CMVCGAGVT-GPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGI 310
            ++ G G     +GFRYWR+PG +     +   ++G+F+ + S  + + F+Y G EL GI
Sbjct: 244 IIMLGGGPDHDRLGFRYWRDPGAFKEYSTAITGSKGKFVAFASVFVYSLFSYTGIELTGI 303

Query: 311 TAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXX---XXXXXXXPF 367
              EA NPRK+VP+AIK                    V ++DP+L             PF
Sbjct: 304 VCSEAKNPRKSVPKAIKLTVYRIIVFYLCTVFLLGMCVAYNDPRLLSTKGKAMSAAASPF 363

Query: 368 IIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGV 427
           ++AIQNSG KVLPHIFN  +L  + SA NS++YV SR ++ LA    AP+ F  T+K GV
Sbjct: 364 VVAIQNSGIKVLPHIFNGCVLVFVFSACNSDLYVSSRNLYALAIDGKAPKIFAKTSKWGV 423

Query: 428 PYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRG 487
           PY A++ +  F  LA++ VS+G AK FN+ +N+V + G  +W+ I I ++ F +    +G
Sbjct: 424 PYYALMVSVLFCCLAYMNVSAGSAKIFNYFVNVVSMFGILSWITILIVYIYFDRACRAQG 483

Query: 488 ISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAF-APTFNGSDFVAAYI 537
           + +    + A    + AY+A          + FT F   TF+   F+  YI
Sbjct: 484 VDKSKFAYVAPGQRYGAYFALFFCILIALIKNFTVFLGHTFDYKTFITGYI 534

>NCAS0D02260 Chr4 (421966..423759) [1794 bp, 597 aa] {ON} 
          Length = 597

 Score =  254 bits (648), Expect = 7e-76,   Method: Compositional matrix adjust.
 Identities = 158/475 (33%), Positives = 235/475 (49%), Gaps = 14/475 (2%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           D+++ Y   G  +   +K+ L+ R                      L  AGPV  LIAY 
Sbjct: 55  DQNDSYNVDGKTEGTRLKKVLEGRVVSMVAIGGSLGTGLLIGTGNSLATAGPVSMLIAYA 114

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
           F+  +VF    SLGEMA                  P++G A GY Y F + I    +L+ 
Sbjct: 115 FVGLLVFFTMASLGEMASYIPLDGFTSYATRYAD-PALGFAVGYCYLFKYFILPPNQLTA 173

Query: 193 VGQIIQFW--TDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYC 250
              +IQ+W   + V    WI I+  ++  +N   V+F+GEFEFW++S KV+ +   +I  
Sbjct: 174 AALVIQYWIPREKVNPGVWITIFLVVIVAINTLGVQFFGEFEFWLSSFKVLVMFALIILL 233

Query: 251 LCMVCGAGVTGP-VGFRYWRNPGP---WGPGIISSQVAEGRFLGWVSSLINAAFTYQGTE 306
             ++ G G     +GFR+W++PG    + P I       G+F+ +VS  + A F Y GTE
Sbjct: 234 FILMLGGGPNHDRLGFRHWKHPGAFNNYSPAITGDT---GKFVAFVSVFVYATFAYLGTE 290

Query: 307 LVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKL---XXXXXXXX 363
           LVGI  GEA NPRK+VP+AIK                    V +DDP L           
Sbjct: 291 LVGIVVGEARNPRKSVPKAIKLTMYRIIIFYLISILLLGMCVGYDDPLLLEAKTKSTSAA 350

Query: 364 XXPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITT 423
             PF++AI NSG KVLPHIFNA +L  + SA NS++YV SR ++ LA    AP+ F  T 
Sbjct: 351 ASPFVVAIVNSGIKVLPHIFNACVLVFVFSACNSDLYVASRSLYSLAIDNKAPKIFARTN 410

Query: 424 KHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTL 483
           + G+PY ++  +  F  LA++ VSSG AK FN+ +N+V + G  +W+ I + ++ F + +
Sbjct: 411 RWGIPYYSLGLSVLFCLLAYMSVSSGSAKIFNYFVNVVSIFGLLSWICILVTYLAFDRAV 470

Query: 484 EHRGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAF-APTFNGSDFVAAYI 537
             +GI +    + A    + AY+A          + FT F    F+   F+  YI
Sbjct: 471 RAQGIDKSTFSYVAPGQRYGAYFALFFCSLIALIKNFTVFLGHQFDYKTFITGYI 525

>Ecym_2480 Chr2 complement(940315..942075) [1761 bp, 586 aa] {ON}
           similar to Ashbya gossypii ACL135W
          Length = 586

 Score =  250 bits (638), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 152/466 (32%), Positives = 235/466 (50%), Gaps = 10/466 (2%)

Query: 81  QGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFS 140
            G  +   +K++L+ RH                   + L  AGP+  LIAY  M  +VF+
Sbjct: 50  DGKHKGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSALSQAGPIAILIAYSIMGWVVFT 109

Query: 141 VTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW 200
           V   LGEMA                  P++G A GY Y F + +    +L+    ++Q+W
Sbjct: 110 VMSCLGEMAAYIPLDGFTSYATRYAD-PALGFAVGYTYLFKYLVLTPNQLTAAALVMQYW 168

Query: 201 TD--AVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAG 258
                V    WI ++  ++  +N+  VKF+GEFEFW++S KV+ ++  +   L +V G G
Sbjct: 169 VGRGKVNPGVWITVFLAVILTINIVGVKFFGEFEFWLSSFKVLVMLCVMTLLLVLVLGGG 228

Query: 259 VT-GPVGFRYWRNPGPWGP--GIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEA 315
            +   +GFRYW++PG + P  G +S    +G+F+ + S  + A F Y GTEL GI A E 
Sbjct: 229 PSHNRLGFRYWKDPGGFKPYSGAVSIPGGKGKFVSFASVFVYALFAYLGTELCGIVAAEC 288

Query: 316 ANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKL---XXXXXXXXXXPFIIAIQ 372
            NPR+ VPRAIK                    V ++DP L             P+++AI+
Sbjct: 289 KNPRRNVPRAIKLTLYRIVVFYLCTVFLLGLSVAYNDPLLLQTKKAKTSAAASPYVVAIK 348

Query: 373 NSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAV 432
           N+G  VLPHIFNA +L+ + SA NS++YVGSR ++GLA  K AP+ F  T   GVPY ++
Sbjct: 349 NAGIPVLPHIFNACVLTFVFSACNSDLYVGSRSLYGLAIDKKAPKIFAKTNSWGVPYNSL 408

Query: 433 LFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDD 492
              + F  LA++ VSS     F++ +N+  + G  +W+ I I ++ F +    +GI ++ 
Sbjct: 409 ALCTLFCCLAYMNVSSSAETMFSYFVNVTSIFGLLSWISILITYISFDRAFRVQGIDKNT 468

Query: 493 LPFKAALMPWLAYYAXXXXXXXXXXQGFTAF-APTFNGSDFVAAYI 537
           L ++A   P  A+ A          + FT F   TF+   F+  YI
Sbjct: 469 LSYQAPFQPVTAWIALGFCLMVALVKNFTVFLGDTFDYKTFITGYI 514

>CAGL0E05632g Chr5 complement(556856..558652) [1797 bp, 598 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348c PUT4 proline and gamma-aminobutyrate permease
          Length = 598

 Score =  250 bits (638), Expect = 2e-74,   Method: Compositional matrix adjust.
 Identities = 157/521 (30%), Positives = 246/521 (47%), Gaps = 19/521 (3%)

Query: 88  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGE 147
           E+K+ LK RH                  S+ L   GP G  I+Y  ++++++ + Q +GE
Sbjct: 74  ELKQGLKSRHVQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYCIISSVIYPIMQGIGE 133

Query: 148 MAXXXXXXXX-----XXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTD 202
           M                         S+G A+ + Y++ + I  A E +    ++++WT 
Sbjct: 134 MVCYLPGSGSKPEGFAAYLVGKYVDESLGFADAWNYYYCYVILVAAECTAASGVVEYWTT 193

Query: 203 AVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGP 262
           +VP +AWI I+   + I+N   VKFYGE EFW ASIK++ I+G +I    +  G G    
Sbjct: 194 SVPKAAWITIFLAAVVILNFTAVKFYGESEFWFASIKILCIVGLIILSFILFWGGGPNHD 253

Query: 263 -VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANPRK 320
            +GFRYW+NPG +   I       G FL   + +I   F +  G E++ +T+ E  + R+
Sbjct: 254 RLGFRYWQNPGGFAHHIRGGSF--GSFLDIYTGIIKGGFAFILGPEMIAMTSSEVEDQRR 311

Query: 321 TVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXX----XXPFIIAIQNSGT 376
            + +A ++                   V ++DP L              PF+I IQN+G 
Sbjct: 312 NIAKAARRFVWRLMFFYILGALSISVIVAYNDPALENALAQNKPGAGSSPFVIGIQNAGI 371

Query: 377 KVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTS 436
           KVLPHI NA ILS+  SAGN+ ++  SR +  +A+   APR F    + GVPY AV  +S
Sbjct: 372 KVLPHIINACILSSAWSAGNAFMFTSSRSLLTMAQNGQAPRIFAKVNRWGVPYYAVGLSS 431

Query: 437 AFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFK 496
           A   LA+L  SS  A  FNW  NI  ++GF  W+ + IA++RF + +   G+ +  LP+ 
Sbjct: 432 AISCLAYLNCSSSTADVFNWFSNISVISGFIGWICVCIAYIRFHKAILFHGM-QSRLPYT 490

Query: 497 AALMPWLAYYAXXXXXXXXXXQGFTAFAPTF-NGSDFVAAYIXXXXXXXXXXXXQLY--- 552
           A  MP+L Y+            G+  F P F +  +FVAAYI            ++Y   
Sbjct: 491 ARGMPYLIYWPLLVISIITLTNGYEVFIPRFWDAKNFVAAYITLPVFWVLWIGHRVYRRK 550

Query: 553 -FRCKLYWSLDEVXXXXXXXXXXXXXWEDSAPKTFWDRFWD 592
            F  K + S++E+              E  A +    ++W+
Sbjct: 551 IFTLKWWKSIEEIDVVTGVEEIEEKTRECDASRVLPTKWWE 591

>KNAG0L02470 Chr12 (440549..442465) [1917 bp, 638 aa] {ON} 
          Length = 638

 Score =  251 bits (640), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 149/463 (32%), Positives = 234/463 (50%), Gaps = 5/463 (1%)

Query: 79  VDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIV 138
           +  G  +   +K++LK RH                     LK AGPV +LIAY F+  +V
Sbjct: 55  IGDGKYEGIRLKKQLKSRHISMIAIGGSLGTGLLIATGESLKVAGPVSTLIAYTFVGIMV 114

Query: 139 FSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQ 198
           F     LGEMA                  P++G A GY Y   + I    +L+    ++Q
Sbjct: 115 FFTMACLGEMATFIPLDGFTSYASRYCD-PALGFAVGYAYLIKYFILPPNQLTAAAMVMQ 173

Query: 199 FWT--DAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYC-LCMVC 255
           +W   D V    W+ + + ++T++N+F V+F+GEFEFW++S+KV+ ++G +I   + M+ 
Sbjct: 174 YWVPRDTVNPGIWVTLVFAVITVINIFGVRFFGEFEFWLSSLKVLIMIGLIILLFVIMLG 233

Query: 256 GAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEA 315
           GAG    +GFRYW++PG +         + G+F+ +V+ L+   F Y G EL GI A EA
Sbjct: 234 GAGSHDRLGFRYWKHPGAFNDYSDDISGSLGKFVSFVAVLVLGVFAYLGIELTGIVAAEA 293

Query: 316 ANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXX-XXXXXPFIIAIQNS 374
           +NPR++VP+AIK                    VP++D KL           PF IAI N+
Sbjct: 294 SNPRRSVPKAIKLTFYRILVFYVVSIFLLGMCVPYNDEKLVTTNENSLTASPFSIAILNA 353

Query: 375 GTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLF 434
           G  VLP IFN  +L  + SA NS++YV SR ++ LA    AP+ F  T + G+PY ++  
Sbjct: 354 GITVLPDIFNGCLLIFVFSAANSDLYVASRNLYSLAVDNKAPKIFAHTNRWGIPYNSLFV 413

Query: 435 TSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLP 494
           +  F  LA++ VSS  A+ F + +N+V +AG   W+ I I ++ F + +  + + +    
Sbjct: 414 SCLFCLLAYMTVSSSSAQVFKYFVNVVSIAGLLTWISILITYICFDRAVRAQHVDKSTFA 473

Query: 495 FKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYI 537
           + A   P+ AY +          + FT F   F+   F+  YI
Sbjct: 474 YVAPFQPYGAYVSLFFCCLIAIIKNFTVFLGHFDYKTFITGYI 516

>NDAI0I02660 Chr9 complement(619959..621743) [1785 bp, 594 aa] {ON} 
          Length = 594

 Score =  249 bits (636), Expect = 3e-74,   Method: Compositional matrix adjust.
 Identities = 154/472 (32%), Positives = 237/472 (50%), Gaps = 8/472 (1%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           DE++ Y   G  +   +K+ LK RH                   T L  AGPV +LIAY 
Sbjct: 52  DENDSYNIDGKTEGTRLKKALKARHVSMIAIGGSLGTGLLIGTGTSLALAGPVSTLIAYA 111

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
           F+  +VF     LGEMA                  P++G A GY Y F + I    +L+ 
Sbjct: 112 FVGLLVFFTMACLGEMATYIPLDGFTSYASRYCD-PALGFAVGYAYLFKYFILPPNQLTA 170

Query: 193 VGQIIQFWTDAVPLS--AWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYC 250
              +IQ+W D   ++   W+ I+  ++  +N+F V+F+GEFEFW++S KV+ ++G ++  
Sbjct: 171 AALVIQYWVDKEKVNPGVWVTIFLVVIVSINVFGVRFFGEFEFWLSSFKVLVMLGLMLLL 230

Query: 251 LCMVCGAGVTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVG 309
             ++ G G     +GFRYWR+PG +     +     GRF+ +VS  + A + Y G EL G
Sbjct: 231 FILMLGGGPDHDRLGFRYWRHPGSFKEYSETITGDTGRFVAFVSVFVYATYAYLGIELTG 290

Query: 310 ITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDP---KLXXXXXXXXXXP 366
           I A EA NPRK++P+AIK                    V +DDP   K           P
Sbjct: 291 IVAAEAQNPRKSIPKAIKLTMYRIVIFYLISIFLLGMCVAYDDPLLIKAKNSSTSAAASP 350

Query: 367 FIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHG 426
           F++AI NSG   LPHI NA +L  + SA NS++YV SR ++ LA    AP+ F  T + G
Sbjct: 351 FVVAIINSGINALPHIINACVLVFVFSACNSDLYVSSRSLYSLAIDNKAPKIFAKTNRWG 410

Query: 427 VPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHR 486
           +PY A+  +  F  LA++ VSS  AK FN+ +N+V + G  +W+ I I ++ F + +  +
Sbjct: 411 IPYYALSVSVLFCLLAYMCVSSASAKIFNYFVNVVSIFGILSWISILITYICFDRAVRAQ 470

Query: 487 GISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFA-PTFNGSDFVAAYI 537
           G+ +    + A   P+ A+++          + FT F    F+  +F+  YI
Sbjct: 471 GVDKSTFAYVAPFQPYGAWFSLFFCCLIALIKNFTVFLNHQFDYKNFITGYI 522

>KNAG0L02460 Chr12 (437963..439729) [1767 bp, 588 aa] {ON} 
          Length = 588

 Score =  248 bits (632), Expect = 1e-73,   Method: Compositional matrix adjust.
 Identities = 158/472 (33%), Positives = 232/472 (49%), Gaps = 10/472 (2%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           D +E +   G   D  +K++LK RH                     L  AGPV  LI+Y 
Sbjct: 48  DTNEQF--DGKCSDQRLKKDLKARHVSMIAIGGSLGTGLLIGTGNSLAVAGPVSMLISYS 105

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
           F+  +VF V   +GEMA                  P++G A GY Y   + I    +L+ 
Sbjct: 106 FVGVLVFFVMSCIGEMAAYIPLDGFTSYASRYCD-PALGFAVGYAYLVKYFILPPNQLTA 164

Query: 193 VGQIIQFW--TDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYC 250
              +IQ+W   + V    WI I   ++ ++N F VKF+GEFEFW++S KVI ++G +I  
Sbjct: 165 AALVIQYWIPREKVNPGVWITIVLVVIVVINTFGVKFFGEFEFWLSSFKVIVMLGLIILM 224

Query: 251 -LCMVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVG 309
            + M+ G      +GFRYW++PG +     S     GRF+ +VS  +   F Y G EL G
Sbjct: 225 FIIMLGGTPTHDRLGFRYWKHPGAFKEYSKSIHGDIGRFVSFVSCFVYGLFCYLGIELTG 284

Query: 310 ITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKL---XXXXXXXXXXP 366
           I A EA NPRK +P+AIK                    V  +DP L             P
Sbjct: 285 IVAAEAENPRKNIPKAIKLTMWRIIIFYIITIFLLGMCVSSNDPLLLEAKTKSTSAAASP 344

Query: 367 FIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHG 426
           F++AI NSG + LPHIFNA +L  + SA NS++YV SR ++ LA    AP+ F  T + G
Sbjct: 345 FVVAIVNSGIEALPHIFNACVLMFVFSACNSDLYVASRNLYSLAIDNKAPKIFAKTNRFG 404

Query: 427 VPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHR 486
           +PY ++     F  LA++ VSSG AK FN+ +N+V + G   W+ I I ++ F + +  +
Sbjct: 405 IPYNSLGVAVLFCLLAYMSVSSGSAKIFNYFVNVVSITGVLTWISILITYICFDRAVRAQ 464

Query: 487 GISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFA-PTFNGSDFVAAYI 537
           GI +    + A L P+ AY++          + FT F    F+  +F+  YI
Sbjct: 465 GIDKSTFAYVAPLQPYGAYFSLFFCCLLALIKNFTVFLNHKFDYRNFITGYI 516

>Kpol_367.7 s367 (23929..25683) [1755 bp, 584 aa] {ON}
           (23929..25683) [1755 nt, 585 aa]
          Length = 584

 Score =  246 bits (629), Expect = 3e-73,   Method: Compositional matrix adjust.
 Identities = 155/498 (31%), Positives = 243/498 (48%), Gaps = 22/498 (4%)

Query: 86  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSL 145
           + ++K+ L  RH                  S  LK  GP G +I+Y+ ++T+++ +  +L
Sbjct: 55  NGKLKQGLSSRHVQFIALGGTIGTGLFVGTSVTLKTVGPGGLVISYIIISTVIYPIMNAL 114

Query: 146 GEMAXXX-----XXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW 200
           GEM                         S+  A G+ Y++ + I  A E +    ++ +W
Sbjct: 115 GEMVCYLPGNGEDSAGSVAHLVGRYVDKSLAFATGWNYYYCFVILVAAECTAASGVVTYW 174

Query: 201 TDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVT 260
           T +VP + WI I+  I+T++N   VK++GE EFW ASIK++ I+G ++    +  G G +
Sbjct: 175 TTSVPTAVWITIFLGIVTLLNFSAVKYFGETEFWFASIKILCILGLILVSFILFWGGGPS 234

Query: 261 G-PVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANP 318
              +GF YW++PG +   I     + G FL   + +I  AF +  G ELV +T+ E  + 
Sbjct: 235 HVRLGFHYWKDPGTFAHHITGG--SWGSFLDIYTGIIKGAFAFILGPELVALTSSECNDQ 292

Query: 319 RKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXX----XXXXPFIIAIQNS 374
           R+ + +A K+                   V ++DP L              PF+I IQN+
Sbjct: 293 RRNIAKASKRFIWRLMFFYILGTLSISVIVAYNDPVLLNALEEGKEGAASSPFVIGIQNA 352

Query: 375 GTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLF 434
           G KVLPHI NA ILS+  SAGNS ++  SR +  +A    AP+ F    + GVPY +V  
Sbjct: 353 GIKVLPHIINACILSSAWSAGNSFMFASSRSLMTMAHNGSAPKIFCKVNRFGVPYYSVGL 412

Query: 435 TSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLP 494
           ++    LAFL VSS  A+ F+W  NI  ++GF  W+   IA++RF + + +  +  D LP
Sbjct: 413 SAMLSCLAFLNVSSSTAQVFDWFSNISTISGFLGWICAIIAYLRFRKAIFYNNM-YDRLP 471

Query: 495 FKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTF-NGSDFVAAYIXXXXXXXXXXXXQLYF 553
           FK    P+L +Y+           G+  F P F +GSDFVAAYI            + + 
Sbjct: 472 FKTFGQPYLIWYSLLVISVITLTNGYQTFIPRFWSGSDFVAAYITLPLFLILWVGHKFWA 531

Query: 554 R-------CKLYWSLDEV 564
           R        KLY+ +DE+
Sbjct: 532 RYKHAVPLLKLYYPVDEI 549

>TDEL0H04070 Chr8 complement(698717..700450) [1734 bp, 577 aa] {ON}
           Anc_7.44 YOR348C
          Length = 577

 Score =  246 bits (627), Expect = 5e-73,   Method: Compositional matrix adjust.
 Identities = 147/469 (31%), Positives = 235/469 (50%), Gaps = 19/469 (4%)

Query: 85  QDAEVKRELKQ----RHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFS 140
           +DA+++ +L+Q    RH                  S+ L   GP G  I+Y+ ++T+++ 
Sbjct: 48  KDAKLEGKLQQGLSARHIQLIALGGAIGTGLFVGTSSTLHTCGPAGLFISYVIISTVLYP 107

Query: 141 VTQSLGEMAXXX-----XXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQ 195
           +  + GEM                        PS+  A G+ Y++ + I  A E +    
Sbjct: 108 IMNAFGEMVCYLPGNGDDSAGSVSHLVDRYVDPSLSFATGWNYFYCYVILVAAECTAASG 167

Query: 196 IIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVC 255
           ++++WTDAVP +AWI I+  I+ ++N+  VK+YGE EFW ASIKV+ I+G +I    +  
Sbjct: 168 VVKYWTDAVPTAAWITIFLSIVVLLNLCAVKYYGETEFWFASIKVLCIVGLIILSFILFW 227

Query: 256 GAGVTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY-QGTELVGITAG 313
           G G     +GFRYW+NPG +   I    +  G FL   S +I  AF +  G EL+ + + 
Sbjct: 228 GGGPNHDRLGFRYWKNPGGFAHHITGGNL--GNFLDVYSGIIKGAFAFILGPELIALASS 285

Query: 314 EAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXX----XXXXPFII 369
           E  + R+ + +A K+                   V  +DP L              PF+I
Sbjct: 286 ECKDQRRNIMKASKRFVWRLMFFYILGALSISVIVASNDPALTSALASGKPGAGSSPFVI 345

Query: 370 AIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPY 429
            IQN+G K+LPHI NA IL++  SAGN+ ++  SR +  +A    AP+ FG   + GVP+
Sbjct: 346 GIQNAGIKILPHIINACILTSAWSAGNAFMFASSRSLLTMASNGQAPKIFGKINRFGVPW 405

Query: 430 IAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGIS 489
           +AV F++    LA+L VSS  A  F W  NI  ++GF  W    +A++RF + +++ G+ 
Sbjct: 406 VAVTFSALISCLAYLNVSSSTADVFAWFTNISTISGFIGWDCGLVAYLRFRKAIKYNGL- 464

Query: 490 RDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTF-NGSDFVAAYI 537
            + LP+      ++ +++           G+  F P F N SDF+AAYI
Sbjct: 465 ENRLPYAPRFQQYMVWWSILVVTLVIFTNGYQVFIPRFWNVSDFIAAYI 513

>YOR348C Chr15 complement(986899..988782) [1884 bp, 627 aa] {ON}
           PUT4Proline permease, required for high-affinity
           transport of proline; also transports the toxic proline
           analog azetidine-2-carboxylate (AzC); PUT4 transcription
           is repressed in ammonia-grown cells
          Length = 627

 Score =  246 bits (629), Expect = 9e-73,   Method: Compositional matrix adjust.
 Identities = 153/498 (30%), Positives = 239/498 (47%), Gaps = 16/498 (3%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           E  P VD G  +  ++K+ L+ RH                  S+ L   GP G  I+Y+ 
Sbjct: 92  EKSPSVD-GDSEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYII 150

Query: 134 MATIVFSVTQSLGEMAX-----XXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFAL 188
           ++ +++ +  +LGEM                        PS+G A G+ Y++ + I  A 
Sbjct: 151 ISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDPSLGFATGWNYFYCYVILVAA 210

Query: 189 ELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLI 248
           E +    ++++WT AVP   WI I+  ++ I+N   VK YGE EFW ASIK++ I+G +I
Sbjct: 211 ECTAASGVVEYWTTAVPKGVWITIFLCVVVILNFSAVKVYGESEFWFASIKILCIVGLII 270

Query: 249 YCLCMVCGAGVTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY-QGTE 306
               +  G G     +GFRYW++PG +   +    +  G F    + +I  AF +  G E
Sbjct: 271 LSFILFWGGGPNHDRLGFRYWQHPGAFAHHLTGGSL--GNFTDIYTGIIKGAFAFILGPE 328

Query: 307 LVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXX----X 362
           LV +T+ E A+ R+ + +A ++                   VP++DP L           
Sbjct: 329 LVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAISVIVPYNDPTLVNALAQGKPGA 388

Query: 363 XXXPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGIT 422
              PF+I IQN+G KVLPHI N  IL++  SA N+ ++  +R +  +A+T  AP+  G  
Sbjct: 389 GSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRI 448

Query: 423 TKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQT 482
            K GVPY+AV  +     LA+L VSS  A  FNW  NI  ++GF  W+   IA++RF + 
Sbjct: 449 NKWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKA 508

Query: 483 LEHRGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTF-NGSDFVAAYIXXXX 541
           + + G+  D LPFK    P+  +++           G+  F P +   +DF+AAYI    
Sbjct: 509 IFYNGL-YDRLPFKTWGQPYTVWFSLIVIGIITITNGYAIFIPKYWRVADFIAAYITLPI 567

Query: 542 XXXXXXXXQLYFRCKLYW 559
                   +LY R    W
Sbjct: 568 FLVLWFGHKLYTRTWRQW 585

>KLTH0B01166g Chr2 (102227..103960) [1734 bp, 577 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease mediates high-affinity
           and high-capacity transport of L- glutamate and
           L-aspartate also a transporter for Gln Asn Ser Ala and
           Gly
          Length = 577

 Score =  245 bits (625), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 153/484 (31%), Positives = 241/484 (49%), Gaps = 8/484 (1%)

Query: 81  QGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFS 140
            G  +   +K+ L+ RH                   + L +AGP   LI+Y F+  +V++
Sbjct: 43  DGKHEGIRLKKALEARHVSMIAIGGSLGTGLLIGTGSSLASAGPASILISYSFVGLLVYT 102

Query: 141 VTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW 200
           V   LGEMA                  P++G A GY Y F + I    +L+    ++Q+W
Sbjct: 103 VMACLGEMAAFIPLDGFTSYASRYVD-PALGFAVGYCYLFKYFIVTPNQLTAGAMVMQYW 161

Query: 201 T--DAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAG 258
              + V    WI I+  ++ ++N   V+F+GEFEFW++S+KV+ ++G ++    ++ G G
Sbjct: 162 VSREKVNPGVWITIFLVLIVLINTVGVRFFGEFEFWLSSVKVLVMLGLILLLFIIMLGGG 221

Query: 259 VTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 317
                 GFRYWR+PG + P   +   ++G+F+ + S    A F Y GTEL GI A EA N
Sbjct: 222 PNHDRTGFRYWRDPGAFKPYSEAISGSKGKFVSFASVFALALFAYTGTELCGIVAAEAKN 281

Query: 318 PRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDP---KLXXXXXXXXXXPFIIAIQNS 374
           PR++VPRAIK                    V ++DP   K           PF++AI+N+
Sbjct: 282 PRRSVPRAIKLTLYRIVLFYVISILLLGMTVAYNDPLLIKAKKMSTSAAASPFVVAIKNA 341

Query: 375 GTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLF 434
           G  VLPHIFNA +L  + SA NS++YV SR ++GLA  + AP+ F  T   GVPY ++  
Sbjct: 342 GIPVLPHIFNACVLLFVFSACNSDLYVASRTLYGLAIDRKAPKIFAKTNGWGVPYYSLAV 401

Query: 435 TSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLP 494
           +  F  LA++ VSSG A+ FN+ +N+V + G  +W+ I I ++RF + +  +   +    
Sbjct: 402 SVLFCLLAYMNVSSGSAQIFNYFVNVVSIFGLLSWISILITYLRFHKAVIAQFGDKSGFS 461

Query: 495 FKAALMPWLAYYAXXXXXXXXXXQGFTAF-APTFNGSDFVAAYIXXXXXXXXXXXXQLYF 553
           + A   PW  + +          + +T F   TF+   F++ YI            +L  
Sbjct: 462 YTAPFQPWSTWVSLFFCCLIGLIKNYTVFLGHTFDYKTFISGYIGIPVYAICYVGYKLVH 521

Query: 554 RCKL 557
           R KL
Sbjct: 522 RSKL 525

>SAKL0B10956g Chr2 complement(949900..951618) [1719 bp, 572 aa] {ON}
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 572

 Score =  244 bits (624), Expect = 1e-72,   Method: Compositional matrix adjust.
 Identities = 148/464 (31%), Positives = 224/464 (48%), Gaps = 15/464 (3%)

Query: 86  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSL 145
           D  +K+ LK RH                  S+ L   GP G   +Y  ++ I++ V  +L
Sbjct: 48  DHTLKKGLKSRHIQLIALGGCIGTGLFVGTSSTLHACGPAGLFTSYCIISVIIYPVMNAL 107

Query: 146 GEMAXXX-----XXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW 200
           GEM                        PS+G A G+ Y++ + I  A E +    ++Q+W
Sbjct: 108 GEMVCYLPGDGSSSGGSISKLVTRYVDPSLGFATGWNYYYCYVILVAAECTAASGVVQYW 167

Query: 201 TDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVT 260
           T AVP  AWI I+  ++ ++N   VKFYGE EFW AS+K++ I+G L     +  G G  
Sbjct: 168 TTAVPKGAWITIFLGVVVLLNFCAVKFYGESEFWFASMKILCILGLLFVSFILFWGGGPH 227

Query: 261 GP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANP 318
              +GFRYW+ PG +   I S     GRFL   + +I   F +  G ELV +T+ EA + 
Sbjct: 228 HDRLGFRYWQKPGAFAYHITSGNT--GRFLDIWTGVIKGGFAFILGPELVALTSAEAQDA 285

Query: 319 RKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXX----XXXXPFIIAIQNS 374
           R+ + +A ++                   V ++D  L              PF+I IQN+
Sbjct: 286 RRNIQKASRRFVYRLIFFYVSSSLAIGCIVAYNDKTLSTALDQGKPGAGSSPFVIGIQNA 345

Query: 375 GTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLF 434
           G KVLPHI N  ILS+  S+GNS ++  SR +  +++   AP+  G   + GVPY AV  
Sbjct: 346 GIKVLPHIINVCILSSAWSSGNSFMFAASRSLLSMSQEGFAPKILGRVNRFGVPYAAVAL 405

Query: 435 TSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLP 494
           TS    +A+L VSS  A  F W  NI  ++GF  W+ I IA++RF + +  + +  + +P
Sbjct: 406 TSLLSCIAYLNVSSSTADVFTWFSNISTISGFIGWICIGIAYLRFRKAIFFQNL-YERVP 464

Query: 495 FKAALMPWLAYYAXXXXXXXXXXQGFTAFAP-TFNGSDFVAAYI 537
           FK    P+  ++            G+  F P  +N SDF+AAY+
Sbjct: 465 FKTPFQPYGTWFFIIAVSVICLTNGYAIFIPANWNVSDFIAAYV 508

>KAFR0C05160 Chr3 (1025799..1027553) [1755 bp, 584 aa] {ON} Anc_7.44
           YOR348C
          Length = 584

 Score =  243 bits (620), Expect = 6e-72,   Method: Compositional matrix adjust.
 Identities = 141/467 (30%), Positives = 221/467 (47%), Gaps = 20/467 (4%)

Query: 88  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGE 147
            +K  L+ RH                  S+ L N GP   +I+Y+ ++TIV+ +    GE
Sbjct: 55  NLKHGLQSRHIQLIALGGTIGTGLFVGTSSTLANCGPAALVISYIVISTIVYPIMNMFGE 114

Query: 148 MAXXX-------XXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW 200
           M                           S+G A  + Y++ + +  A E +    I+++W
Sbjct: 115 MVCYLPGNDDDDESVGYCAYLVSKYVDESLGFATSWNYYYCFIVLVATECTAASSIVEYW 174

Query: 201 TDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVT 260
           T  +P +  I ++  ++ ++N  PVKFYGE EFW A IK+  I G +I    + CG    
Sbjct: 175 TSKIPKAVLIFLFLGVIFLLNFLPVKFYGEAEFWFAIIKIFCITGLIIVAFVIFCGGAPN 234

Query: 261 GP----VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY-QGTELVGITAGEA 315
                 VGF YW+NP  +   + +  +  G FL   ++LI  AF +  G ELV +T+ E 
Sbjct: 235 NEDNSFVGFHYWKNPSSFRDYVTNGSL--GNFLDVYNALIKGAFAFILGPELVSLTSSEC 292

Query: 316 ANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXX----XXPFIIAI 371
            + R+ + +A ++                   VP++DP L              PF+I I
Sbjct: 293 VDQRRNIAKASRRFVYRLMFFYIFGALSISVIVPYNDPTLLNALALNKPGAGSSPFVIGI 352

Query: 372 QNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIA 431
           QN+G  +LPHI N  IL++ +SAGN+ ++  +R +  + K   APR F    +HGVPY+A
Sbjct: 353 QNAGITILPHIINFCILTSAMSAGNAFLFASTRALLTMGKNGSAPRIFSRINRHGVPYVA 412

Query: 432 VLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRD 491
           +  +     LAFL  S+  AK F W  NI  ++GF  W    IA++RF +T+++ G+  D
Sbjct: 413 LSLSIMIACLAFLNCSASSAKVFQWFSNISTISGFIGWFTGCIAYLRFRRTIDYNGL-YD 471

Query: 492 DLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTF-NGSDFVAAYI 537
            LPFK     +L +Y+           G+    P F N  DF+AAYI
Sbjct: 472 RLPFKTKGQVYLTWYSFVFVGILILTNGYMYIIPKFWNYQDFIAAYI 518

>AFR156W Chr6 (717642..719318) [1677 bp, 558 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YOR348C (PUT4)
          Length = 558

 Score =  239 bits (611), Expect = 7e-71,   Method: Compositional matrix adjust.
 Identities = 156/515 (30%), Positives = 240/515 (46%), Gaps = 20/515 (3%)

Query: 89  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEM 148
           + + L+ RH                  S  L N G    L++++ ++TIV+ +  SL EM
Sbjct: 46  LHKGLQSRHIQLIALGGCIGTGLFVGTSWTLHNCGAAPLLLSFILISTIVYPIMCSLAEM 105

Query: 149 AXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLSA 208
                              PS+G A G+ Y +++AI  A ELS    ++ +W + VP++A
Sbjct: 106 ICYLPQQGSVPELVSRYVDPSLGFATGWNYAYAYAILVAAELSAAASVVSYWDNPVPMAA 165

Query: 209 WIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMV-CGAGVTGPVGFRY 267
           WI I+  ++  +N   VK+YGE EFW ASIK+I I+G L+  + +   GA      GFRY
Sbjct: 166 WITIFLVVVVGLNFTAVKYYGEAEFWFASIKLICILGLLVVSVVIFFGGAPNHDRTGFRY 225

Query: 268 WRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKTVPRAI 326
           W+NPGP+   +     + GRFL    ++I +AF +    EL+GI   EA + R+   +A 
Sbjct: 226 WKNPGPFAMSLAPG--STGRFLDVWRAVIKSAFAFILSPELIGIACVEAQDTRRNTEKAS 283

Query: 327 KKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXX----XXXXPFIIAIQNSGTKVLPHI 382
           ++                   +   DPKL              PF+  I N+G  VL H+
Sbjct: 284 RRFIYRIIFFYVSCALMIGVILSRTDPKLIEALETGAPGAASSPFVQGIANAGIPVLDHV 343

Query: 383 FNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALA 442
            N  ILS+  SAGNS +Y  +R++  LA+   AP++     ++GVPY AV+  +    LA
Sbjct: 344 INVAILSSAWSAGNSFMYASTRMVLALAREGNAPKFLTKINRYGVPYNAVIVCTLVACLA 403

Query: 443 FLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDL----PFKAA 498
           +L V +  A  F WL NI  ++GF  W  + IA +RF      RGI  ++L    P++  
Sbjct: 404 YLNVKTTSANVFQWLSNICTISGFIGWFAMGIAFIRF-----RRGIVFNNLQSRIPYQGP 458

Query: 499 LMPWLAYYAXXXXXXXXXXQGFTAFAP-TFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKL 557
           L P++AYY            GF  F    +N  DFVAAY+            +L+FR + 
Sbjct: 459 LQPYIAYYFTFMTVVVCLTNGFHVFLKGRWNVVDFVAAYVTLPIYLVLYLGHKLWFRTRW 518

Query: 558 YWSLDE--VXXXXXXXXXXXXXWEDSAPKTFWDRF 590
           Y  +++  V                  PK  W++F
Sbjct: 519 YIPVEQIDVITGLVEAEEESKMTPPRIPKNLWEKF 553

>Ecym_8035 Chr8 (81434..83125) [1692 bp, 563 aa] {ON} similar to
           Ashbya gossypii AFR156W
          Length = 563

 Score =  239 bits (611), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 148/467 (31%), Positives = 227/467 (48%), Gaps = 12/467 (2%)

Query: 80  DQGVVQDAE--VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATI 137
           +  VV D E  +K+ L  RH                  S+ L   GP    ++++ ++T+
Sbjct: 40  NSDVVSDYEHNLKKGLSNRHIQLIALGGCIGTGLFVGTSSTLTQCGPAPLFLSFIIISTM 99

Query: 138 VFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQII 197
           V+ +  +L EM                   PS+G A G+ Y +S+A+  A EL+    I+
Sbjct: 100 VYCIMCTLAEMVCYLPQQGSVPELVTRYVDPSLGFAAGWNYAYSYAMLVATELTAAAGIV 159

Query: 198 QFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG- 256
           ++WTD VP   WI I+  ++ ++N   V+FYGE EFW AS+K+I I+  L+  + +  G 
Sbjct: 160 RYWTDQVPQGVWITIFLIVVVVLNFSAVRFYGESEFWFASLKIICILALLVVSIVIFFGG 219

Query: 257 AGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY-QGTELVGITAGEA 315
           A     VGFRYWRNPG +G  I    +  GRFL   +++I +AF +    ELVG+   EA
Sbjct: 220 APNHDRVGFRYWRNPGAFGYHITGGNL--GRFLDLWTAIIKSAFAFILSPELVGLACVEA 277

Query: 316 ANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXX----XXXXPFIIAI 371
            + R+ + +A ++                   V  +D  L              PF+  I
Sbjct: 278 KDTRRNIEKASRRFIYRIIFFYLSSSLMIGVIVAKNDHNLLLALEENRPGAASSPFVQGI 337

Query: 372 QNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIA 431
            NSG  VL H+ N  IL++  SAGNS  Y  SR +  L+K   AP+ F    + GVPY A
Sbjct: 338 ANSGIPVLNHVINVAILTSAWSAGNSFFYASSRSILALSKQGDAPKIFSKINRFGVPYNA 397

Query: 432 VLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRD 491
           V   S    LA+L VSS  +K F WL NI  ++GF  W LI +A++RF + +    +  D
Sbjct: 398 VFLCSLVACLAYLNVSSTSSKVFQWLSNICTISGFIGWFLIGVAYIRFRKAILFNRL-LD 456

Query: 492 DLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP-TFNGSDFVAAYI 537
            +P+++ L P+ AY+            G+  F    ++  DF+ +YI
Sbjct: 457 RIPYRSPLQPFSAYFFTIVVAIITLTNGYVVFIKGRWDYKDFLTSYI 503

>Ecym_4789 Chr4 complement(1531864..1533630) [1767 bp, 588 aa] {ON}
           similar to Ashbya gossypii AGR319W
          Length = 588

 Score =  240 bits (613), Expect = 8e-71,   Method: Compositional matrix adjust.
 Identities = 137/426 (32%), Positives = 213/426 (50%), Gaps = 8/426 (1%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           D+ E  +     +   + R+L  RH                   + L   GP   +IA+ 
Sbjct: 55  DDVEKAIFNTTKRSLNLNRDLSIRHLLTLAVGGAIGTGLFVNSGSALNIGGPASLVIAWT 114

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
            ++T +F++  +LGE+A                  PS+G A    Y   WA+   LEL  
Sbjct: 115 IISTCLFTIVNALGELAAVFPVVGGFNVYVTRLVDPSLGFAVNINYLAQWAVLLPLELVA 174

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
               I++W ++V   AW+ +++  + + ++  VK +GE EF ++ +K++AI GF I  + 
Sbjct: 175 ASITIRYWNNSVNSDAWVAVFYVCIFLASLLDVKSFGETEFILSMVKILAIGGFTILGIV 234

Query: 253 MVCGAG-VTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
           ++CG G   G +G +YW +PG +      SQ     F G  S  + AAF+Y GTELVG++
Sbjct: 235 LICGGGPKNGYIGAKYWNDPGSFVGASPGSQ-----FKGLCSVFVTAAFSYSGTELVGVS 289

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXX--XXXPFII 369
           A E+ANPR T+P+A K+                   V  DDPKL            P +I
Sbjct: 290 AAESANPRYTLPKASKRTFWLITLSYLLVLTIIGCLVRHDDPKLLSASSSVDVAASPLVI 349

Query: 370 AIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPY 429
           AI+N G + LP + NA+IL  IIS  NS++Y  SR M  +A+    PR F      G P 
Sbjct: 350 AIENGGIQGLPSLMNAIILIAIISVANSSVYACSRCMVSMAEIGNLPRIFTYIDNRGRPI 409

Query: 430 IAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGIS 489
           +A++FT  FG L+F+  S+   + F WL  + G++  F WL I+I+H+RF + L  +G S
Sbjct: 410 VAIIFTLVFGLLSFIAASNKQEEIFVWLSALSGLSTLFCWLAINISHIRFRRALNTQGYS 469

Query: 490 RDDLPF 495
            D+LP+
Sbjct: 470 LDELPY 475

>NDAI0E03800 Chr5 (829594..831459) [1866 bp, 621 aa] {ON} Anc_7.44
          Length = 621

 Score =  240 bits (613), Expect = 2e-70,   Method: Compositional matrix adjust.
 Identities = 151/482 (31%), Positives = 232/482 (48%), Gaps = 21/482 (4%)

Query: 74  EDEPYVDQGVVQ---DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIA 130
           +DE   +QG  +   + E+K+ LK RH                  S+ L N GP G  I+
Sbjct: 78  DDEAEKEQGKERSSSNGELKQGLKSRHIQLIALGGTIGTSLLVGTSSALANCGPAGLFIS 137

Query: 131 YLFMATIVFSVTQSLGEM-----AXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAIT 185
           YL ++T V+ +  +LGEM                        PS+G A  + Y++ + I 
Sbjct: 138 YLIISTFVYPIMNALGEMVCFLPGNGSDSAGSAAHLVHKYVDPSLGFAASWNYYYCFVIL 197

Query: 186 FALELSVVGQIIQFWT--DAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAI 243
            A E+S    +I++W   + VP  AWI I+  ++ I+N  PV  YGE EFW ASIK++ I
Sbjct: 198 VAAEVSAASGVIEYWAWAEHVPKGAWITIFLSLIVILNFLPVNVYGESEFWFASIKILCI 257

Query: 244 MGFLIYCLCMVCGAG--VTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFT 301
            G +I    +  G G    G +GFRYW+NPG +   I       G FL   + +I   F+
Sbjct: 258 TGLIILSFILFWGGGPKSDGILGFRYWKNPGSFAHHITGG--GGGNFLDIYTGIIKGGFS 315

Query: 302 Y-QGTELVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDP----KLX 356
              G ELV +T+ E A+ R+ + +A K+                   V ++DP     L 
Sbjct: 316 VILGPELVCLTSSECADQRRNIAKASKRFVWRLMFFYILGSLSIGVIVAYNDPVLQNALA 375

Query: 357 XXXXXXXXXPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAP 416
                    PF+I IQN+G + +PHI N  IL++  SAGN+ ++  SR +  +A+   AP
Sbjct: 376 QSKAGAGSSPFVIGIQNAGIRAVPHIVNFCILTSAWSAGNAYMFASSRSLLTMARNGNAP 435

Query: 417 RWFGITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAH 476
           + F    + GVPY AV  +     LA+L VSS  A  FNW  NI  ++GF  W+   +A+
Sbjct: 436 KIFCRINQLGVPYTAVGASLLLSCLAYLNVSSSTADVFNWFSNISTISGFIGWICACVAY 495

Query: 477 VRFIQTLEHRGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP-TFNGSDFVAA 535
           +RF + + +  ++   +PF+A    +  +Y+           G+  F P  +N  DF+AA
Sbjct: 496 IRFRKAITYNKLTH-RIPFRAKGQQYTIWYSLFWVSLITLTNGYAIFIPRNWNVKDFIAA 554

Query: 536 YI 537
           YI
Sbjct: 555 YI 556

>Ecym_6021 Chr6 (37898..39700) [1803 bp, 600 aa] {ON} similar to
           Ashbya gossypii AFR230C
          Length = 600

 Score =  239 bits (610), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 146/461 (31%), Positives = 230/461 (49%), Gaps = 11/461 (2%)

Query: 83  VVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVT 142
           +   + ++R+LK RH                  S  L+ AGP G LI +  MAT++  + 
Sbjct: 78  LTSQSPLQRKLKNRHLQMIAIGGAIGTGLFIGSSKALRTAGPAGILIGWGLMATMILCMC 137

Query: 143 QSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW-T 201
            SLGEMA                   S G AN   Y     +   LE+      + +W  
Sbjct: 138 LSLGEMAVTFPVSGGYTTYATRFIDESYGFANNINYMMQALVVLPLEIVAASITVDYWGP 197

Query: 202 DAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTG 261
            +   +A++ ++W  +  +NMF VK YGE EF  + IKV+ ++GF+I  + +VCG G T 
Sbjct: 198 KSQYRAAFVALFWLCIVSINMFGVKGYGEAEFVFSLIKVVTVIGFIILGVILVCGGGPTH 257

Query: 262 P-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 320
             +G ++W NPG +         A  +F G  S  + AAF++  TELVG+ A E  +PRK
Sbjct: 258 EYIGSKFWSNPGAF-----VGDTAGQKFKGICSVFVTAAFSFANTELVGLAAAETEDPRK 312

Query: 321 TVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX-XXXXXXXXXPFIIAIQNSGTKVL 379
           +VP+A K+V                  VP+ DP+L           PF++A++N G K L
Sbjct: 313 SVPKAAKQVFWRITLFYILSLLMVGLLVPYTDPRLLGSSIVDAAASPFVLALKNHGIKGL 372

Query: 380 PHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFG 439
           P + N VIL+ ++S GNS+++  SR +  L++    P  FG   + G P ++++F+SAFG
Sbjct: 373 PSVINVVILTAVLSVGNSSVFSCSRCLTALSEQGFLPNVFGYIDRKGRPLVSIIFSSAFG 432

Query: 440 ALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAAL 499
            L FL VS    + F+W+L++ G++  F WL IS+ H+RF + L  +  S D+L F + +
Sbjct: 433 LLCFLAVSHQVQEIFDWMLSLSGLSSLFIWLTISLCHIRFRKALSAQNRSIDELAFASPI 492

Query: 500 MPWLAYYAXXXXXXXXXXQGFTAFAPTF---NGSDFVAAYI 537
             W +YY+          Q + A  P     + S+F  AY+
Sbjct: 493 GIWGSYYSVFLIIVVLILQFWIALFPGHQKPSASNFFKAYL 533

>Suva_8.402 Chr8 complement(722727..724778) [2052 bp, 683 aa] {ON}
           YOR348C (REAL)
          Length = 683

 Score =  241 bits (614), Expect = 3e-70,   Method: Compositional matrix adjust.
 Identities = 156/539 (28%), Positives = 249/539 (46%), Gaps = 22/539 (4%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           E  P  D G      +K+ L+ RH                  S+ L   GP G  I+Y+ 
Sbjct: 148 EKSPSAD-GDAGPHRLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYII 206

Query: 134 MATIVFSVTQSLGEMAX-----XXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFAL 188
           ++ +++ +  +LGEM                         S+G A G+ Y++ + I  A 
Sbjct: 207 ISAVIYPIMCALGEMVCFLPGDGSDSAGSSANLVTRYVDASLGFATGWNYYYCYVILVAA 266

Query: 189 ELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLI 248
           E +    ++++WT AVP   WI I+  ++ ++N   VK YGE EFW ASIK++ I+G +I
Sbjct: 267 ECTAASGVVEYWTTAVPKGVWITIFLCVVVLLNFSAVKVYGESEFWFASIKILCIVGLII 326

Query: 249 YCLCMVCGAGVTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY-QGTE 306
               +  G G     +GFRYW++PG +   +    +  G F    + +I  AF +  G E
Sbjct: 327 LSFILFWGGGPKHDRLGFRYWQHPGSFAHHLAGGSL--GNFTDIYTGIIKGAFAFILGPE 384

Query: 307 LVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXX----X 362
           LV +T+ E A+ R+ + +A ++                   VP++DP L           
Sbjct: 385 LVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLAITVIVPYNDPSLVNALAQGKPGA 444

Query: 363 XXXPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGIT 422
              P++I IQN+G KVLPHI N  IL++  SA N+ ++  +R +  +A+T  AP+  G  
Sbjct: 445 GSSPYVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKI 504

Query: 423 TKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQT 482
            + GVPY+AV  +     LA+L VSS  A  FNW  NI  ++GF  W+   IA++RF + 
Sbjct: 505 NRFGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKA 564

Query: 483 LEHRGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTF-NGSDFVAAYIXXXX 541
           +   G+  D LPFK    P+  +++           G+  F P + N +DF+AAYI    
Sbjct: 565 IFFNGL-YDRLPFKTWGQPYTVWFSLTVVSIITITNGYAIFIPKYWNVADFIAAYITLPI 623

Query: 542 XXXXXXXXQLYFRCKLYW--SLDEVXXXXXXXXXXXXXWEDSA----PKTFWDRFWDVV 594
                   +LY R   +W  S+ E+              +       P TF ++F D +
Sbjct: 624 FLVLWLGHKLYTRTWNHWWHSVSEIDVTTGLVEIEEKSRDIEELRLPPATFKEKFMDAL 682

>Smik_15.532 Chr15 complement(932437..934332) [1896 bp, 631 aa] {ON}
           YOR348C (REAL)
          Length = 631

 Score =  239 bits (610), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 158/539 (29%), Positives = 250/539 (46%), Gaps = 22/539 (4%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           E  P V +G  +  ++K+ L+ RH                  S+ L   GP G  I+Y+ 
Sbjct: 96  EKSPSV-EGDNEPHKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPAGLFISYII 154

Query: 134 MATIVFSVTQSLGEMAX-----XXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFAL 188
           ++ +++ +  +LGEM                         S+G A G+ Y++ + I  A 
Sbjct: 155 ISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAA 214

Query: 189 ELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLI 248
           E +    ++++WT AVP   WI I+  ++ ++N+  VK YGE EFW ASIK++ I+G +I
Sbjct: 215 ECTAASGVVEYWTTAVPKGVWITIFLCVVVLLNLSAVKVYGESEFWFASIKILCIVGLII 274

Query: 249 YCLCMVCGAGVTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY-QGTE 306
               +  G G     +GFRYW++PG +   +    +  G F    + +I  AF +  G E
Sbjct: 275 LSFILFWGGGPNHDRLGFRYWQHPGAFAHHLTGGSL--GNFTDIYTGIIKGAFAFILGPE 332

Query: 307 LVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXX----X 362
           LV +T+ E A+ R+ + +A ++                   VP++DP L           
Sbjct: 333 LVCMTSAECADQRRNISKASRRFVWRLIFFYVLGTLAISVIVPYNDPSLVNALAQGKPGA 392

Query: 363 XXXPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGIT 422
              PF+I IQN+G KVLPHI N  ILS+  SA N+ ++  +R +  +A+T  AP+  G  
Sbjct: 393 GSSPFVIGIQNAGIKVLPHIINGCILSSAWSAANAFMFASTRSLLTMAQTGQAPKCLGRI 452

Query: 423 TKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQT 482
            + GVPY+AV  +     LA+L VSS  A  FNW  NI  ++GF  W+   IA++RF + 
Sbjct: 453 NRWGVPYVAVGVSFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWMCGCIAYLRFRKA 512

Query: 483 LEHRGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTF-NGSDFVAAYIXXXX 541
           + + G+  D LPFK    P+  + +           G+  F P +   +DF+AAYI    
Sbjct: 513 IFYNGL-FDRLPFKTWGQPYTVWASLIVVGIITLTNGYAIFIPKYWKIADFIAAYITLPI 571

Query: 542 XXXXXXXXQLYFRCKLYWSL--DEVXXXXXXXXXXXXXWEDSA----PKTFWDRFWDVV 594
                   +LY R    W L   E+              E       P +F D+F D +
Sbjct: 572 FLVLWFGHKLYTRTWSQWWLPVSEIDVTTGLIEIEEKSREIEEMRLPPSSFKDKFMDAL 630

>SAKL0C01232g Chr3 (110269..112110) [1842 bp, 613 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 613

 Score =  238 bits (608), Expect = 7e-70,   Method: Compositional matrix adjust.
 Identities = 142/459 (30%), Positives = 224/459 (48%), Gaps = 8/459 (1%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           + E   D G   D ++K+ +K RH                     L+N GP G +I Y  
Sbjct: 81  DKEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAI 140

Query: 134 MATIVFSVTQSLGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSV 192
           M + ++ + Q+ GE+A                   P++G +  ++Y   W     LEL  
Sbjct: 141 MGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVT 200

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
               I++WT +V    ++ I++ ++  +N+F  + Y E EF+  + KV+ I GFLI  + 
Sbjct: 201 ASITIKYWTTSVNPDIFVAIFYVVIITINVFGARGYAEAEFFFNTFKVLMISGFLILGII 260

Query: 253 MVCG-AGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
           + CG AG  G +G +YW +PG +     S       F G VS+L+ AAF +  TE + +T
Sbjct: 261 VNCGGAGNDGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEFIALT 315

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX-XXXXXXPFIIA 370
           A E ANPRK++P A KK+                  VP +  +L           P++IA
Sbjct: 316 AAEQANPRKSIPSAAKKILYRILVLYVGSIILIGFLVPHNSEELMGSGGSATHASPYVIA 375

Query: 371 IQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYI 430
           I + G KV+PH+ NAVIL ++IS GNS  Y  SR++  LA+   AP +     + G P +
Sbjct: 376 IASHGVKVVPHLINAVILLSVISMGNSAFYSSSRLLLTLAEQGYAPSFLKYVDREGRPTL 435

Query: 431 AVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISR 490
           A++ +S FG ++F+  S      F WLL I G++  F W  I ++H+RF + ++ +G S 
Sbjct: 436 AMVISSVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSL 495

Query: 491 DDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNG 529
            +L FK+ +  W +YYA          Q +TA AP   G
Sbjct: 496 GELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEG 534

>ZYRO0D17908g Chr4 (1486514..1488070) [1557 bp, 518 aa] {ON} similar
           to uniprot|P53388 Saccharomyces cerevisiae YPL265W DIP5
           Dicarboxylic amino acid permease, mediates high-affinity
           and high-capacity transport of L-glutamate and
           L-aspartate; also a transporter for Gln, Asn, Ser, Ala,
           and Gly
          Length = 518

 Score =  235 bits (600), Expect = 1e-69,   Method: Compositional matrix adjust.
 Identities = 140/485 (28%), Positives = 227/485 (46%), Gaps = 5/485 (1%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           EDE   ++   ++  + RELK R                    + L   GP+   IAYLF
Sbjct: 17  EDECESEEIDEKNGNLSRELKPRVVSLLTLGSAVGTGLIIGSGSALAKGGPISLFIAYLF 76

Query: 134 MATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVV 193
             +++  V  SL EMA                  P+ G A G+ Y+  +AI  +  L+  
Sbjct: 77  TGSLLCVVIFSLSEMASFAPMDKGFSGYLNRYVDPAFGFAAGWNYFLKYAIVLSANLTAF 136

Query: 194 GQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCM 253
           G +I +W   V +  W+ + +  +  +N   VK++GE E  +   K++ ++   I CL +
Sbjct: 137 GLVIGYWRPDVNVGVWVTVLYVTVFCVNFLAVKYFGEIEALLTVFKLLVLVIVYITCLII 196

Query: 254 VCGAGVTGPV-GFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITA 312
            CG        GFRYWR  G   P ++      G+FLGW + ++ + F + G+E++GI  
Sbjct: 197 TCGGAPNHTTTGFRYWRESGAL-PYLVGG--GTGKFLGWWACVVQSIFGFMGSEMIGIVY 253

Query: 313 GEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXV-PFDDPKLXXXXXXXXXXPFIIAI 371
           GE ANP+KT+P++   V                  + P +   +          PF+IAI
Sbjct: 254 GETANPKKTIPKSSMNVFFRIGFLYVFGVFILGLAISPVNSKLVHAHSTDANASPFVIAI 313

Query: 372 QNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIA 431
            +SG KVLP+  NA +L  IIS+ N++IY+ SR ++GLAK   AP+ F +  +  VP + 
Sbjct: 314 SSSGIKVLPNFVNAALLVFIISSANTDIYICSRQLYGLAKDGAAPKIFLLVNRFKVPVVG 373

Query: 432 VLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRD 491
            +  S  G LA++      A  F+++ + V V G   W  I IA++ + + ++ +GIS D
Sbjct: 374 CVTGSLLGFLAYMNTKKSAATVFSYITSTVSVFGILNWFYILIAYINYDRAIKAKGISID 433

Query: 492 DLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQL 551
           D+PF+    P+ AY             G+ AF   F+   F+ +YI            +L
Sbjct: 434 DIPFRMWFQPYAAYVTLFFVTIITFFNGYNAFIIKFHYKTFITSYIGVFANILMVIGYKL 493

Query: 552 YFRCK 556
           YF+ K
Sbjct: 494 YFKTK 498

>SAKL0D00836g Chr4 complement(65731..67536) [1806 bp, 601 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 601

 Score =  237 bits (604), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 150/473 (31%), Positives = 221/473 (46%), Gaps = 17/473 (3%)

Query: 89  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEM 148
           +KR LK RH                     L+  GP   +IA++   ++V+SV Q+LGE+
Sbjct: 89  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVVIAWIMTGSMVYSVVQALGEL 148

Query: 149 AXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW-TDAVPLS 207
           A                  PS G A  Y Y     IT  LEL      + +W  D+    
Sbjct: 149 AVALPVSGSYLSYVSRFIEPSFGFAIAYNYLIGNLITMPLELIAASITVNYWDVDSKYAD 208

Query: 208 AWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVT--GPVGF 265
           A++ +++ ++  +N+F VK YGE EF  + IKV AI+GF+I  + +VCG G +  G +G 
Sbjct: 209 AFVALFYIVIVGINLFGVKGYGEAEFVFSVIKVTAIVGFIILGIVLVCGGGPSDEGYIGA 268

Query: 266 RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRA 325
           RYW NPG +  G          F G+ +  + +AF++ G+E+  + A E  NPRK +PRA
Sbjct: 269 RYWYNPGGFAHG----------FKGFAAIFVTSAFSFAGSEMFALAAAETENPRKDLPRA 318

Query: 326 IKKVSXXXXXXXXXXXXXXXXXVPFDDPKL-XXXXXXXXXXPFIIAIQNSGTKVLPHIFN 384
            K+V                  VP+ D  L           PF+IAI  +G K LP + N
Sbjct: 319 AKQVFWRITLFYVISLTLIGCLVPYTDKHLFAASSVDASASPFVIAIARAGIKGLPSVVN 378

Query: 385 AVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFL 444
            VIL  ++S GN  +Y  SR +  LA     PR FG   + G P + +L  + FG L+FL
Sbjct: 379 VVILIAVLSVGNCCVYAASRAVLSLAHYGFLPRRFGYVDRKGRPLVGILLCAIFGLLSFL 438

Query: 445 EVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLA 504
             SS   + F+W+L I G+  FF W  I + H+RF + L  +G S D+L +KA    W +
Sbjct: 439 SASSNYGEVFDWMLAISGLNSFFIWGSICVCHLRFRRALSVQGRSTDELSYKAQTGIWGS 498

Query: 505 YYAXXXXXXXXXXQGFTAFAP---TFNGSDFVAAYIXXXXXXXXXXXXQLYFR 554
            Y           Q + A  P   + N + F +AY+            +LY R
Sbjct: 499 LYGIGLIFIVLCFQFWVALFPIGGSPNANHFFSAYLSLPVVIFFYTCHKLYTR 551

>Kwal_33.15407 s33 (1092383..1094146) [1764 bp, 587 aa] {ON} YGR191W
           (HIP1) - histidine permease [contig 290] FULL
          Length = 587

 Score =  235 bits (599), Expect = 8e-69,   Method: Compositional matrix adjust.
 Identities = 140/448 (31%), Positives = 216/448 (48%), Gaps = 8/448 (1%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           +D+   ++L  RH                   + L   GP   +I ++ ++T +F++  +
Sbjct: 66  EDSRYNKDLSVRHLLTLAVGGAIGTGLFVNSGSALTTGGPGSLVIDWVIISTCLFTIVNA 125

Query: 145 LGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAV 204
           LGE++                  PS G A    Y   WA+   LEL      I++W   +
Sbjct: 126 LGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNSTI 185

Query: 205 PLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVG 264
              AW+ I++ I+ + N+  VK +GE EF ++ +K++AI+GF I  + + CG G  G   
Sbjct: 186 NSDAWVAIFYTIIFLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPEGGYI 245

Query: 265 F-RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 323
             +YW NPG +  G  SSQ    RF G  S  + AAF+Y GTEL+ ++A E+ NPR T+P
Sbjct: 246 GGKYWSNPGAF-VGNTSSQ----RFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLP 300

Query: 324 RAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX--XXXXXXXXXPFIIAIQNSGTKVLPH 381
           +A K+                   VP DDP+L            P +IAI+N G K LP 
Sbjct: 301 KACKRTFWLITVCYIVVLTLVGCLVPSDDPRLLHGSSSVDVAASPLVIAIENGGIKGLPS 360

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
           + NA+IL  ++S  NS +Y  SR M  +A+    P+ F    + G P  A+L T  FG L
Sbjct: 361 LMNAIILIAVLSVANSAVYACSRCMASMARIGNLPKTFSYVDRKGRPLYAILATLIFGLL 420

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
           +F+  S+     F WL  + G++  F W  I+++H+RF  T++ RG S D+LPF +    
Sbjct: 421 SFIAASNKQETVFTWLSALSGLSTLFCWFAINVSHIRFRYTMKQRGRSLDELPFVSMTGV 480

Query: 502 WLAYYAXXXXXXXXXXQGFTAFAPTFNG 529
           W +YY             +TA  P+  G
Sbjct: 481 WGSYYGCVIIFVVLVVCFWTALFPSTEG 508

>Ecym_2664 Chr2 complement(1280994..1282721) [1728 bp, 575 aa] {ON}
           similar to Ashbya gossypii AGR040C
          Length = 575

 Score =  233 bits (593), Expect = 4e-68,   Method: Compositional matrix adjust.
 Identities = 142/489 (29%), Positives = 226/489 (46%), Gaps = 18/489 (3%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           D+D    D+     +++K+ +K RH                   T L  AGP G +I Y 
Sbjct: 48  DDDVVGYDEETGTSSKMKKTIKSRHLLMISLGTGIGTGLLVGNGTALAKAGPGGLIIGYG 107

Query: 133 FMATIVFSVTQSLGEMAXXXXXXX-XXXXXXXXXXXPSIGAANGYMYWFSWAITFALELS 191
             + +++ + Q+ GE+                    P++G +  ++Y   W   F L+L 
Sbjct: 108 VASAMLYCIIQAAGELGICYSGMTGNYTAYSSLLVDPALGFSVSWVYCIQWMTVFPLQLV 167

Query: 192 VVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCL 251
                I++WTD  P   ++ I +F++  +N+F  K Y E EF   + KV+ ++GF+I  +
Sbjct: 168 TAAITIKYWTDTNP-DIFVAILYFLIVFINLFGAKGYAEAEFLFNTCKVLMMVGFVILGI 226

Query: 252 CMVCG-AGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGI 310
            + CG AG  G +G RYW  PG +  G          F G       AAF Y G E++ +
Sbjct: 227 IINCGGAGNDGYIGARYWHTPGAFSTG----------FKGVCYVFCYAAFAYGGIEVMVL 276

Query: 311 TAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIA 370
           TA E  NPRK++P A KKV                  VP+D P+L          PF+IA
Sbjct: 277 TASEQENPRKSIPSACKKVIYRILLIYMLTTLIVCFLVPYDAPELTSTGSASRASPFVIA 336

Query: 371 IQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYI 430
           I + G  V+PHI NAVIL  ++S GNS++Y   R++  L++   AP+ F    + G P +
Sbjct: 337 IASHGISVVPHIINAVILVAVVSVGNSSLYSAPRLLLSLSEQGYAPKVFNYVDRQGRPLL 396

Query: 431 AVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISR 490
             L     G LAF+  S      F+WLL I G++  F W+ I ++HVRF   ++ +G S 
Sbjct: 397 CFLVAMFVGLLAFIAASDAEEDVFSWLLAISGLSQLFIWISICLSHVRFRDAMKAQGRSL 456

Query: 491 DDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNG-----SDFVAAYIXXXXXXXX 545
            ++ +K+    W +++A          Q + A AP  NG      DF  +Y+        
Sbjct: 457 GEVGYKSQTGYWGSWFAIIVSLFVLVAQFWVAIAPIGNGGKLSAKDFFQSYLAAPVLIFI 516

Query: 546 XXXXQLYFR 554
               ++Y++
Sbjct: 517 YFGYKIYYK 525

>TDEL0A08030 Chr1 (1405718..1407262) [1545 bp, 514 aa] {ON} 
          Length = 514

 Score =  230 bits (586), Expect = 1e-67,   Method: Compositional matrix adjust.
 Identities = 138/486 (28%), Positives = 223/486 (45%), Gaps = 5/486 (1%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           D      + G   +A + REL                       T L   GP+   +AYL
Sbjct: 17  DSASSRDEGGSTNEATLSRELSPGVVSLLTLGSAVGTGLIIGSGTALARGGPISIFLAYL 76

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
           F  +I+  V  SL EMA                  P+ G A G+ Y+  +AI  +  L+ 
Sbjct: 77  FTGSILAVVIFSLSEMAAFHPMDRGFSGYLTKYVDPAFGFAAGWNYFLKYAIVLSANLTA 136

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
            G +I +W   + ++ W+ + +    ++N   V+++G+ E ++   K+  ++   I CL 
Sbjct: 137 FGLVIGYWRPDINVAVWVTVLYANAFVVNFLAVRYFGKLEAFMTVAKLTILLLIFIVCLV 196

Query: 253 MVCGAGVTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
           + CG G     +GFRYWR  G + P ++      G+FLGW + +I + F + G+E++GI 
Sbjct: 197 ITCGGGPDHTTIGFRYWRESG-FLPYLVKGN--TGKFLGWWACVIQSIFGFMGSEMIGII 253

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXX-XXXXPFIIA 370
            GE ANPRKT+P+A + V                  V   + KL           PF+IA
Sbjct: 254 YGETANPRKTIPKASRNVIIRICVFYIFGVFVLGLAVSPHNAKLVHAHSTDANASPFVIA 313

Query: 371 IQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYI 430
           I  SG KVLP   NA +L  I S+  ++IY+ SR ++GLAK   AP+ F    KH +P +
Sbjct: 314 ISTSGIKVLPSFVNAFLLVFITSSAYTDIYICSRQLYGLAKDGAAPKIFLRLNKHKIPMV 373

Query: 431 AVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISR 490
             +  S  G LA++      A  F ++ + V V G   W  I +A++ + + ++  G+  
Sbjct: 374 GCVVGSLLGFLAYMNTKKSAATVFGYITSTVSVFGILNWFYILVAYIHYDRVVKSHGVRL 433

Query: 491 DDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQ 550
           D++PF+    P+ AY A           G++AF   FN   F+ +YI            +
Sbjct: 434 DEIPFRMPFQPYAAYIALFFVSVITFFNGYSAFILKFNYKLFITSYIGIFANVLLVLGYK 493

Query: 551 LYFRCK 556
           LY++ K
Sbjct: 494 LYYKTK 499

>KLTH0B02046g Chr2 complement(163199..164968) [1770 bp, 589 aa] {ON}
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 589

 Score =  230 bits (587), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 132/425 (31%), Positives = 206/425 (48%), Gaps = 8/425 (1%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           QDA   ++L  RH                     L   GP   +I ++ ++T +F++  +
Sbjct: 68  QDARYNKDLSVRHLLTLAVGGAIGTGLFVNSGAALTTGGPGSLVIDWVIISTCLFTIVNA 127

Query: 145 LGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAV 204
           LGE++                  PS G A    Y   WA+   LEL      I++W   +
Sbjct: 128 LGELSSTFPVVGGFNVYISRFVEPSFGFAVNLNYLAQWAVLLPLELVAASLTIRYWNHTI 187

Query: 205 PLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVG 264
              AW+ I++ I+ + N+  VK +GE EF ++ +K++AI+GF I  + + CG G  G   
Sbjct: 188 NSDAWVAIFYTIILLANLLDVKSFGETEFVLSMVKILAIIGFTILGIVLTCGGGPKGGYI 247

Query: 265 F-RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 323
             +YW NPG +         A  RF G  S  + AAF+Y GTEL+ ++A E+ NPR T+P
Sbjct: 248 GGKYWSNPGAF-----VGHTAGDRFHGLCSVFVTAAFSYSGTELIAVSAAESVNPRITLP 302

Query: 324 RAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX--XXXXXXXXXPFIIAIQNSGTKVLPH 381
           +A K+                   V  DDP+L            P +IAI+N G K LP 
Sbjct: 303 KACKRTFWLITVCYIVVLTLVGCLVSSDDPRLLNGSSSVDVAASPLVIAIENGGIKGLPS 362

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
           + NA+IL  ++S  NS +Y  SR M  +A+    P+ F    + G P  A++ T  FG L
Sbjct: 363 LMNAIILIAVLSVANSAVYACSRCMASMAQIGNLPKVFTYVDRKGRPLYAIVATLIFGLL 422

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
           +F+  S    + F WL  + G++  F W  I+++H+RF +T++ RG + D+LPF +    
Sbjct: 423 SFIAASDKQEEVFTWLSALSGLSTLFCWFAINVSHIRFRRTMKERGRTLDELPFVSMTGV 482

Query: 502 WLAYY 506
           W +YY
Sbjct: 483 WGSYY 487

>TDEL0C00930 Chr3 complement(147777..149564) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  230 bits (587), Expect = 5e-67,   Method: Compositional matrix adjust.
 Identities = 141/458 (30%), Positives = 213/458 (46%), Gaps = 11/458 (2%)

Query: 86  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSL 145
            + +K  LK RH                   T L+ AGP G LI +    T+++S+  ++
Sbjct: 76  QSPLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYSMVMAV 135

Query: 146 GEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW-TDAV 204
           GE+A                   S G A  ++Y   W +   LE+      + +W TD  
Sbjct: 136 GELAVVFPVAGGFTTYATRFVDESFGFAANFIYMLQWLVVLPLEIVAASITVNYWGTDPK 195

Query: 205 PLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGP-V 263
               ++ +++ ++ I+NMF VK YGE EF  + IKVI ++GF+I  + ++CG G     +
Sbjct: 196 YRDGFVALFYVVIVIINMFGVKGYGEAEFIFSFIKVITVIGFIIMAIVLICGGGKDHKYI 255

Query: 264 GFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 323
           G +YW NPG +         A  +F G+ +  + AAF++ G+ELVG+   EA  PRK+VP
Sbjct: 256 GAQYWYNPGAF-----VGDTAGQQFQGFCTVFVTAAFSFAGSELVGLAGSEAEEPRKSVP 310

Query: 324 RAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX-XXXXXXXXXPFIIAIQNSGTKVLPHI 382
            A K+V                  VP D P+L           PF+IAI N G K LP +
Sbjct: 311 GAAKQVFWRITLFYILCLLLIGMLVPSDSPRLIGASSVDAAASPFVIAIVNHGIKGLPSV 370

Query: 383 FNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALA 442
            N VIL  ++S GNS IY  SR +  LA     P   G   + G P + +  ++ FG +A
Sbjct: 371 VNVVILIAVLSVGNSAIYSCSRTLAALADQGFLPSICGYIDRGGRPLVGIAISAFFGLIA 430

Query: 443 FLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPW 502
           F+  S      FNWL+ + G++  F W  I + H+R+   L  +G S D+LPF+A    W
Sbjct: 431 FVAQSKKEGDVFNWLMALSGLSSLFTWAGICLCHIRYRGALAAQGRSTDELPFQAPAGVW 490

Query: 503 LAYYAXXXXXXXXXXQGFTAFAP---TFNGSDFVAAYI 537
            +Y+           Q +    P     N  DF  AY+
Sbjct: 491 GSYWGFFMCILMFIAQFYVGLFPPGTKPNAYDFFLAYL 528

>TDEL0C06510 Chr3 (1196039..1197967) [1929 bp, 642 aa] {ON} Anc_1.50
           YDR508C
          Length = 642

 Score =  231 bits (588), Expect = 9e-67,   Method: Compositional matrix adjust.
 Identities = 140/456 (30%), Positives = 221/456 (48%), Gaps = 10/456 (2%)

Query: 75  DEPYVDQ--GVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           D   VD+  G  ++  +K+ +K RH                  +  L +AGP G  I Y 
Sbjct: 109 DSGSVDELEGKTKEEHLKKSIKPRHVVMISLGTGIGTGLLVGNAKALNDAGPAGLAIGYA 168

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELS 191
            M + ++ + Q+ GEMA                   P +G A  ++YW  WA    LEL 
Sbjct: 169 IMGSCIYCIIQAAGEMAVTYSNLVGGFNAYPSFLVSPKLGFAVAWVYWLQWACVCPLELV 228

Query: 192 VVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCL 251
                I++WT  V    ++VI++F++ ++N+F  + Y E EF+    KV+ I GF I  +
Sbjct: 229 TASMTIKYWTTKVNPDVFVVIFYFLIIVINVFGARGYAEAEFFFNCCKVLMITGFFILGI 288

Query: 252 CMVCG-AGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGI 310
            + CG AG  G +G +YW +PG +         A  RF G  ++L+ AAF + G+E + +
Sbjct: 289 IINCGGAGNDGYIGGKYWHDPGAF-----RGDKAIDRFKGVAATLVTAAFAFGGSEFIAL 343

Query: 311 TAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX-XXXXXXXXXPFII 369
           TA E +NPRK +P A KK+                  VP++  +L           P++I
Sbjct: 344 TASEQSNPRKAIPAAAKKILYRIIIIFLGSIIMVGFLVPWNSDQLMGSDSSKTKASPYVI 403

Query: 370 AIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPY 429
           AI + G +V+PH  NAVIL +++S GNS  Y  SR++  L++   AP++F    + G P 
Sbjct: 404 AISSHGVRVVPHFVNAVILLSVLSVGNSAFYSSSRILISLSQQGYAPKFFNYIDREGRPA 463

Query: 430 IAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGIS 489
            A++  + F  +AF   SS     F WLL I G++  F W  I ++H+RF + +  +G S
Sbjct: 464 RAMVIGALFAVIAFCAASSKEEDVFTWLLAISGLSQIFTWAAICLSHIRFRRAMHVQGRS 523

Query: 490 RDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP 525
             ++ FK+ L  W +YYA          Q +   AP
Sbjct: 524 LGEIGFKSELGVWGSYYAAGMMFLVLIAQFWVGLAP 559

>Skud_15.515 Chr15 complement(924662..926542) [1881 bp, 626 aa] {ON}
           YOR348C (REAL)
          Length = 626

 Score =  230 bits (587), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 147/498 (29%), Positives = 237/498 (47%), Gaps = 16/498 (3%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           E  P  D G  +  ++K+ L+ RH                  S+ L   GP G  I+Y+ 
Sbjct: 91  EKSPSAD-GDNEPRKLKQGLQSRHVQLIALGGAIGTGLLVGTSSTLHTCGPGGLFISYII 149

Query: 134 MATIVFSVTQSLGEM-----AXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFAL 188
           ++ +++ +  +LGEM                         S+G A G+ Y++ + I  A 
Sbjct: 150 ISAVIYPIMCALGEMVCFLPGDGSDSAGSTANLVTRYVDASLGFATGWNYFYCYVILVAA 209

Query: 189 ELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLI 248
           E +    ++++WT AVP   WI ++  ++ ++N   VK YGE EFW ASIK++ I+G +I
Sbjct: 210 ECTAASGVVEYWTTAVPKGVWITVFLLVVVLLNFSAVKVYGESEFWFASIKILCIVGLII 269

Query: 249 YCLCMVCGAGVTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY-QGTE 306
               +  G G     +GFRYW++PG +   +    +  G F    + +I  AF +  G E
Sbjct: 270 LSFILFWGGGPKHDRLGFRYWQHPGAFAHHLTGGSL--GNFTDIYTGIIKGAFAFILGPE 327

Query: 307 LVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXX----X 362
           LV +T+ E A+ R+ + +A ++                   VP++DP L           
Sbjct: 328 LVCMTSAECADQRRNIAKASRRFVWRLIFFYVLGTLSISVIVPYNDPVLVNALAQGKPGA 387

Query: 363 XXXPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGIT 422
              PF+I IQN+G KVLPHI N  IL++  SA N+ ++  +R +  +A+T  AP+  G  
Sbjct: 388 GSSPFVIGIQNAGIKVLPHIINGCILTSAWSAANAFMFASTRSLLTMAQTGQAPKCLGKI 447

Query: 423 TKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQT 482
            + GVPY+AV  +     LA+L VSS  A  FNW  NI  ++GF  W+   IA++RF + 
Sbjct: 448 NRWGVPYVAVAASFLCSCLAYLNVSSSTADVFNWFSNISTISGFLGWICGCIAYLRFRKA 507

Query: 483 LEHRGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTF-NGSDFVAAYIXXXX 541
           + + G+  D LPFK    P+  +++           G+  F P +   +DF+AAY+    
Sbjct: 508 IFYNGL-YDRLPFKTWGQPYTVWFSLIVVSIITITNGYAIFIPKYWKVADFIAAYVTLPI 566

Query: 542 XXXXXXXXQLYFRCKLYW 559
                   +LY R    W
Sbjct: 567 FLVLWLGHKLYTRTWHQW 584

>KAFR0D00510 Chr4 complement(80174..82027) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  229 bits (585), Expect = 1e-66,   Method: Compositional matrix adjust.
 Identities = 139/469 (29%), Positives = 225/469 (47%), Gaps = 12/469 (2%)

Query: 75  DEPYVDQGVVQDA---EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAY 131
           D+  V+   V D    ++K+ ++ RH                   T L +AGP G +I Y
Sbjct: 82  DDAKVEISQVDDELNEKLKKTIQPRHVVMMSLGTGIGTGLLVGNGTTLAHAGPAGLVIGY 141

Query: 132 LFMATIVFSVTQSLGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALEL 190
             MA+ ++ + Q++GEMA                   P++  +  ++Y   W     LEL
Sbjct: 142 AIMASCIYCIIQAVGEMAVNYLTLVGGFNAYPGFLVDPALNFSIAWIYCIQWFCVCPLEL 201

Query: 191 SVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFP-VKFYGEFEFWVASIKVIAIMGFLIY 249
                 IQ+WT  V    +++I++ ++  +N+F   + Y E EF   S K++ ++GF I 
Sbjct: 202 VTASMTIQYWTTKVNADIFVLIFYILVLAINIFGGARGYAETEFICNSCKILMMIGFFIL 261

Query: 250 CLCMVCG-AGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELV 308
            + ++CG AG  G +G +YWR+PG +            RF G VS+L+ AAF++  TE +
Sbjct: 262 GIVIICGGAGNDGFIGGKYWRDPGAF-----RGSDGPNRFKGVVSTLVTAAFSFGQTEFL 316

Query: 309 GITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX-XXXXXXXXXPF 367
            ITA E +NPRK +P A KKV                  VP+D  +L           P+
Sbjct: 317 AITASEQSNPRKAIPSAAKKVIYRALLIYLASIIIVGLLVPYDSSELLGSSSAATKASPY 376

Query: 368 IIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGV 427
           ++A+   G +V+PH  NAVIL ++ S  +S  Y  SR++  LA+   AP+ F    + G 
Sbjct: 377 VLAVSTHGVRVVPHFINAVILISVFSVADSAFYSSSRMLLTLARQGYAPKVFTFVDRTGR 436

Query: 428 PYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRG 487
           P +  L  +    +AF   SS   + FNWLL I G++  F W LI ++H+RF + ++ +G
Sbjct: 437 PSLGFLVGAVIAVMAFCACSSKETEVFNWLLAISGLSQVFTWALICLSHIRFRRAMKVQG 496

Query: 488 ISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAY 536
            S D++ +K+ +  W + YA          Q +    P   GS  V A+
Sbjct: 497 RSIDEIGYKSQVGVWGSAYAFVMMILIMIGQCWVGIVPVGEGSADVQAF 545

>Smik_4.790 Chr4 complement(1389278..1391269) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  230 bits (586), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 133/453 (29%), Positives = 217/453 (47%), Gaps = 8/453 (1%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           +   +K+ +K RH                  S  L NAGP G +I Y  M + V+ + Q+
Sbjct: 141 KQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQA 200

Query: 145 LGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
            GE+A                   P++G +  +++   W     LEL      I++WT  
Sbjct: 201 CGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTVK 260

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGP 262
           V    ++VI++ ++ ++N+F  K Y E +F+    K++ I+GF I  + + CG AG  G 
Sbjct: 261 VDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIIDCGGAGTDGY 320

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
           +G +YWR+PG +            RF G V++ + AAF +  +E + +TA E +NPRK +
Sbjct: 321 IGSKYWRDPGAF-----RGDTPIQRFKGIVATFVTAAFAFGMSEQLAMTASEQSNPRKAI 375

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPF-DDPKLXXXXXXXXXXPFIIAIQNSGTKVLPH 381
           P A KK+                  VP+  D  L          P++IA+ + G +V+PH
Sbjct: 376 PSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPH 435

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
             NAVIL +++S  NS  Y  SR++  LAK   AP+ F    + G P +A+L ++ FG +
Sbjct: 436 FINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAVAMLVSALFGVI 495

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
           AF   S      F WLL I G++  F W+ I ++H+RF + ++ +G S  ++ +K+ +  
Sbjct: 496 AFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGV 555

Query: 502 WLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVA 534
           W + YA          Q + A AP   G    A
Sbjct: 556 WGSAYAVLMMMLALIAQFWVAIAPIGGGGKLSA 588

>SAKL0G14014g Chr7 (1202476..1204293) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191W HIP1 High-affinity histidine permease also
           involved in the transport of manganese ions
          Length = 605

 Score =  228 bits (582), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 132/434 (30%), Positives = 208/434 (47%), Gaps = 20/434 (4%)

Query: 74  EDEPYVDQ------GVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGS 127
            D P+V            D+++ ++L  RH                     L   GP   
Sbjct: 67  SDVPHVSDFENNVYDTANDSKLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLNTGGPASL 126

Query: 128 LIAYLFMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFA 187
           ++A++ ++T +F++  +LGE+A                  PS G A    Y   WA+   
Sbjct: 127 IVAWVIVSTCLFTIVNALGELAAVFPVVGGFNVYITRFVEPSFGFAVNINYLAQWAVLLP 186

Query: 188 LELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFL 247
           LEL      I++W + +   AW+ I++  + + NM  VK +GE EF ++ IK++AI+GF 
Sbjct: 187 LELVAASITIRYWNNTINSDAWVAIFYTAIFLANMLDVKSFGETEFVLSMIKILAIIGFT 246

Query: 248 IYCLCMVCGAGVTGP-VGFRYWRNPGPW---GPGIISSQVAEGRFLGWVSSLINAAFTYQ 303
           I  + + CG G +G  +G RYW +PG +    PG         RF G  +  + AAF+Y 
Sbjct: 247 ILGIVLACGGGPSGEYIGGRYWNDPGAFVGDTPG--------RRFKGVCAVFVTAAFSYS 298

Query: 304 GTELVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXX--XXXX 361
           GTELV ++A E+ NPR T+P+A K+                   VP++D +L        
Sbjct: 299 GTELVAVSAAESHNPRVTLPKASKRTFWLITLCYITVLTIIGCLVPYNDERLLNGNSSVD 358

Query: 362 XXXXPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGI 421
               P +IAI+N G K LP + NA+IL  I+S  NS +Y  SR M  +A+    P+    
Sbjct: 359 AAASPLVIAIENGGIKGLPSLMNAIILIAILSVANSAVYACSRCMVAMAEIGNLPKRLNY 418

Query: 422 TTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQ 481
             K G P  A+  T  FG L+F+  S    + F WL  + G++  F W  I+++H+RF Q
Sbjct: 419 IDKRGRPLYAIFATLIFGLLSFIAASDKQEEVFTWLSALSGLSTLFCWFSINLSHIRFRQ 478

Query: 482 TLEHRGISRDDLPF 495
            ++ +  S ++LPF
Sbjct: 479 AMKAQDRSLNELPF 492

>Kwal_26.9612 s26 complement(1291552..1293183) [1632 bp, 543 aa]
           {ON} YFL055W (AGP3) - Amino acid permease [contig 363]
           FULL
          Length = 543

 Score =  227 bits (578), Expect = 3e-66,   Method: Compositional matrix adjust.
 Identities = 145/479 (30%), Positives = 222/479 (46%), Gaps = 27/479 (5%)

Query: 73  DEDEPYVDQGVVQDAE------------VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLK 120
           D+ EP + +  +Q  E            VKR LK RH                     L 
Sbjct: 14  DKLEPKIAEVELQRLETDSLNEFDPHSGVKRALKNRHISLLALGGIIGPGCLIGAGNALN 73

Query: 121 NAGPVGSLIAYLFMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWF 180
             GP+  L+ +  +  + FS+ +S+GE+                     + A +GY Y  
Sbjct: 74  KGGPLALLLGFGIIGLVCFSIMESIGELVTLYPSGGGFITLARRFHSEGLSAVSGYAYIV 133

Query: 181 SWAITFALELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKV 240
            +    A E + +  I+QFW   VP+  + +I+WF   +  +  V  +GE E+W+A  K+
Sbjct: 134 VFFAVLANEYNTISSILQFWGPQVPIYGYTLIFWFFFLVFQLIGVGAFGECEYWLAWFKI 193

Query: 241 IAIMGFLIYCLCMVCGAGVTG--PVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINA 298
           + ++ F I+ +  + G G+ G  P+GF+YW+NPG    G          F G     +  
Sbjct: 194 LGLVAFYIFSIVYMSG-GIPGKPPIGFQYWKNPGALSHG----------FRGIAVVFVFC 242

Query: 299 AFTYQGTELVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXX 358
           +  Y GTE V + A E+ NPRK VP A+++                   VP++DP L   
Sbjct: 243 STFYSGTESVALAATESRNPRKAVPLAVRQTFWRILIVYLGISFFYGVTVPYNDPTLGAQ 302

Query: 359 XXXXXXXPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRW 418
                  P  IA+  +G     H+ NA IL T ISA NS++Y+GSR +  LA   LAPR 
Sbjct: 303 TKSLKS-PISIALSRAGWAGGVHLVNAFILMTCISAINSSLYIGSRTLSHLAHEGLAPRI 361

Query: 419 FGITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVR 478
              T K GVP  A++  +A G ++ + VS G + A+N+++N+ GV  F  W  ISI H+R
Sbjct: 362 LAWTDKRGVPVPALIVFNALGLISLMNVSVGASNAYNYIVNLSGVGVFIVWSAISITHLR 421

Query: 479 FIQTLEHRGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYI 537
           F +    +G S  +LP++A   PW   ++          QG+T+  P F   DFV AYI
Sbjct: 422 FRKAWVAQGRSLSELPYRALFYPWTTIFSLAANIFLALIQGWTSLVP-FVAKDFVDAYI 479

>NDAI0D02160 Chr4 (505202..506965) [1764 bp, 587 aa] {ON} Anc_5.158
          Length = 587

 Score =  228 bits (580), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 132/437 (30%), Positives = 210/437 (48%), Gaps = 8/437 (1%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           ++    V    V +  + + L  RH                     L + GP   +I ++
Sbjct: 54  NDATSTVSNASVTNVNLNKNLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWV 113

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
            ++T +F+V  +LGEMA                  PS+G A    Y   W +   LEL  
Sbjct: 114 IISTCLFTVINALGEMAAAFPVVGGFNVYITRFVDPSVGFAVNINYLAQWLVLLPLELVA 173

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
               I++W D +   AW+ I++ ++   NM  VK +GE EF ++ +K++AI+GF I  + 
Sbjct: 174 ASMTIKYWNDTINSDAWVAIFYAVIAFANMLEVKSFGETEFVLSMVKILAIIGFTILGIV 233

Query: 253 MVCGAGVTGPVGF-RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
           + CG G  G     +YW NPG +         +  +F G  S  + AAF+Y G E+  ++
Sbjct: 234 LSCGGGPQGGYLGGKYWHNPGSF-----VGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVS 288

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXX--XXXXXXXXPFII 369
           A E+ +PR+T+P+A K+                   VP+D+P+L            P +I
Sbjct: 289 AAESKDPRRTIPKAAKRTFWLITASYITILTLIGCLVPYDEPRLLSGSSSVDAASSPLVI 348

Query: 370 AIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPY 429
           AI+N G K LP + NA+IL +IIS  NS +Y  SR M  +A     P+      K G P 
Sbjct: 349 AIENGGIKGLPSLMNAIILISIISVANSAVYACSRCMVAMAHIGNLPQVLKHIDKKGRPV 408

Query: 430 IAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGIS 489
            A+LFT  FG L+F+  S   A+ F WL  + G++  F W+ I+I+H+RF Q ++ +  S
Sbjct: 409 NAILFTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINISHIRFRQAMKKQRKS 468

Query: 490 RDDLPFKAALMPWLAYY 506
            D+LP+ +    W ++Y
Sbjct: 469 LDELPYLSQTGVWGSWY 485

>Suva_2.688 Chr2 complement(1219181..1221166) [1986 bp, 661 aa] {ON}
           YDR508C (REAL)
          Length = 661

 Score =  229 bits (584), Expect = 5e-66,   Method: Compositional matrix adjust.
 Identities = 136/462 (29%), Positives = 220/462 (47%), Gaps = 9/462 (1%)

Query: 76  EPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMA 135
           +P  +Q   Q+  +K+ +K RH                  S  L NAGP G +I Y  M 
Sbjct: 131 QPSQEQDQNQE-NLKKTIKPRHIVMMSLGTGIGTGLLVGNSKVLNNAGPAGLVIGYAIMG 189

Query: 136 TIVFSVTQSLGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVG 194
           + ++ + Q+ GE+A                   P++G +  ++Y   W     LEL    
Sbjct: 190 SCIYCIIQACGELAVIYSDLIGGFNTYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTAS 249

Query: 195 QIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMV 254
             I++WT  V    ++VI++ ++ ++N+F  K Y E +F+    K++ I+GF I  + + 
Sbjct: 250 MTIKYWTVKVDPDVFVVIFYVLIIVINVFGAKGYAEADFFFNCCKILMIIGFFILAIIID 309

Query: 255 CG-AGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAG 313
           CG AG  G +G RYW NPG +            RF G V++ + AAF +  +E + +TA 
Sbjct: 310 CGGAGTDGYIGSRYWHNPGAF-----RGNTGIQRFKGVVATFVTAAFAFGMSEQLAMTAS 364

Query: 314 EAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPF-DDPKLXXXXXXXXXXPFIIAIQ 372
           E +NPRK +P A KK+                  VP+  D  L          P++IA+ 
Sbjct: 365 EQSNPRKAIPSAAKKMIYRILFVFLGSLVLVGFLVPYTSDQLLGASGSATKASPYVIAVA 424

Query: 373 NSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAV 432
           + G +V+PH  NAVIL +++S  N   Y  SR++  LAK   AP+ F    + G P +A+
Sbjct: 425 SHGVRVVPHFINAVILLSVLSVANGAFYSSSRILMSLAKQGNAPKCFDYIDREGRPAVAM 484

Query: 433 LFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDD 492
           L +S FG +AF   S      F WLL I G++  F W+ I ++H+RF + ++ +G S  +
Sbjct: 485 LVSSIFGIIAFCASSPKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGE 544

Query: 493 LPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVA 534
           + +K+ +  W + YA          Q + A +P   G    A
Sbjct: 545 VGYKSQVGIWGSMYAIVMMVLALIAQFWVAISPIGGGGKLSA 586

>Skud_4.784 Chr4 complement(1386623..1388614) [1992 bp, 663 aa] {ON}
           YDR508C (REAL)
          Length = 663

 Score =  229 bits (583), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 135/455 (29%), Positives = 220/455 (48%), Gaps = 15/455 (3%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           E EP       +   +K+ +K RH                  S  L NAGP G +I Y  
Sbjct: 137 EQEP-------KQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAI 189

Query: 134 MATIVFSVTQSLGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSV 192
           M + V+ + Q+ GE+A                   P++G +  +++   W     LEL  
Sbjct: 190 MGSCVYCIIQACGELAVIYSDLIGGFNTYPSFLVDPAVGFSVAWLFCLQWLCVCPLELVT 249

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
               I++WT  V    +++I++ ++ ++N+F  K Y E +F+    K++ I GF I  + 
Sbjct: 250 ASMTIKYWTVKVNADVFVIIFYVLILVINIFGAKGYAEADFFFNCCKILMITGFFILAII 309

Query: 253 MVCG-AGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
           + CG AG  G +G RYWR+PG +  G  S Q    RF G V++ + AAF +  +E + +T
Sbjct: 310 IDCGGAGTDGYIGSRYWRDPGAF-RGDTSIQ----RFKGVVATFVTAAFAFGMSEQLAMT 364

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPF-DDPKLXXXXXXXXXXPFIIA 370
           A E +NPRK +P A KK+                  VP+  D  L          P++IA
Sbjct: 365 ASEQSNPRKAIPSAAKKMIYRILFVFLASLALVGFLVPYTSDQLLGAAGSATKASPYVIA 424

Query: 371 IQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYI 430
           + + G +V+PH  NAVIL +++S  NS  Y  SR++  LAK   AP+ F    + G P +
Sbjct: 425 VSSHGVRVVPHFINAVILLSVLSVANSAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAV 484

Query: 431 AVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISR 490
           A++ ++ FG +AF   S      F WLL I G++  F W+ I ++H+RF + ++ +G S 
Sbjct: 485 AMIVSAVFGVIAFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRKGMKVQGRSL 544

Query: 491 DDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP 525
            ++ +K+ +  W + YA          Q + A +P
Sbjct: 545 GEVGYKSQVGVWGSAYAVVLMVLALIGQFWVAISP 579

>CAGL0K05753g Chr11 (565111..567093) [1983 bp, 660 aa] {ON} highly
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508c GNP1
          Length = 660

 Score =  229 bits (583), Expect = 6e-66,   Method: Compositional matrix adjust.
 Identities = 138/453 (30%), Positives = 217/453 (47%), Gaps = 8/453 (1%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           ++  +K+ +K RH                  +  L NAGP G +I Y  M + ++ + Q+
Sbjct: 138 EEEALKKSIKPRHVVMISLGTGIGTGLLVGNAKALHNAGPAGLVIGYAIMGSCIYCIIQA 197

Query: 145 LGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
            GEMA                   P  G A  ++Y   W     LEL      I++WT  
Sbjct: 198 AGEMAVVYSNLLGGFNTYPSMLVDPGFGFAVAWVYCLQWLCVCPLELVTTSLTIKYWTTT 257

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCM-VCGAGVTGP 262
           V   A++VI++ ++  + +F  + Y E EF+    K++ I+GF I  + +   GAG  G 
Sbjct: 258 VNPDAFVVIFYVVIIFIQIFGARGYAEAEFFFNCCKILMIIGFYILGIIINAGGAGNDGY 317

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
           +G +YW +PG +  G    Q    RF G +++ ++AAF +  TE + +TA E +NPRK +
Sbjct: 318 LGAKYWHDPGAF-RGTNGIQ----RFKGIMATFVSAAFAFGATEFIALTAAEQSNPRKAI 372

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX-XXXXXXPFIIAIQNSGTKVLPH 381
           P A KKV                  VP+D  +L           P+++AI   G +V+PH
Sbjct: 373 PSAAKKVLYRVICIFVGTIALLGFLVPWDSDQLMGAGGSATKASPYVLAISIHGVRVVPH 432

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
             NAVIL ++ S  NS  Y  SR++ GLA+   AP++F    + G P+ A+   + FG +
Sbjct: 433 FINAVILISVFSVANSAFYSSSRLLLGLAQQGYAPKFFDYVDRQGRPFRAMCCAALFGVI 492

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
           AF   S    + F WLL I G++  F W+ I ++H+RF + +  +G S  ++ FKA L  
Sbjct: 493 AFCAASPKEDQVFTWLLAISGLSQLFTWIAICVSHIRFRRAMTVQGRSLGEIGFKAQLGV 552

Query: 502 WLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVA 534
           + +YYA          Q + A AP  N  D  A
Sbjct: 553 YGSYYATIMMVLALIAQFWVAIAPIGNNGDLDA 585

>KLLA0F23419g Chr6 complement(2187386..2189107) [1722 bp, 573 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 573

 Score =  226 bits (577), Expect = 7e-66,   Method: Compositional matrix adjust.
 Identities = 143/465 (30%), Positives = 219/465 (47%), Gaps = 17/465 (3%)

Query: 86  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSL 145
           D  +K+ LK  H                  S+ L   GP G  I+Y  M+TI++ V  +L
Sbjct: 49  DHNLKKGLKSAHIQLIAIGGCIGTGLFVGTSSTLYKCGPAGLFISYCIMSTIIYPVMNAL 108

Query: 146 GEMAX-------XXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQ 198
            EM                           S+G A G+ Y + + I  A E +    ++ 
Sbjct: 109 AEMVCFLPGLPDENETGGSISTLCTRYVDSSLGFAVGWNYVYCYVILVAAECTAASGVVT 168

Query: 199 FWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAG 258
           +WT AVP +AWI I+  I+ ++N   V+FYG  E    S+K+  I+G +I  + +  G G
Sbjct: 169 YWTTAVPKAAWITIFLGIIVVLNCTAVEFYGTSEAIFCSLKIFCILGIIIVSIVLFFGGG 228

Query: 259 VTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY-QGTELVGITAGEAA 316
                +GFR+W++PG W   +  +    GR    ++ +I A F +  G ELV +T+ EA 
Sbjct: 229 PNHDRLGFRFWKDPGAWAYHL--ADGGAGRLSDIITGVIRAGFAFILGPELVVLTSTEAQ 286

Query: 317 NPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXX----XXXXPFIIAIQ 372
           + R+ + +A ++                   V  +DP L              PF+I IQ
Sbjct: 287 DSRRNIEKAARRFVWRLIFFYCVSSLCAGVIVSRNDPVLLNALSQGKPGAGSSPFVIGIQ 346

Query: 373 NSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAV 432
           N+G KVLPHI N  ILS+  S+GNS +Y  +R +  L++   AP+ F    + GVPY  V
Sbjct: 347 NAGIKVLPHIINVCILSSAWSSGNSFMYATTRSLLSLSQEGYAPKIFNRVNRWGVPYTGV 406

Query: 433 LFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDD 492
            F +AF  LA+L VSS  A  FNW  NI  ++GF  W+   +A++RF + +    +  D 
Sbjct: 407 AFATAFSCLAYLNVSSSTADVFNWFSNISTISGFLGWICSGVAYLRFRKAVFFNNL-YDR 465

Query: 493 LPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYI 537
           LPFK    P+  ++            G+ +F   +N  DF+AAYI
Sbjct: 466 LPFKTPFQPYFTWFYIILIAIICLINGYESFV-HWNYKDFIAAYI 509

>Kwal_23.4026 s23 (534468..536072) [1605 bp, 534 aa] {ON} YPL265W
           (DIP5) - dicarboxylic amino acid permease [contig 255]
           FULL
          Length = 534

 Score =  224 bits (572), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 137/451 (30%), Positives = 219/451 (48%), Gaps = 5/451 (1%)

Query: 89  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEM 148
           ++R  KQRH                   T LK  GP   LIA++F  +++  V  SL EM
Sbjct: 46  LQRGFKQRHVDMLAIAGAIGTGLVIGTGTALKRGGPGSLLIAFIFTGSLLIGVLMSLAEM 105

Query: 149 AXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLSA 208
           A                  P++G A G+ Y+  +AI  A ELS +G ++Q+W + + ++ 
Sbjct: 106 ASFAPMDKSFSGYATRYVDPALGFATGWNYFLKYAIALASELSAIGLLVQYWREDLSIAI 165

Query: 209 WIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGP-VGFRY 267
           +IV++  +L  +N   +KFYGE EFW A +K + ++   +  L + CG G +   +GFRY
Sbjct: 166 FIVVFLVVLLSLNFMNIKFYGEVEFWSALLKFLVLIICFVTGLVLTCGGGPSKETIGFRY 225

Query: 268 WRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIK 327
           WR    + P ++      GRFLGW + +I + + Y G+E +G+  GEA NP+KT+P A +
Sbjct: 226 WREYA-FVPYLVKGTT--GRFLGWWACVIQSCYAYIGSETIGVVFGEAPNPKKTIPAATR 282

Query: 328 KVSXXXXXXXXXXXXXXXXXV-PFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLPHIFNAV 386
            V                  + P D              PF+IA  N+G K LP   NA+
Sbjct: 283 NVIFRITGFYIVGVLILGLIISPHDKTLANAKTSDASGSPFVIAFTNAGIKGLPSFINAM 342

Query: 387 ILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLEV 446
           ++  I SA N+ +YV SR  +GLAK  +AP+ F    ++GVP+   L       L+F+ +
Sbjct: 343 LIMFIASAANTALYVCSRTAYGLAKDGMAPKIFLAQNRYGVPFNGCLLAGLISLLSFMNI 402

Query: 447 SSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAYY 506
           S+  +  F +L + V V G   WL + I+++ + +      + RD +PF+    P+ AY 
Sbjct: 403 SNSSSVIFGYLTSSVTVFGTLNWLSVLISYIGYERARVFHDVPRDRIPFRMWFQPYSAYV 462

Query: 507 AXXXXXXXXXXQGFTAFAPTFNGSDFVAAYI 537
                       G++AF   F    F+ +YI
Sbjct: 463 CLFFVSLIIFFNGYSAFIAGFKYKSFIVSYI 493

>YDR508C Chr4 complement(1466453..1468444) [1992 bp, 663 aa] {ON}
           GNP1High-affinity glutamine permease, also transports
           Leu, Ser, Thr, Cys, Met and Asn; expression is fully
           dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 663

 Score =  228 bits (580), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 132/453 (29%), Positives = 216/453 (47%), Gaps = 8/453 (1%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           +   +K+ +K RH                  S  L NAGP G +I Y  M + V+ + Q+
Sbjct: 141 KQENLKKSIKPRHTVMMSLGTGIGTGLLVGNSKVLNNAGPGGLIIGYAIMGSCVYCIIQA 200

Query: 145 LGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
            GE+A                   P++G +  +++   W     LEL      I++WT +
Sbjct: 201 CGELAVIYSDLIGGFNTYPLFLVDPALGFSVAWLFCLQWLCVCPLELVTASMTIKYWTTS 260

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGP 262
           V    ++VI++ ++ ++N+F  K Y E +F+    K++ I+GF I  + + CG AG  G 
Sbjct: 261 VNPDVFVVIFYVLIVVINVFGAKGYAEADFFFNCCKILMIVGFFILAIIIDCGGAGTDGY 320

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
           +G +YWR+PG +            RF G V++ + AAF +  +E + +TA E +NPRK +
Sbjct: 321 IGSKYWRDPGAF-----RGDTPIQRFKGVVATFVTAAFAFGMSEQLAMTASEQSNPRKAI 375

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPF-DDPKLXXXXXXXXXXPFIIAIQNSGTKVLPH 381
           P A KK+                  VP+  D  L          P++IA+ + G +V+PH
Sbjct: 376 PSAAKKMIYRILFVFLASLTLVGFLVPYTSDQLLGAAGSATKASPYVIAVSSHGVRVVPH 435

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
             NAVIL +++S  N   Y  SR++  LAK   AP+ F    + G P  A+L ++ FG +
Sbjct: 436 FINAVILLSVLSVANGAFYTSSRILMSLAKQGNAPKCFDYIDREGRPAAAMLVSALFGVI 495

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
           AF   S      F WLL I G++  F W+ I ++H+RF + ++ +G S  ++ +K+ +  
Sbjct: 496 AFCASSKKEEDVFTWLLAISGLSQLFTWITICLSHIRFRRAMKVQGRSLGEVGYKSQVGV 555

Query: 502 WLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVA 534
           W + YA          Q + A AP   G    A
Sbjct: 556 WGSAYAVLMMVLALIAQFWVAIAPIGGGGKLSA 588

>KAFR0D00500 Chr4 complement(77541..79394) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  226 bits (577), Expect = 2e-65,   Method: Compositional matrix adjust.
 Identities = 133/426 (31%), Positives = 212/426 (49%), Gaps = 9/426 (2%)

Query: 86  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSL 145
           + ++K+ ++ RH                   T L +AGP G +I Y  M+T ++ V Q++
Sbjct: 96  NEKLKKTIQPRHVIMITLGTGVGTGLLVGNGTTLSHAGPAGLIIGYAIMSTCIYCVMQAV 155

Query: 146 GEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAV 204
           GEMA                   P +  A  ++Y   W     LEL      IQ+WT  V
Sbjct: 156 GEMAVNYLTLIGGFSAYPGFLIDPGLNFAVSWIYCIQWFCVCPLELVTASMTIQYWTTKV 215

Query: 205 PLSAWIVIWWFILTIMNMFP-VKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGP 262
               +++I++ ++  +N+F   + Y E EF+    K++ + GF I  + ++CG AG +G 
Sbjct: 216 NADIFVLIFYLLMIGINIFGGARGYAEAEFFCNVCKILMMTGFFILGIILICGGAGNSGF 275

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
           +G RYW +PG +            RF G VS+L+ AAF + GTE + ITA E ANPRK +
Sbjct: 276 IGARYWHSPGAF-----RGDNGINRFKGIVSTLVTAAFAFGGTEFLAITASEQANPRKAI 330

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXX-XXXXXPFIIAIQNSGTKVLPH 381
           P A KKV                  VP++  +L           P++IA+ + G +V+PH
Sbjct: 331 PSAAKKVIYRALIIYVGSIIIVGFLVPYNSSELLGSSGPATKASPYVIAVASHGIRVVPH 390

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
             NAVIL ++ S  +S  Y  SR++  LA+   AP+ F    K G P +  +  +    +
Sbjct: 391 FINAVILISVFSVADSAFYSSSRLLLTLARQGFAPKIFTYVDKRGRPTLGFVVGAIIAII 450

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
           +F   SS  A  FNWLL+I G++  F W +IS++H+RF + ++ +G S D++ FK+    
Sbjct: 451 SFCACSSKEADVFNWLLSISGLSEVFTWAIISLSHIRFRRAMKVQGRSLDEIGFKSQAGV 510

Query: 502 WLAYYA 507
           W + YA
Sbjct: 511 WGSVYA 516

>ZYRO0D03762g Chr4 complement(304207..306009) [1803 bp, 600 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 600

 Score =  226 bits (575), Expect = 3e-65,   Method: Compositional matrix adjust.
 Identities = 136/455 (29%), Positives = 216/455 (47%), Gaps = 11/455 (2%)

Query: 89  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEM 148
           ++ +LK RH                   T L+ AGP G LI ++   ++++ +  S+ E+
Sbjct: 84  LQHQLKNRHLQMISIGGAIGTGLFVGSGTALRTAGPAGILIGWIIAGSMIYCMVMSVAEL 143

Query: 149 AXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW-TDAVPLS 207
           A                   S G AN + Y   W +T  LE+      + +W TD     
Sbjct: 144 AIAFPVAGGFTTYATRFIDESYGFANNFNYMLQWIVTLPLEIVAASITVNYWHTDKKYRD 203

Query: 208 AWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVGF-R 266
            ++ ++W ++ I+NMF V+ YGE EF  +  K++ I+GF+I  + ++CG G        R
Sbjct: 204 GFVALFWVVIVIINMFGVRGYGEAEFIFSICKILMIVGFIILAIILICGGGPGTGYIGAR 263

Query: 267 YWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAI 326
           YW +PG +     +   +  +F G+ S  + AAF++ G+ELVG+ A EA+NPRK VP A 
Sbjct: 264 YWYHPGAF-----AGDTSGRKFKGFCSVFVTAAFSFAGSELVGLAAAEASNPRKDVPGAA 318

Query: 327 KKVSXXXXXXXXXXXXXXXXXVPFDDPKLXX-XXXXXXXXPFIIAIQNSGTKVLPHIFNA 385
           K+V                  VP+ DP+L           PF+IAI+N G   LP + N 
Sbjct: 319 KQVFWRITMFYVLCLLLIGMLVPYTDPRLIGGSSVDAAASPFVIAIKNQGISGLPTLVNV 378

Query: 386 VILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLE 445
           VIL  ++S GNS +Y  SR +  LA     P+ F    + G P + +  TSAFG +AF+ 
Sbjct: 379 VILIAVLSVGNSAVYACSRTLSALADQGFLPKCFSYIDRMGRPMVGIAVTSAFGLIAFVA 438

Query: 446 VSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAY 505
            S    + F+WL+ + G++  F W  I + H+RF + L  +G S ++L F +    W A 
Sbjct: 439 QSDKEGEVFDWLMALSGLSSLFTWATICLCHIRFRRALAAQGRSTNELAFASPAGVWGAA 498

Query: 506 YAXXXXXXXXXXQGFTAFAPTF---NGSDFVAAYI 537
           +           Q + A  P     + +DF   Y+
Sbjct: 499 WGLFLCIIMLAAQFYVALFPLGAPPSANDFFQGYL 533

>NCAS0A07110 Chr1 (1408106..1409884) [1779 bp, 592 aa] {ON}
           Anc_5.158
          Length = 592

 Score =  225 bits (574), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 129/426 (30%), Positives = 205/426 (48%), Gaps = 8/426 (1%)

Query: 84  VQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQ 143
           + +  + + L  RH                     L + GP   +I ++ ++T +F+V  
Sbjct: 70  INNVNLNKNLSIRHLLTLAVGGSIGVGLFVNSGAALASGGPASLVIDWIIISTCLFTVIN 129

Query: 144 SLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
           +LGEMA                  PS+G A    Y   W +   LEL      I++W + 
Sbjct: 130 ALGEMAAAFPVVGGFNVYITRFIDPSVGFAVNINYLAQWLVLLPLELVAASMTIKYWNET 189

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPV 263
           +   AW+ I++ ++ + NM  VK +GE EF ++ IK++AI+GF I  + + CG G  G  
Sbjct: 190 INSDAWVAIFYCVIALANMLEVKSFGETEFVLSMIKILAIIGFTILGIVLACGGGPHGGF 249

Query: 264 GF-RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
              +YW +PG +         +  +F G  S  + AAF+Y G E+  ++A E+ +PR T+
Sbjct: 250 IGGKYWNHPGSF-----VGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRTTI 304

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX--XXXXXXXXXPFIIAIQNSGTKVLP 380
           P+A K+                   VP+DDP+L            P +IAI+N G K LP
Sbjct: 305 PKAAKRTFWLITASYVTILTLIGCLVPYDDPRLLSGTSSVDAASSPLVIAIENDGIKGLP 364

Query: 381 HIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGA 440
            + NA+IL +IIS  NS +Y  SR M  +A     PR        G P  A++FT  FG 
Sbjct: 365 SLMNAIILISIISVANSAVYACSRCMVAMAHIGNVPRILNRVDTKGRPMNAIIFTLFFGL 424

Query: 441 LAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALM 500
           L+F+  S   A  F WL  + G++  F W+ I+++H+RF Q++  +  S D+LPF +   
Sbjct: 425 LSFVAASDRQADVFTWLSALSGLSTIFCWMAINLSHIRFRQSMAKQNRSLDELPFLSQTG 484

Query: 501 PWLAYY 506
            W ++Y
Sbjct: 485 VWGSWY 490

>Suva_4.307 Chr4 complement(540768..542597) [1830 bp, 609 aa] {ON}
           YDR046C (REAL)
          Length = 609

 Score =  225 bits (574), Expect = 4e-65,   Method: Compositional matrix adjust.
 Identities = 138/448 (30%), Positives = 209/448 (46%), Gaps = 8/448 (1%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
            D+++K+ +K RH                  +  L   GP   +I Y  ++ + + + Q+
Sbjct: 87  SDSKLKKSMKSRHVVMMTLGTGIGTGLLVANAKGLHYGGPAALVIGYFLVSFVTYFMIQA 146

Query: 145 LGEMAXXXXXX-XXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
            GEMA                      G A  ++Y F W     LEL      I+FW D 
Sbjct: 147 AGEMAVTYPTLPANFNAYSSIFISKPFGFATVWVYCFQWLTVLPLELITAAMTIKFWNDT 206

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGP 262
           +    +I+I++  L  ++ F VK YGE EF     K++ I GF+I  + + CG AG  G 
Sbjct: 207 INPDIFILIFFVFLLFIHFFGVKGYGETEFIFNCCKILMIAGFIILSVVINCGGAGNDGY 266

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
           +G +YWRNPG +     +   + GRF      L+ A F++ G EL  ++  E ANPRKT 
Sbjct: 267 IGGKYWRNPGAF-----AGDTSAGRFKNVCYILVTAYFSFGGMELFALSVQEQANPRKTT 321

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX-XXXXXXPFIIAIQNSGTKVLPH 381
           P A K+                   VP++D +L           P+++A    G KV+PH
Sbjct: 322 PVAAKRSIYRILVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVKVVPH 381

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
           I NAVIL ++IS  NS++Y G R+M  LA+    P++     + G P IA++  S FG +
Sbjct: 382 IINAVILISVISVANSSLYAGPRLMCSLAQQGYGPKFLDYVDREGRPLIALIVCSVFGVI 441

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
            F+  SS     F WL  I G++  F W  I ++H+RF Q ++ +G S D+L +KA    
Sbjct: 442 GFVAASSKEEVVFAWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKATTGI 501

Query: 502 WLAYYAXXXXXXXXXXQGFTAFAPTFNG 529
           W + Y           Q + A AP  NG
Sbjct: 502 WGSAYGVFFNILVFIAQFWVALAPLNNG 529

>KNAG0C02140 Chr3 complement(416347..418143) [1797 bp, 598 aa] {ON} 
          Length = 598

 Score =  225 bits (573), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 148/473 (31%), Positives = 222/473 (46%), Gaps = 12/473 (2%)

Query: 73  DEDEPYVDQGVVQDAE--VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIA 130
           D +   +DQ   + A   ++  LK RH                   T L+ AGP G LI 
Sbjct: 63  DPNMSELDQIAFRTANSPLQHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIG 122

Query: 131 YLFMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALEL 190
           +    T+++S+  +LGE+A                   S G AN   Y   W +   LE+
Sbjct: 123 WGLTGTMIYSMVMALGELAVLFPVSGGFTTYATRFIDESYGFANNINYMLQWLVVLPLEI 182

Query: 191 SVVGQIIQFW-TDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIY 249
                 + +W T+      ++ ++W  + I+N+F VK YGE EF  + IKVI ++GF+I 
Sbjct: 183 VAASITVNYWGTNPRYRDGFVALFWLAIFIINLFGVKGYGEAEFIFSIIKVITVVGFIIL 242

Query: 250 CLCMVCGAG-VTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELV 308
            + + CG G V G +G RYW +P     G      A  RF G  S  + AAF++ G+ELV
Sbjct: 243 GIILNCGGGPVKGYIGGRYWHHP----YGAFVGDSAGARFKGVCSVFVTAAFSFAGSELV 298

Query: 309 GITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX-XXXXXXXXXPF 367
           G+ + E ANPRK+VP+A K+V                  VP+ + +L           PF
Sbjct: 299 GLASAETANPRKSVPKAAKQVFWRITLFYLLALGMVGLLVPYTEKRLIGASSVDAAASPF 358

Query: 368 IIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGV 427
           +IAI   G + LP + N VIL  ++S GNS IY  SR +  LA+    P++FG   + G 
Sbjct: 359 VIAITTHGIRGLPSVVNVVILIAVLSVGNSAIYACSRTLCALAEQNFLPKFFGYIDRSGR 418

Query: 428 PYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRG 487
           P  ++L TS FG +AF+  S    + FNWLL + G++  F W  I + H+RF + L  +G
Sbjct: 419 PLYSILVTSGFGLVAFVAQSKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRKALSAQG 478

Query: 488 ISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP---TFNGSDFVAAYI 537
              D+L F +    + +Y+           Q + A  P     N   F  AY+
Sbjct: 479 RGTDELSFVSPAGVYGSYWGLFMIILMFIAQFYVALFPPGAKPNAKAFFEAYL 531

>TBLA0C01240 Chr3 (270186..272075) [1890 bp, 629 aa] {ON} Anc_1.368
           YOL020W
          Length = 629

 Score =  225 bits (574), Expect = 6e-65,   Method: Compositional matrix adjust.
 Identities = 138/479 (28%), Positives = 226/479 (47%), Gaps = 19/479 (3%)

Query: 75  DEPYVDQGVVQDAEVKRELKQ----RHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIA 130
           +E  + + ++ +   K +LKQ    RH                     L   GP G + +
Sbjct: 84  NETIISEELINEDGRKNKLKQGLNARHIQLIALGGCIGTGLFVGAGITLNKCGPAGLVAS 143

Query: 131 YLFMATIVFSVTQSLGEMAXX-----XXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAIT 185
           YL ++T+V+ +   LGEM                         S+  A G+ Y++ + + 
Sbjct: 144 YLIISTMVYPIMNVLGEMVCYLPGDGSDSAGSVPHLVKRYLDDSLSFAAGWNYYYCFVML 203

Query: 186 FALELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMG 245
            A E +    ++++WT  VP  AWIV++  I+  +NM PV+ YGE EFW A  K++ I+G
Sbjct: 204 VAAECTAASGVVEYWTKVVPKPAWIVMFQLIIFGLNMCPVRVYGESEFWFAISKILCIVG 263

Query: 246 FLIYCLCMVCGAGVTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY-Q 303
            +I    +  G G     +GFRYW  PG +   I +     G FL     +I  AF++  
Sbjct: 264 LIILSFILFWGGGPNHDRLGFRYWITPGSFANTITNGSF--GNFLDVYKGIILGAFSFIL 321

Query: 304 GTELVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXX 363
           G ELV + + E ++PR+ + +A K+                   V ++DP L        
Sbjct: 322 GPELVVLPSSECSDPRRNIKKASKRFIWRLMFFYILGTLSISVIVSYNDPILSTALIQDK 381

Query: 364 ----XXPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWF 419
                 PF+I IQN+G  VLPHI N  IL +  S+GN+ ++  SR +  +A    AP+  
Sbjct: 382 PGAGSSPFVIGIQNAGIDVLPHIINVCILISAWSSGNAYLFASSRSLQTMAINSQAPKCL 441

Query: 420 GITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRF 479
           G   + GVPY+AV+ +     +A+L  S   +  F W  N+  ++GF  W+++S+ ++RF
Sbjct: 442 GKINRFGVPYVAVIVSIILSCIAYLNCSKSTSDVFKWFTNLSTISGFLGWIIVSVTYLRF 501

Query: 480 IQTLEHRGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP-TFNGSDFVAAYI 537
            + +E+ G+ +D LP+     P+L  Y+           GF    P  +N SDF+AAY+
Sbjct: 502 RKAIEYHGM-KDRLPYTTWGQPYLIIYSLISFIIITITNGFDILIPRNWNVSDFIAAYL 559

>YBR068C Chr2 complement(373861..375690) [1830 bp, 609 aa] {ON}
           BAP2High-affinity leucine permease, functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine, isoleucine and valine; contains 12
           predicted transmembrane domains
          Length = 609

 Score =  225 bits (573), Expect = 7e-65,   Method: Compositional matrix adjust.
 Identities = 134/452 (29%), Positives = 211/452 (46%), Gaps = 8/452 (1%)

Query: 81  QGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFS 140
           + +  D+++K+ +K RH                  +  L   GP   +I Y+ ++ + + 
Sbjct: 83  ESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALIIGYILVSFVTYF 142

Query: 141 VTQSLGEMAXXXXXX-XXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQF 199
           + Q+ GEMA                    S G A  ++Y F W     LEL      IQF
Sbjct: 143 MIQAAGEMAVTYPTLPANFNAYSSIFISKSFGFATVWLYCFQWLTVLPLELITASMTIQF 202

Query: 200 WTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AG 258
           W D +    +I+I++  L  ++ F VK YGE EF     K++ I GF+I  + + CG AG
Sbjct: 203 WNDKINPDIYILIFYVFLVFIHFFGVKAYGETEFIFNCCKILMIAGFIILSIVINCGGAG 262

Query: 259 VTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 318
             G +G  YW NPG +     +   + GRF      L+ A F++ G EL  ++  E +NP
Sbjct: 263 NDGYIGATYWHNPGAF-----AGDTSIGRFKNVCYILVTAYFSFGGMELFALSVQEQSNP 317

Query: 319 RKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX-XXXXXXPFIIAIQNSGTK 377
           RK+ P A K+                   VP++D +L           P+++A    G K
Sbjct: 318 RKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVK 377

Query: 378 VLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSA 437
           ++PHI NAVIL +++S  NS++Y G R++  LA+   AP++     + G P  A++    
Sbjct: 378 IVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCV 437

Query: 438 FGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKA 497
           FG +AF+  SS     F WL  I G++  F W  I ++H+RF Q ++ +G S D+L +KA
Sbjct: 438 FGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKA 497

Query: 498 ALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNG 529
               W + Y           Q + A AP  NG
Sbjct: 498 TTGIWGSIYGVFFNILVFVAQFWVALAPLGNG 529

>SAKL0C01650g Chr3 complement(139480..141321) [1842 bp, 613 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 613

 Score =  225 bits (573), Expect = 8e-65,   Method: Compositional matrix adjust.
 Identities = 140/459 (30%), Positives = 221/459 (48%), Gaps = 8/459 (1%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           + E   D G   D ++K+ +K RH                     L+N GP G +I Y  
Sbjct: 81  DKEDGSDAGDKGDNKLKKTIKSRHVVMISLGTGIGTGMLVGNGKALRNGGPAGLVIGYAI 140

Query: 134 MATIVFSVTQSLGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSV 192
           M + ++ + Q+ GE+A                   P++G +  ++Y   W     LEL  
Sbjct: 141 MGSCLYCIIQAAGELAVCYTSLSGGFNAYPSLLIDPALGFSVAWVYCLQWLCVMPLELVT 200

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
               I++WT +V    ++ I++ +   +N+F  + Y E EF+  + KV+ I GF I  + 
Sbjct: 201 ASITIKYWTTSVNPDIFVAIFYVLTIAINVFGARGYAEAEFFFNTCKVLMITGFFILGII 260

Query: 253 MVCG-AGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
           + CG AG  G +G +YW +PG +     S       F G VS+L+ AAF +  TE + +T
Sbjct: 261 VNCGGAGNDGYIGGKYWNDPGSF-----SGDKPIDHFKGVVSTLVTAAFAFGATEFIALT 315

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX-XXXXXXPFIIA 370
           A E ANPRK++P A KKV                  VP +  +L           P++IA
Sbjct: 316 AAEQANPRKSIPSAAKKVLYRIIVIFLGSITLVGFLVPHNSEELMGSGGSATHASPYVIA 375

Query: 371 IQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYI 430
           I + G KV+PH  NAVIL +++S GNS  Y  SR++  LA+   AP +     + G P +
Sbjct: 376 IASHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPSFLKYVDREGRPTL 435

Query: 431 AVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISR 490
           A++ ++ FG ++F+  S      F WLL I G++  F W  I ++H+RF + ++ +G S 
Sbjct: 436 AMIISAVFGLISFVAASPKEETVFTWLLAISGLSQLFTWSAICLSHIRFRRAMKVQGRSL 495

Query: 491 DDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNG 529
            +L FK+ +  W +YYA          Q +TA AP   G
Sbjct: 496 GELGFKSQVGVWGSYYATGMMLLILIGQFWTAIAPIGEG 534

>ACL135W Chr3 (115359..117125) [1767 bp, 588 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL265W (DIP5)
          Length = 588

 Score =  224 bits (570), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 148/478 (30%), Positives = 230/478 (48%), Gaps = 14/478 (2%)

Query: 73  DEDEPYVD---QGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLI 129
           D++   VD    G  +   +K++L+ RH                   + L  AGP   LI
Sbjct: 40  DQEAQSVDWNYDGKHEGIRLKKDLQARHVSMIAIGGSLGTGLLIGTGSSLMRAGPGSILI 99

Query: 130 AYLFMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALE 189
           AY  M  +VF+V   LGEMA                  P++G A G+ Y F + +    +
Sbjct: 100 AYSIMGWVVFTVMSCLGEMAAYIPLDGFTSYATRYAD-PALGFAVGWAYLFKYLVLTPNQ 158

Query: 190 LSVVGQIIQFWTDAVPLS--AWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFL 247
           L+    +IQFW  A  +S   WI +   ++ ++N   V+F+GEFEFW++S KV+ ++  +
Sbjct: 159 LTAGALVIQFWIPAARVSPGVWITVVLAVIVVINTVGVRFFGEFEFWLSSFKVLVMLCVM 218

Query: 248 IYCLCMVCGAGVT-GPVGFRYWRNPG---PWGPGIISSQVAEGRFLGWVSSLINAAFTYQ 303
           I  L +  G G T   +GFRYW +PG    +       +   G+F+ ++S  + A F Y 
Sbjct: 219 ILLLVLALGGGPTHDRLGFRYWSDPGAFKEYSKKDTHIKGGLGKFVAFLSVFVYALFAYL 278

Query: 304 GTELVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXX 363
           GTEL GI A E  +PR+ VPRAIK                    V ++DP L        
Sbjct: 279 GTELCGIVAAECKDPRRNVPRAIKLTLYRIVVFYLVTIFLLGMCVAYNDPLLMQASSAEV 338

Query: 364 XX---PFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFG 420
                P+++AI+N+   VLP++FNA +L+ + SA NS++YVGSR ++GLA    AP+ F 
Sbjct: 339 SAAASPYVVAIENAVIPVLPNLFNACVLTFVFSACNSDLYVGSRSLYGLAIDGKAPKLFA 398

Query: 421 ITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFI 480
            T K GVPY A+   + F  LA++ VS     AF + +N+  + G  +W+ I I ++ F 
Sbjct: 399 RTNKWGVPYNALACCTLFCCLAYMSVSKSARTAFGYFVNVTSIFGLMSWVSILITYICFD 458

Query: 481 QTLEHRGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAF-APTFNGSDFVAAYI 537
           +    +GI +  L + A   P+  + A          + F AF     +   F+  YI
Sbjct: 459 RAFRAQGIPKSTLSYVAPCQPYAGWVALIFCIFVALIKNFDAFIGKEVDVPTFITGYI 516

>KLLA0A11770g Chr1 (1014918..1016663) [1746 bp, 581 aa] {ON} similar
           to uniprot|P06775 Saccharomyces cerevisiae YGR191W HIP1
           High-affinity histidine permease also involved in the
           transport of manganese ions
          Length = 581

 Score =  223 bits (569), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 148/506 (29%), Positives = 236/506 (46%), Gaps = 20/506 (3%)

Query: 74  EDEPYVDQGVVQ-------DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVG 126
           E++ Y D   V+       D+++ ++L  RH                     L   GP  
Sbjct: 42  EEKDYADMNDVEKAIYNTKDSKLNKDLSIRHLLTLAVGGAIGTGLFVNSGDSLSTGGPAS 101

Query: 127 SLIAYLFMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITF 186
            +IA+  ++T +F++  SLGE++                  PS G A  + Y   WAI  
Sbjct: 102 LVIAWTIISTCLFTIVNSLGELSATFPVVGGFNVYVTRFVEPSFGFAVNFNYLAQWAILL 161

Query: 187 ALELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGF 246
            LEL      I++W  ++   AW+ I++  +   NM  VK +GE EF ++ +K++AI+GF
Sbjct: 162 PLELCAASITIRYWNKSINPDAWVSIFYVAIAFANMLDVKSFGETEFVLSMVKILAIIGF 221

Query: 247 LIYCLCMVCGAGVTGPVGF-RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGT 305
            I  + ++CG G +G     +YW +PG +  G   +Q    RF G  +  I AAF+Y G 
Sbjct: 222 TILGIVLICGGGPSGGFIGGKYWNDPGAF-VGDTPAQ----RFKGLSAVFITAAFSYSGL 276

Query: 306 ELVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX--XXXXXXX 363
           ELVG++A E+ NPR T+P+A K+                   VP +DP L          
Sbjct: 277 ELVGVSAAESRNPRVTLPKAAKRTFWLITMSYLVILTLIGCLVPSNDPLLLNGTSSVDAA 336

Query: 364 XXPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITT 423
             P +IAIQN G K LP + NA+IL  ++S  NS +Y  SR +  +A+    PR      
Sbjct: 337 ASPLVIAIQNGGIKGLPSLMNAIILIALLSVANSAVYACSRCIISMAEIGNLPRSLAHVD 396

Query: 424 KHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTL 483
           K G P  A+  T   G L+F+  S+   + F WL  + G++  F W  I++AH+RF   +
Sbjct: 397 KKGRPLYAIAITLLVGLLSFIAASNKRDEVFTWLSALSGLSTLFCWFAINLAHLRFRHAM 456

Query: 484 EHRGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPT-FNGSD---FVAAYIXX 539
           +H+  S ++LP+ +    W ++Y             +T+  P   NG+D   F  +Y+  
Sbjct: 457 KHQNRSLEELPYVSMTGEWGSWYGCIVIGLVLIASFWTSLFPAGGNGADATSFFESYLSL 516

Query: 540 XXXXXXXXXXQLYFR-CKLYWSLDEV 564
                     +++ R  +LY  L EV
Sbjct: 517 PIFIACYLGHKIWKRNLRLYIKLSEV 542

>Skud_11.275 Chr11 (496787..498595) [1809 bp, 602 aa] {ON} YKR039W
           (REAL)
          Length = 602

 Score =  224 bits (570), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 142/446 (31%), Positives = 210/446 (47%), Gaps = 8/446 (1%)

Query: 83  VVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVT 142
           V     +K  LK RH                   T L+  GP   LI +    T+++S+ 
Sbjct: 80  VTAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYSMV 139

Query: 143 QSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW-T 201
            +LGE+A                   S G AN + Y   W +   LE+      + FW T
Sbjct: 140 MALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGT 199

Query: 202 DAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTG 261
           D      ++ ++W ++ I+NMF VK YGE EF  + IKVI ++GF+I  + + CG G  G
Sbjct: 200 DPKYRDGFVALFWLVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEG 259

Query: 262 PVGF-RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 320
                +YW +PG +     +      +F G  S  + +AF++ G+ELVG+ A E+ +PRK
Sbjct: 260 GYIGGKYWHDPGAF-----AGDTPGAKFKGLCSVFVTSAFSFAGSELVGLAASESVDPRK 314

Query: 321 TVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX-XXXXXXXXXPFIIAIQNSGTKVL 379
           +VP+A K+V                  VP++DP L           PF+IAI+  G K L
Sbjct: 315 SVPKAAKQVFWRITLFYILSLLMVGLLVPYNDPNLIGASSVDAAASPFVIAIKTHGIKGL 374

Query: 380 PHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFG 439
           P + N VIL  ++S GNS IY  SR M  LA+ +  P+ F    + G P + +  TSAFG
Sbjct: 375 PTVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIAVTSAFG 434

Query: 440 ALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAAL 499
            +AF+  S      FNWLL + G++  F W  I I H+RF + L  +G   D+L FK+  
Sbjct: 435 LIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPT 494

Query: 500 MPWLAYYAXXXXXXXXXXQGFTAFAP 525
             W +Y+           Q + A  P
Sbjct: 495 GVWGSYWGLFMVVIMFIAQFYVALFP 520

>NDAI0B05220 Chr2 (1278386..1280221) [1836 bp, 611 aa] {ON}
           Anc_1.244
          Length = 611

 Score =  224 bits (571), Expect = 1e-64,   Method: Compositional matrix adjust.
 Identities = 135/413 (32%), Positives = 205/413 (49%), Gaps = 8/413 (1%)

Query: 86  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSL 145
            A +K  LK RH                  ST L+ AGP G +I +   +T+++ +  +L
Sbjct: 92  KAPLKHTLKGRHMQMVAIGGAIGSGLFVGSSTALRTAGPAGIVIGWGLTSTMIYCMVMAL 151

Query: 146 GEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW-TDAV 204
           GE+A                   S G A+ + Y   W  T  LE+      + +W T   
Sbjct: 152 GELAVVFPVSGGFTTYATRFIDESFGFASNFNYALQWLATLPLEIVSASITVNYWQTPER 211

Query: 205 PLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVG 264
               ++ ++W ++ I+N+F V+ +GE EF  ++IKV+ ++GF+I  + +V G G  G   
Sbjct: 212 YRDGFVALFWLVIVIINLFGVRGFGEAEFVFSTIKVLTVIGFIILGIVLVAGGGPEGGFV 271

Query: 265 F-RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 323
             RYW NPG +         A  +F G  S  + AAF++ G+ELVGITA EAANPRK+VP
Sbjct: 272 GGRYWHNPGAF-----VGDNAGTQFKGVCSVFVTAAFSFAGSELVGITAAEAANPRKSVP 326

Query: 324 RAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX-XXXXXXXXXPFIIAIQNSGTKVLPHI 382
           RA K+V                  VP+ DP+L           PF+IAI   G + LP +
Sbjct: 327 RAAKQVVWRIVLFYMGSLIMIGLLVPYTDPRLIGASSVDASASPFVIAIVTHGIRGLPSV 386

Query: 383 FNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALA 442
            N VIL  ++S GNS I+ GSR +  L++    P  FG   + G P + ++  S FG +A
Sbjct: 387 INVVILIAVLSVGNSAIFAGSRTIAALSEQGFLPEIFGYIDRKGRPLVGIIVISTFGLIA 446

Query: 443 FLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPF 495
           F+  S    + F WL+ + G++  F W  I + H+RF   L+ +G S ++LPF
Sbjct: 447 FIAASKKQGEVFAWLMALSGLSSLFTWGGICLCHIRFRMALKAQGRSTNELPF 499

>NCAS0E02260 Chr5 (437115..438896) [1782 bp, 593 aa] {ON} Anc_7.44
          Length = 593

 Score =  223 bits (569), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 147/479 (30%), Positives = 228/479 (47%), Gaps = 20/479 (4%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           DE++    Q   ++ ++K+ LK RH                  S  L   GP G   +YL
Sbjct: 57  DEEK---QQQPEENGKLKQGLKSRHVQLIALGGTIGTGLLVGSSQTLATCGPAGLFTSYL 113

Query: 133 FMATIVFSVTQSLGEMAXX-----XXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFA 187
            + T ++ +  + GEM                         S+G A+ + Y++ + I  A
Sbjct: 114 IICTFIYPIMNAFGEMVCYLPGNGSDSAGSSAYLVEKYVDRSLGFASSWNYYYCFVILVA 173

Query: 188 LELSVVGQIIQFWTDA--VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMG 245
            E +    ++++W  A  VP  AWI I+ F +  +NM PV FYGE EFW ASIK++ I+G
Sbjct: 174 TECTAAAGVVEYWAWALKVPKGAWITIFLFCVVALNMLPVNFYGESEFWFASIKILCILG 233

Query: 246 FLIYCLCMVCGAGVTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY-Q 303
            +I    +  G G +   +GFRYW+ PG +   I       G FL   + +I   F +  
Sbjct: 234 LIILSFILFWGGGPSHDRLGFRYWQRPGAFADHITDG--TGGNFLDVYTGVIKGGFAFVL 291

Query: 304 GTELVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXX 363
           G ELV +T+ E  + R+ + +A ++                   V ++DP L        
Sbjct: 292 GPELVSLTSSECHDQRRNIAKASRRFVWRLMIFYVLGSLSISVIVAYNDPNLQNALAQSK 351

Query: 364 ----XXPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWF 419
                 PF+I IQN+G KVLPHI N  I+++  SAGN+ ++  SR +  +A    AP++F
Sbjct: 352 PGAGSSPFVIGIQNAGIKVLPHIINVCIMTSAWSAGNAYMFASSRSLLTMASHGHAPKFF 411

Query: 420 GITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRF 479
               + GVPY+AV F+  F  LA+L VSS  A  FNW  NI  ++GF  W+   +A++RF
Sbjct: 412 SKINRFGVPYVAVGFSFLFCCLAYLNVSSSTANVFNWFSNISTISGFIGWICACVAYIRF 471

Query: 480 IQTLEHRGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTF-NGSDFVAAYI 537
            + +    +  D LP+K     +L +Y+           G+  F P F +  DF+AAYI
Sbjct: 472 RKAIIFNDL-YDRLPYKGFAQKYLIWYSLFMVSLITLTNGYQIFIPRFWDYKDFIAAYI 529

>KLTH0E15642g Chr5 (1389937..1391727) [1791 bp, 596 aa] {ON} similar
           to uniprot|P19145 Saccharomyces cerevisiae YKR039W GAP1
           General amino acid permease localization to the plasma
           membrane is regulated by nitrogen source
          Length = 596

 Score =  223 bits (567), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 143/472 (30%), Positives = 215/472 (45%), Gaps = 11/472 (2%)

Query: 89  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEM 148
           ++R LK RH                   + L+  GP   LI +  +  +++SV  ++GE+
Sbjct: 80  LQRHLKNRHLQMIAIGGAIGTGLFVGSGSALRTGGPAAVLIGWGLIGLMIYSVVMAMGEL 139

Query: 149 AXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW-TDAVPLS 207
           A                   S G A  Y+Y   W +   LE+      + +W T A    
Sbjct: 140 AVTFPVAGGFTTYIPRFVDDSFGFAINYIYMLQWLVVLPLEIVAASITVNYWGTPAKYRD 199

Query: 208 AWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVGF-R 266
            ++ +++ ++ I+NMF VK YGE EF  + IKV  ++GF+I  + ++CG G  G     +
Sbjct: 200 GFVALFYVVIVIINMFGVKGYGEAEFVFSIIKVTTVVGFIILGIVLICGGGPVGGYVGGK 259

Query: 267 YWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAI 326
           YW NPG +     +   A  RF    S  + AAF++ GTELVG+ A E  NPRK +PRA 
Sbjct: 260 YWHNPGAF-----NGDNAGQRFKAVCSVFVTAAFSFAGTELVGLAAAETENPRKALPRAA 314

Query: 327 KKVSXXXXXXXXXXXXXXXXXVPFDDPKLX-XXXXXXXXXPFIIAIQNSGTKVLPHIFNA 385
           K+V                  VP+    L           PF++AI+  G   LP + N 
Sbjct: 315 KQVFWRITLFYIISLCLIGLLVPYTSENLIGSSSVDAAASPFVLAIKTHGISGLPSVINV 374

Query: 386 VILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLE 445
           VIL +++S GNS++Y  SR +  LA     P+ F    + G P + +L T  FG L F+ 
Sbjct: 375 VILISVLSVGNSSVYACSRTLSALADQGFLPQIFSYIDRKGRPLVGILATCTFGLLCFIA 434

Query: 446 VSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAY 505
            S      FNWL+ + G++  F W  I I H+RF + L  +G S D+L F + +  W +Y
Sbjct: 435 QSKKEGDVFNWLMALSGLSSLFTWGFICICHLRFRRALAAQGRSTDELAFTSYVGVWGSY 494

Query: 506 YAXXXXXXXXXXQGFTAFAP---TFNGSDFVAAYIXXXXXXXXXXXXQLYFR 554
           +           Q + A  P   T N SDF  AY+            +LY R
Sbjct: 495 FGVILICLVFIAQFWIAVWPMGGTPNASDFFQAYLSVVVVLFFYLAHKLYTR 546

>NDAI0A00640 Chr1 complement(118100..120025) [1926 bp, 641 aa] {ON}
           Anc_1.50
          Length = 641

 Score =  223 bits (569), Expect = 4e-64,   Method: Compositional matrix adjust.
 Identities = 134/456 (29%), Positives = 219/456 (48%), Gaps = 9/456 (1%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           +  E+K  +K RH                   T L N+GP G +I Y  M + ++ + Q+
Sbjct: 119 KSEELKHSIKPRHVIMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYAIMGSCIYCIIQA 178

Query: 145 LGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
            GEMA                   P++G +  ++Y   W     LEL      I++WT  
Sbjct: 179 TGEMAVLYSKLIGGFNSYPSFLIEPALGFSVAWVYCIQWLCVCPLELVTASMTIKYWTTK 238

Query: 204 VPLSAWIVIWWFILTIMNMFP-VKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTG 261
           V    ++VI++ ++ ++N+      Y E EF+  S K++ ++GF I  + ++CG AG  G
Sbjct: 239 VDPDVFVVIFYVLIILINVLGGAAGYAEAEFFFNSCKILMLLGFFILGIILICGGAGDDG 298

Query: 262 PVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 321
            +G RYW +PG +       + A  RF G VS+L+NAAF +  +E++G+TA E +NPRK 
Sbjct: 299 YIGGRYWHDPGAF-----RGEHAIDRFKGVVSTLVNAAFAFGLSEMIGVTASEQSNPRKA 353

Query: 322 VPRAIKKVSXXXXXXXXXXXXXXXXXVPFD-DPKLXXXXXXXXXXPFIIAIQNSGTKVLP 380
           +P A KK+                  VP++ D  L          P+++A+   G +V+P
Sbjct: 354 IPSAAKKMIYRIVCIYLGSVVIVGFLVPWNSDQLLGSSGGGVKASPYVLAVSTHGVRVVP 413

Query: 381 HIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGA 440
           H  NAVIL +++S  NS  Y  SR++ GLA+   AP+ F    + G P + +   +    
Sbjct: 414 HFINAVILLSVLSVANSAFYSSSRLLLGLAEQGYAPKIFKYVDREGRPTMGMCVAALVNV 473

Query: 441 LAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALM 500
           ++F   S    + F WLL I G++  F W  I ++H+RF + +  +G S  ++ FK+   
Sbjct: 474 ISFCATSPKEDQVFVWLLAISGLSQLFTWSAICLSHIRFRRAMAVQGRSLGEIGFKSQCG 533

Query: 501 PWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAY 536
            W ++YA          Q + A AP   G   V A+
Sbjct: 534 VWGSWYAFIMMMLILIAQFWVAIAPIGEGRLDVQAF 569

>AGR319W Chr7 (1328425..1330305) [1881 bp, 626 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YGR191W (HIP1)
          Length = 626

 Score =  223 bits (567), Expect = 6e-64,   Method: Compositional matrix adjust.
 Identities = 133/426 (31%), Positives = 203/426 (47%), Gaps = 14/426 (3%)

Query: 76  EPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMA 135
           E  V       +++ + L  RH                     L   GP   LIA+  ++
Sbjct: 96  ERAVCDAARNSSQLSKNLSIRHLLTLAVGGAIGTGLFVNSGASLNTGGPGSILIAWTLIS 155

Query: 136 TIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQ 195
           T +F++  SLGE+A                  PS G A    Y   WA+   LEL+    
Sbjct: 156 TCLFTIVNSLGELASAFPVVGGFNVYITRFVEPSFGFAVNISYLAQWAVLLPLELAAASI 215

Query: 196 IIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVC 255
            I++W + +   AW+ I++  + + NM  VK +GE EF ++ +K++AI GF I    ++C
Sbjct: 216 TIKYWNNKINSDAWVAIFYVCIALANMLDVKSFGETEFVLSMVKILAIFGFAILGTVLIC 275

Query: 256 GAGVTGPVGF-RYWRNPGPW---GPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
           G G  G     +YW +PG +    PG         +F G  S  + AAF+Y GTELVG++
Sbjct: 276 GGGPVGGFIGAKYWHDPGAFVGDTPG--------AQFKGLCSVFVTAAFSYSGTELVGVS 327

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX--XXXXXXXXXPFII 369
           A E+ NPR T+PRA K+                   VP +DP+L            P +I
Sbjct: 328 AAESINPRYTIPRASKRSFWLITSSYLLVLTIAGCLVPSNDPRLLNGMSSVDVAASPLVI 387

Query: 370 AIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPY 429
           AI+N G + +P + NA+IL  IIS  NS++Y  SR M  +A+    P+ F    + G P 
Sbjct: 388 AIENGGIRGVPSLMNAIILIAIISVANSSVYACSRCMVSMAQVGNLPKVFNYIDRKGRPL 447

Query: 430 IAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGIS 489
           +A+L T  FG L+F+  S      F WL  + G++  F W  I+I+H+RF + +  +  S
Sbjct: 448 VAILATLVFGLLSFVAASDKQEAIFTWLSALSGLSTLFCWFAINISHIRFRRAMCAQQRS 507

Query: 490 RDDLPF 495
            D+LP+
Sbjct: 508 LDELPY 513

>Kwal_27.12681 s27 (1332647..1334428) [1782 bp, 593 aa] {ON} YKR039W
           (GAP1) - 1:1 [contig 260] FULL
          Length = 593

 Score =  221 bits (564), Expect = 8e-64,   Method: Compositional matrix adjust.
 Identities = 144/461 (31%), Positives = 213/461 (46%), Gaps = 11/461 (2%)

Query: 83  VVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVT 142
           +   + ++R LK RH                     L+  GP G LI +  +  +++ V 
Sbjct: 71  ITAQSPLQRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTGGPAGVLIGWGLIGLMIYCVV 130

Query: 143 QSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW-T 201
            S+GE+A                   S G A  Y Y   W +   LE+      + FW T
Sbjct: 131 MSMGELAVTFPVSGGFTTYATRFVDESFGFAINYNYMLQWLVVLPLEIVAASITVNFWGT 190

Query: 202 DAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTG 261
                  ++ +++ ++ I+N F V+ YGE EF  + IKVI ++GF+I  + +VCG G  G
Sbjct: 191 PPKYRDGFVALFYIVIVIINFFGVRGYGEAEFVFSFIKVITVIGFIILGIVLVCGGGPVG 250

Query: 262 PVGF-RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 320
                +YW NPG +     S   A  RF G  S  + AAF++ GTELVG+ + E ANPRK
Sbjct: 251 GYIGGKYWHNPGAF-----SGDDAGSRFKGVCSVFVTAAFSFAGTELVGLASAETANPRK 305

Query: 321 TVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX-XXXXXXXXXPFIIAIQNSGTKVL 379
            +PRA K+V                  VP    +L           PF++AIQ  G K L
Sbjct: 306 ALPRAAKQVFWRILLFYIISLCLIGLLVPHTSERLIGTSSVDAAASPFVLAIQTHGIKGL 365

Query: 380 PHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFG 439
           P + N VIL +++S GNS +Y  SR M  LA+    P  F    + G P +A++ T  FG
Sbjct: 366 PSVINVVILISVLSVGNSAVYACSRSMVALAEQGSLPHIFAYIDRKGRPLVAIITTCVFG 425

Query: 440 ALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAAL 499
            L+F+  S      FNWLL + G++  F+W  I I H+RF + L  +G S D+L F +  
Sbjct: 426 LLSFIAQSEKEGDVFNWLLALSGLSTLFSWGAICICHIRFRRALSAQGRSTDELAFVSYA 485

Query: 500 MPWLAYYAXXXXXXXXXXQGFTAFAP---TFNGSDFVAAYI 537
               +Y+           Q + A  P   + N  DF +AY+
Sbjct: 486 GIAGSYFGVILVLLVLIAQFWVAVWPIGGSPNAEDFFSAYL 526

>TPHA0E03660 Chr5 (775232..777175) [1944 bp, 647 aa] {ON} Anc_1.50
           YDR508C
          Length = 647

 Score =  222 bits (566), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 136/448 (30%), Positives = 209/448 (46%), Gaps = 8/448 (1%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
            +  +K+ ++ RH                   T LKNAGP G +I Y  M +I++ + Q+
Sbjct: 126 DNKALKQTIRPRHVVMISLGTGIGTGLLVGNGTALKNAGPAGLVIGYSIMGSIIYCIIQA 185

Query: 145 LGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
            GEMA                      G A  ++Y   W     LEL      I++WT +
Sbjct: 186 TGEMAIAYSNLPGGYNVYPSFLVEKGFGFAIAWVYCIQWLTVCPLELVTASLTIKYWTTS 245

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGP 262
           V    ++ I++ ++ I+N+F  K Y E EF+    KV+ ++GF I  + +  G AG  G 
Sbjct: 246 VNSDIFVAIFYALIIIINVFGAKGYAEAEFFCNCCKVLMMIGFFILSITITAGGAGNDGY 305

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
           +G  YW  PG +         +   F G   +L+ AAF Y GTE + +TA E +NPR  +
Sbjct: 306 LGGLYWHTPGAF-----RGDSSIDHFKGICGTLVTAAFAYGGTEFLALTAAEQSNPRAAI 360

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX-XXXXXXPFIIAIQNSGTKVLPH 381
           P A KKV                  VPFD  +L           P+++A    G +V+PH
Sbjct: 361 PSAAKKVLYRIICVYLISILMIGFLVPFDSTRLLGSDGSATSASPYVLAASLHGVRVVPH 420

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
             NAVIL +++S GNS  Y  SR++  LA+   AP+WF    + G P  A+L ++ FG +
Sbjct: 421 FINAVILISVLSVGNSAFYSSSRLLMSLARQGYAPKWFDYIDREGRPARAMLMSALFGVI 480

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
           AF   S    + F WLL I G++  F W  I ++H+RF   ++ +G S  ++ + A    
Sbjct: 481 AFCAASPKETEVFTWLLAISGLSQLFTWCAICLSHIRFRTAMKVQGRSLGEVGYLAQTGV 540

Query: 502 WLAYYAXXXXXXXXXXQGFTAFAPTFNG 529
           W ++YA          Q + A AP  +G
Sbjct: 541 WGSWYALFMMFLIYIAQFWVAIAPIGSG 568

>ZYRO0F17446g Chr6 (1451431..1453332) [1902 bp, 633 aa] {ON} similar
           to uniprot|P48813 Saccharomyces cerevisiae YDR508C GNP1
           High-affinity glutamine permease also transports Leu Ser
           Thr Cys Met and Asn expression is fully dependent on
           Grr1p and modulated by the Ssy1p-Ptr3p-Ssy5p (SPS)
           sensor of extracellular amino acids
          Length = 633

 Score =  222 bits (565), Expect = 1e-63,   Method: Compositional matrix adjust.
 Identities = 134/453 (29%), Positives = 217/453 (47%), Gaps = 7/453 (1%)

Query: 80  DQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVF 139
           D+ V++  E+KR++ QRH                  ++ L +AGP G LI Y  M T V+
Sbjct: 108 DEVVIKKEELKRDINQRHMVFMAIGSGVGTGLLVGNASTLNSAGPAGLLIGYALMGTCVY 167

Query: 140 SVTQSLGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQ 198
            V Q+ GE+                    PS   + G++Y   W     LEL      I+
Sbjct: 168 CVIQAAGELGVTYANLIGGFNAYPAILVAPSFAFSVGWIYTLQWLCMTPLELVTASLTIK 227

Query: 199 FWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-A 257
           +WT  V    ++VI++ ++ ++N F  K Y E +F+   +K+  I GF I  + + CG A
Sbjct: 228 YWTTKVDPDVFVVIFYLLILLINFFGSKGYAEADFFFNCMKLAMISGFFILGIVVACGGA 287

Query: 258 GVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 317
           G  G +G +YW NPG +       + A   F G  S  + +AF + G+E V ++A E AN
Sbjct: 288 GHDGYLGGKYWHNPGAF-----RGEKAIDHFKGVSSVFVTSAFAFGGSEFVALSASEQAN 342

Query: 318 PRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTK 377
           PRK++P A K +                  VP+D P+L          P+++AI   G K
Sbjct: 343 PRKSIPSAAKLILYRIIWVYLTSITILGFLVPWDSPQLQPSSDGKKTSPYVVAIAMHGVK 402

Query: 378 VLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSA 437
           V+PH+ NAVIL  ++S  NS  +  SR++  L++   AP+WF    + G P  A+L ++ 
Sbjct: 403 VVPHLINAVILMAVLSVSNSAFFYSSRLLLSLSQRGYAPKWFDYVDRKGRPVRAMLISAL 462

Query: 438 FGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKA 497
           FG + F   S      F+WLL I G++  F +  I ++H+R    ++ +G S  +L F++
Sbjct: 463 FGVICFCATSKKETDVFSWLLAISGLSTIFTYFSICVSHIRMRSAMKVQGRSLGELGFRS 522

Query: 498 ALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGS 530
            +  + ++YA          + + A AP   G 
Sbjct: 523 QVGTYGSFYACLLLVLSLMAEFWVALAPIGEGK 555

>Smik_6.482 Chr6 complement(795927..797603) [1677 bp, 558 aa] {ON}
           YPL265W (REAL)
          Length = 558

 Score =  220 bits (560), Expect = 2e-63,   Method: Compositional matrix adjust.
 Identities = 137/456 (30%), Positives = 219/456 (48%), Gaps = 18/456 (3%)

Query: 76  EPYVDQGVVQD--AEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           E  V +GV+ +   ++K+ LK+RH                     LK  GPVG LIAYLF
Sbjct: 34  EETVKRGVLHNDRTKLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLF 93

Query: 134 MATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFAL----E 189
           +  +V     ++ E+A                   S+G      + F W  T++     E
Sbjct: 94  VGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDESVG------FTFGWISTYSSLMPGE 147

Query: 190 LSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIY 249
           LS    I+++WTD  P + +I ++  +  + N++ ++FYGE E+    +K++ I   +I 
Sbjct: 148 LSATAVIMRYWTDVSP-AVFITVFGILFVVTNIYTIRFYGELEYIFGWLKLVLIFILIIS 206

Query: 250 CLCMVCGAGVTGP--VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTEL 307
            L +  G G  G   +GF YWR PGP+   ++   +  G+F+G+ +++ +  ++Y G + 
Sbjct: 207 GLVIDLG-GTKGQERLGFHYWREPGPFANYLVGGHI--GKFVGFWAAISSVVYSYSGIQN 263

Query: 308 VGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPF 367
           + I AGE  N R  +    K V                  VP++D  +          PF
Sbjct: 264 IAILAGETKNSRHAIFHGAKNVFLRIIVLYLVTVFILTLIVPYNDKLIATGTGTARSSPF 323

Query: 368 IIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGV 427
           +IA+  +G KVLPHI NA+IL++  SAGN  I  GSR +F LA    AP+ F  T+K G+
Sbjct: 324 VIAMNRAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLRTSKRGI 383

Query: 428 PYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRG 487
           PY+ V+F S+F  LA++  S   A  F W   +V       W+LIS  H+   + L+ +G
Sbjct: 384 PYVGVIFISSFLPLAYMSCSKSSATVFGWFQELVSSNTLLRWILISANHIHMDRALKAQG 443

Query: 488 ISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAF 523
            SR DLP+   + P+ A+++           GF  F
Sbjct: 444 YSRSDLPYSTPMGPFAAWFSGIMSFIFLLTGGFYNF 479

>CAGL0B01012g Chr2 (91330..93201) [1872 bp, 623 aa] {ON} similar to
           uniprot|P25376 Saccharomyces cerevisiae YCL025c AGP1
           Asparagine/glutamine permease or uniprot|P48813
           Saccharomyces cerevisiae YDR508c GNP1
          Length = 623

 Score =  220 bits (561), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 130/461 (28%), Positives = 215/461 (46%), Gaps = 8/461 (1%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
            E++   ++   ++ E+K+ +K RH                  +  L NAGP G LI Y 
Sbjct: 90  QENQVLTEKSNQKNKELKQTIKPRHVILISLGTGIGTGLLVGNAKALHNAGPAGLLIGYS 149

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELS 191
            M T ++ + Q+ GE+A                   P+ G +  ++Y   W     LEL 
Sbjct: 150 IMGTCLYCIIQAAGELAVSYSSLSGGFNVYPSFLVDPAFGFSVAWVYCIQWLCVCPLELV 209

Query: 192 VVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCL 251
                I++WT  V    ++ I++ ++ ++N F  + Y E EF+    K++ ++GF I  +
Sbjct: 210 TASMTIKYWTTTVNADIFVGIFYVLIIVINTFGARGYAEAEFFFNCCKILMMIGFFILGI 269

Query: 252 CM-VCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGI 310
            +   GAG  G +G RYW  PG +     +       F G +++++ AAF +  TE + +
Sbjct: 270 VINTGGAGNDGYIGDRYWHTPGAF-----AGDRPIDHFKGIMATMVTAAFAFGATEFIAL 324

Query: 311 TAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX-XXXXXXPFII 369
           TA E +NPRK +P A KKV                  VP+D  +L           P+++
Sbjct: 325 TAAEQSNPRKAIPSAAKKVLYRILFIFLGSITLVGFLVPYDSDQLMGSGGSATKASPYVL 384

Query: 370 AIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPY 429
           A+   G KV+PH  NAVIL +++S GNS  Y  SR+++ LA+   AP++F    + G P+
Sbjct: 385 AVSTHGVKVVPHFINAVILLSVLSVGNSAFYSSSRLLYSLAQQGNAPKFFDYVDREGRPF 444

Query: 430 IAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGIS 489
            A++    F  ++F   S    + F WLL I G++  F W  I ++H+RF + +  +  S
Sbjct: 445 RAMVCAGVFAIISFCAASPKEEQVFTWLLAISGLSQVFTWFAICLSHIRFRKAMFVQKRS 504

Query: 490 RDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGS 530
             ++ FKA    W +YY           Q + A AP   G 
Sbjct: 505 LGEIGFKAQTGVWGSYYVCFMLVMILIAQFWVAIAPIGEGK 545

>AFR698C Chr6 complement(1726387..1728216) [1830 bp, 609 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR508C
           (GNP1) and YCL025C (AGP1)
          Length = 609

 Score =  220 bits (560), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 132/418 (31%), Positives = 206/418 (49%), Gaps = 10/418 (2%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           +   +K+ +K RH                   T L + GP GS I +L M   V+ V Q+
Sbjct: 86  KHENLKQTIKSRHMIMISLGTGIGTGLLVGSGTALHDGGPAGSAIGFLIMGLCVYCVIQA 145

Query: 145 LGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW--T 201
            GE+A                   P++G A  ++Y   W   F LEL      I+FW  +
Sbjct: 146 AGELAVCYTSLAGGFNAYPSFLIDPALGFATAWVYCLQWLCVFPLELVTASITIKFWPGS 205

Query: 202 DAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGA-GVT 260
            +V    ++ I++ ++ ++N F  + Y E EF+  S KV+ ++GF I  + +  GA G +
Sbjct: 206 RSVNPDIYVAIFYVLIIVINFFGARGYAEAEFFFNSCKVLMMIGFFIVGILINTGAVGTS 265

Query: 261 GPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 320
           G +G +YWR+PG  G      +     F G V++L+NAAF+   +E V +TA E ANPRK
Sbjct: 266 GYIGGKYWRDPGSLG-----GRTHFDHFKGIVATLVNAAFSLGCSEFVALTAAEQANPRK 320

Query: 321 TVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX-XXXXXXXXXPFIIAIQNSGTKVL 379
           ++P A KK+                  VP D  +L           P++IA++  G  V+
Sbjct: 321 SIPAAAKKMIYKIFVVFLGSVILIGFLVPKDSHELMGSNDSDLHVSPYVIAVRMHGVNVV 380

Query: 380 PHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFG 439
           P   NAVIL +++S GNS  Y  SR++  LA+   AP+ F    + G P +A++ +  FG
Sbjct: 381 PSFINAVILLSVLSVGNSAFYSSSRLLHSLAEQNYAPKIFKYIDRAGRPLMAMIISILFG 440

Query: 440 ALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKA 497
            + F+  S    + F WLL I G++  F W  I ++H+RF + L  +G S D+L FKA
Sbjct: 441 TICFVAASPKEEEVFKWLLAISGLSQLFTWSTICLSHIRFRRALAVQGYSTDELGFKA 498

>TBLA0A05190 Chr1 complement(1271605..1273608) [2004 bp, 667 aa]
           {ON} Anc_1.50 YDR508C
          Length = 667

 Score =  221 bits (563), Expect = 5e-63,   Method: Compositional matrix adjust.
 Identities = 135/471 (28%), Positives = 216/471 (45%), Gaps = 14/471 (2%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           + +P   Q   ++A++K+ +K RH                   TPL  AGP   +I Y  
Sbjct: 137 DSQPVEQQD--ENAQLKQTIKPRHVIMMSLGTGIGTGLLVGNGTPLAQAGPAPLVIGYGI 194

Query: 134 MATIVFSVTQSLGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSV 192
           M T ++ + Q+ GE+A                   P    A  ++Y   W     LEL  
Sbjct: 195 MGTCLYCIIQACGELAVAYSKVNGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVT 254

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
               I++WT  V    ++VI++ ++ ++N F  K Y E EF+    KV+ ++GF I  +C
Sbjct: 255 SSMTIKYWTTKVDPDVFVVIFYVLILLINFFGAKGYAEAEFFFNCCKVMMMIGFFIMAIC 314

Query: 253 MVCGA-GVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
           +  GA G  G +G +YW +PG +       Q    RF G + + + AAF +  TE + +T
Sbjct: 315 INTGAAGTDGYIGAKYWNDPGAF-----RGQTKIERFKGVMDTFVTAAFAFGATEFIALT 369

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFD-DPKLXXXXXXXXXXPFIIA 370
           A E +NPRK +P A KKV+                 VP++ D  +          P+++A
Sbjct: 370 AAEQSNPRKAIPSAAKKVAYRILLIFLTSIILIGFLVPYNSDQLMGSSSGGNSASPYVLA 429

Query: 371 IQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYI 430
               G  V+ H  NAVIL +++S  NS  Y  SR++ GLA+   AP+WF    ++G P  
Sbjct: 430 ASLHGVHVVQHFINAVILLSVLSVANSAFYSSSRLLLGLAQVGYAPKWFDYVDRNGRPLR 489

Query: 431 AVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISR 490
           ++L  +    +AF   S      F WLL I G++  F W  I ++H+RF + ++ +G S 
Sbjct: 490 SMLCAAIIAVIAFCATSPKETDVFTWLLAISGLSQIFTWFAICVSHIRFRRGMQVQGRSL 549

Query: 491 DDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP----TFNGSDFVAAYI 537
            +L F+A      +YYA          Q + A  P    T +  +F   Y+
Sbjct: 550 GELGFRAQTGVLGSYYAAIMLFLALVAQFWVALVPMNTHTLDAENFFQNYL 600

>SAKL0C13992g Chr3 complement(1242080..1243738) [1659 bp, 552 aa]
           {ON} similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 552

 Score =  218 bits (556), Expect = 6e-63,   Method: Compositional matrix adjust.
 Identities = 139/450 (30%), Positives = 210/450 (46%), Gaps = 13/450 (2%)

Query: 89  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEM 148
           VKR LK RH                     L   GP+  L+ +  +  + F+V +S+GEM
Sbjct: 44  VKRALKNRHISLLALGGIIGPGCLVGAGNALSKGGPLSLLLGFGIIGIVAFAVMESIGEM 103

Query: 149 AXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLSA 208
                               ++ A +GY Y   +    A E + +  I+QFW   VPL  
Sbjct: 104 ITLYPSGSGFSTLSRRFHSDALSAVSGYAYVVVFFAVLANEYNTLSSILQFWGPQVPLYG 163

Query: 209 WIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPV-GFRY 267
           +I+I+     +  M  V  +GEFE+W+A  K+I ++ + I+ +  + G     P  GF Y
Sbjct: 164 YILIFSVAFQVFQMLGVGIFGEFEYWLAWFKIIGLIAYYIFSIIYISGGIKNRPAFGFHY 223

Query: 268 WRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIK 327
           W NPG    G          F G     +  +  Y GTE V + A E+ NP K VP AIK
Sbjct: 224 WNNPGALADG----------FKGIAVVFVFCSSFYSGTESVALAATESRNPGKAVPIAIK 273

Query: 328 KVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLPHIFNAVI 387
           +                   VP++D  L          P  IAI  +G +   H+ NA I
Sbjct: 274 QTFWRIIIVYLGIAVFYGATVPYNDTSLGAHTKALKS-PIAIAITRAGWEGGVHLVNAFI 332

Query: 388 LSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLEVS 447
           L T +SA N ++Y+GSR +  LA   LAP++   T K GVP  A+   +A G ++ + VS
Sbjct: 333 LITCVSAINGSLYIGSRTLIYLAHEGLAPKFLKWTDKRGVPIPAITLFNALGLVSLMNVS 392

Query: 448 SGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAYYA 507
            G + A+++++N+ GV  F  W +IS+ H+RF +  + +G S  +LP+K+ L PW   ++
Sbjct: 393 VGASNAYSYIVNLSGVGVFIVWGIISLTHLRFRKAWDLQGRSASELPYKSLLFPWGPIFS 452

Query: 508 XXXXXXXXXXQGFTAFAPTFNGSDFVAAYI 537
                     QG+T F P F+  DFV AYI
Sbjct: 453 LAANIFLGLIQGWTTFVP-FSAKDFVDAYI 481

>TPHA0B01090 Chr2 complement(246708..248528) [1821 bp, 606 aa] {ON}
           Anc_1.244 YKR039W
          Length = 606

 Score =  219 bits (558), Expect = 8e-63,   Method: Compositional matrix adjust.
 Identities = 141/455 (30%), Positives = 215/455 (47%), Gaps = 11/455 (2%)

Query: 89  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEM 148
           +K  LK RH                   T L+ AGP   +I +    ++++S+  ++ EM
Sbjct: 89  LKHHLKSRHLQMIAIGGAIGTGLFVGSGTALRTAGPASLIIGWSITGSMIYSMVMAVAEM 148

Query: 149 AXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW-TDAVPLS 207
           A                   S G AN + Y   W +   LE+      + +W T      
Sbjct: 149 AVLYPISGGFTTYATRFIDESFGFANNFNYMLQWLVVLPLEIVSASITVNYWGTPTKYRD 208

Query: 208 AWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVGF-R 266
            ++ ++W ++ I+N+F VK YGE EF  ++IKVI ++GF+I  L +VCG G TG     +
Sbjct: 209 GFVALFWLVIVIINLFGVKGYGEAEFIFSTIKVITVVGFIILGLVLVCGGGPTGGYVGAK 268

Query: 267 YWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAI 326
           YW +PG +         A  +F G+ S  + AAF++ G+EL+GI   EA NPRK VP A 
Sbjct: 269 YWHDPGAF-----VGATAGAQFQGFCSVFVTAAFSFSGSELIGIAGSEAENPRKAVPPAA 323

Query: 327 KKVSXXXXXXXXXXXXXXXXXVPFDDPKLX-XXXXXXXXXPFIIAIQNSGTKVLPHIFNA 385
           K+V                  VP +D +L           PF+IAI   G + LP + N 
Sbjct: 324 KQVFWRILLFYILSLLFIGLLVPSNDSRLIGSSNVDAAASPFVIAITVHGIRGLPSVINV 383

Query: 386 VILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLE 445
           VIL  ++S GNS IY  SR +  LA+    P+      + G P + +  +S FG +AF+ 
Sbjct: 384 VILIAVLSVGNSAIYTCSRTLVALAEQGFLPKVVSYIDRSGRPLVGIAISSFFGLVAFVA 443

Query: 446 VSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAY 505
            S      FNWLL I G++ FF W  I + H+RF   L+ +  S D+LPF + L  + +Y
Sbjct: 444 QSDKEGDVFNWLLAISGLSSFFTWGAICLCHIRFRAALKAQNRSTDELPFVSPLGVFGSY 503

Query: 506 YAXXXXXXXXXXQGFTAFAP---TFNGSDFVAAYI 537
           +           Q + A  P   T + ++F +AY+
Sbjct: 504 WGLFLIVLMLAAQFYVAIFPVGDTPSATNFFSAYL 538

>Skud_6.2 Chr6 (1506..3182) [1677 bp, 558 aa] {ON} YFL055W (REAL)
          Length = 558

 Score =  218 bits (554), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 140/465 (30%), Positives = 214/465 (46%), Gaps = 14/465 (3%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
            +EP V +    +  VKR LK RH                     L   GP+  L+ +  
Sbjct: 35  SEEPDVSK-FDPNTGVKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFSI 93

Query: 134 MATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVV 193
           +  I F+V +S+GE+                    ++ A  GY Y   +    A E + +
Sbjct: 94  IGVIAFAVMESIGEIITLYPSGGGFTTLARRFHGDALSAVCGYAYVVVFFAVLANEYNTL 153

Query: 194 GQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCM 253
             I+QFW   VPL  +I+I+WF   I  +  V  +GE E+W++  K++ ++ + I+ +  
Sbjct: 154 SSILQFWGPQVPLYGYILIFWFAFEIFQLIGVSLFGETEYWLSWFKIVGLVAYYIFSIIY 213

Query: 254 VCGAGVTGPV-GFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITA 312
           + G     P  GF YW +PG    G          F G     +  +  Y GTE V + A
Sbjct: 214 ISGGIKDRPAFGFHYWNSPGSLSHG----------FKGIAVVFVFCSTFYSGTECVALAA 263

Query: 313 GEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQ 372
            E+ NP K VP A+++                   VPFDDP L          P  IAI 
Sbjct: 264 TESKNPGKAVPLAVRQTLWRVLIVYIGIAVFYGATVPFDDPNLSATTKVLKS-PISIAIS 322

Query: 373 NSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAV 432
            +G     H+ NA IL T ISA N ++Y+GSR +  LA   LAP+    T + GVP  A+
Sbjct: 323 RAGWAGGAHLVNAFILVTCISAINGSLYIGSRTLTNLAHEGLAPKILAWTDRRGVPIPAI 382

Query: 433 LFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDD 492
              +A G ++ + VS G + A+++++N+ GV  F  W +IS  H+R  +    +G S ++
Sbjct: 383 TVFNALGLISLMNVSVGASDAYSYIVNLSGVGVFIVWGVISYTHLRVRKAWVTQGRSLEE 442

Query: 493 LPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYI 537
           LP+KA L PW   ++          QG+T+F P F+  +FV AYI
Sbjct: 443 LPYKALLYPWTPIFSLIANVFLALIQGWTSFVP-FDAGNFVDAYI 486

>Skud_7.525 Chr7 (856072..857883) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  219 bits (557), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 127/425 (29%), Positives = 203/425 (47%), Gaps = 8/425 (1%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
            D   V+Q  + +  + ++L  RH                   T L   GP   +I ++ 
Sbjct: 71  RDNDDVEQVDINNTNLNKDLSVRHLLTLAVGGAIGTGLYVNTGTALSTGGPASLVIDWVI 130

Query: 134 MATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVV 193
           + T +F+V  SLGE++                  PS   A    Y   W +   LEL   
Sbjct: 131 IGTCLFTVINSLGELSAAFPVVGGFNVYGMRFVEPSFAFAVNLNYLAQWLVLLPLELVAA 190

Query: 194 GQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCM 253
              I++W D +   AW+ I++  + + NM  VK +GE EF ++ IK+++I+GF I  + +
Sbjct: 191 SITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFSILGIVL 250

Query: 254 VCGAGVTGPVGF-RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITA 312
            CG G  G     +YWRNPG +         +  +F G  S  + AAF+Y G E+  ++A
Sbjct: 251 SCGGGPHGGYIGGKYWRNPGAF-----VGHNSGTKFKGLCSVFVTAAFSYSGIEMTAVSA 305

Query: 313 GEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX--XXXXXXXXXPFIIA 370
            E+ NPR+T+P+A K+                   VP +DP+L            P +IA
Sbjct: 306 AESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIA 365

Query: 371 IQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYI 430
           I+N   K LP + NA+IL  ++S  NS +Y  SR M  +A     P++     K G P  
Sbjct: 366 IENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMN 425

Query: 431 AVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISR 490
           A+L T  FG L+F+  S+  A+ F WL  + G++  F W+ I+++H+RF + ++ +  S 
Sbjct: 426 AILLTLFFGLLSFVAASNKEAEVFTWLSALSGLSTIFCWMAINLSHIRFRKAMKVQERSL 485

Query: 491 DDLPF 495
           D+LPF
Sbjct: 486 DELPF 490

>NDAI0G06030 Chr7 complement(1489584..1491383) [1800 bp, 599 aa]
           {ON} 
          Length = 599

 Score =  218 bits (556), Expect = 1e-62,   Method: Compositional matrix adjust.
 Identities = 142/454 (31%), Positives = 212/454 (46%), Gaps = 15/454 (3%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           D  +P +D G      +KR LK RH                     L + GP+  +I + 
Sbjct: 70  DSFKPPLD-GSFHTHNLKRTLKARHLIMIAIGGSIGTGLFIGSGQALASGGPLALIIGWS 128

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
              T +      LGE+                   PSI      +Y   W     LE+  
Sbjct: 129 IAGTQIVGTIHGLGEITVRFPVVGAFANYSTRFLDPSISFVISTIYVIQWFFVLPLEIIA 188

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
               IQ+W  ++    W+ I++ ++  +N+F  + +GE EF  +SIKVI I+GF+I C+ 
Sbjct: 189 SAMTIQYWNQSIDPVVWVAIFYCVIVSINLFGARGFGEAEFLFSSIKVITIIGFIILCIV 248

Query: 253 MVCGAGVTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
           ++CG G     VG RYW +PG    G          F G +S L+ A+++  GTE+V + 
Sbjct: 249 LICGGGPDHDFVGARYWHDPGCLSHG----------FPGVLSVLVVASYSLGGTEMVCLA 298

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAI 371
           +GE  NPR+ +P AIK+                   VP+ +P L          PF+IAI
Sbjct: 299 SGET-NPRE-LPSAIKQTFWRILFFFLISLTLIGFLVPYTNPNLLGGSSVNNS-PFVIAI 355

Query: 372 QNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIA 431
           +    K LP I NAVIL +I+S GNS I+  SR +  +A   L P++FG   + G P   
Sbjct: 356 KLHHIKALPSIVNAVILISIMSVGNSCIFASSRTLCSMAHQGLIPKFFGYIDRAGRPLTG 415

Query: 432 VLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRD 491
           +L  S FG LAFL  SS   + F+WL+ I G+A    WL I+I+H+RF   ++ +G S D
Sbjct: 416 ILTNSLFGLLAFLVKSSSMGEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGKSLD 475

Query: 492 DLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP 525
           +L F +A+  W + Y+          Q + A  P
Sbjct: 476 ELEFVSAVGMWGSAYSALINSLILIAQFYCALWP 509

>Smik_11.302 Chr11 (505026..506684) [1659 bp, 553 aa] {ON} YKR039W
           (REAL)
          Length = 553

 Score =  217 bits (552), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 140/446 (31%), Positives = 208/446 (46%), Gaps = 8/446 (1%)

Query: 83  VVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVT 142
           V     +K  LK RH                   T L+  GP   LI +    T+++++ 
Sbjct: 80  VTAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMV 139

Query: 143 QSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW-T 201
            +LGE+A                   S G AN + Y   W +   LE+      + FW T
Sbjct: 140 MALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGT 199

Query: 202 DAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTG 261
           D      ++ ++W ++ I+NMF VK YGE EF  + IKVI ++GF+I  + + CG G  G
Sbjct: 200 DPKYRDGFVALFWVVIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPEG 259

Query: 262 PVGF-RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 320
                +YW +PG +     +      +F G  S  + +AF++ G+ELVG+ A E+  PRK
Sbjct: 260 GYIGGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTSAFSFAGSELVGLAASESVEPRK 314

Query: 321 TVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX-XXXXXXXXXPFIIAIQNSGTKVL 379
           +VP+A K+V                  VP++D  L           PF+IAI+  G K L
Sbjct: 315 SVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKNLIGASSVDAAASPFVIAIKTHGIKGL 374

Query: 380 PHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFG 439
           P + N VIL  ++S GNS IY  SR M  LA+ +  P+ F    + G P + +  TSAFG
Sbjct: 375 PSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPQIFAYVDRKGRPLVGIGVTSAFG 434

Query: 440 ALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAAL 499
            +AF+  S      FNWLL + G++  F W  I I H+RF + L  +G   D+L FK+  
Sbjct: 435 LIAFVAASKKEGDVFNWLLALSGLSSLFTWGGICICHIRFRKALTAQGRDLDELSFKSPT 494

Query: 500 MPWLAYYAXXXXXXXXXXQGFTAFAP 525
             W +Y+           Q + A  P
Sbjct: 495 GVWGSYWGLFMVVIMFIAQFYVALFP 520

>TDEL0E05750 Chr5 (1074448..1076094) [1647 bp, 548 aa] {ON} 
          Length = 548

 Score =  217 bits (552), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 139/481 (28%), Positives = 222/481 (46%), Gaps = 26/481 (5%)

Query: 73  DEDEPYVDQGVVQD------------AEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLK 120
           DE E  +++GV  D             ++K+ LK RH                     LK
Sbjct: 18  DEAEVQLEEGVTLDETIKQGVLHNDRTKLKQGLKARHIKMLTLVGVFGTGLFLSSGGTLK 77

Query: 121 NAGPVGSLIAYLFMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWF 180
             GPVG LIAY+ +  +V     ++ E+A                   ++G      + F
Sbjct: 78  KTGPVGMLIAYVLVGIVVGCNQIAIAEVASFMPATGATIRHSEQFIDEAVG------FTF 131

Query: 181 SWAITFAL----ELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVA 236
            W  T++     ELS    ++ +WTD  P + +I I+  +  + N++ ++FYGE E++  
Sbjct: 132 GWISTYSSLMPGELSATAVVMTYWTDLSP-AIFITIFGVLFILTNIYTIRFYGEIEYFFG 190

Query: 237 SIKVIAIMGFLIYCLCMVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLI 296
            +K+  I   +I  L +  G      +GF YWRNPGP+   ++      G+F+G+ ++L 
Sbjct: 191 WLKLALIAILIITGLVIDLGGTKQERLGFHYWRNPGPFAEYLVGGDT--GKFVGFWAALS 248

Query: 297 NAAFTYQGTELVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX 356
           +  ++Y G + + I AGE  N R  +    K V                  VP++D  + 
Sbjct: 249 SVVYSYSGIQNIAILAGETKNSRHAIFHGAKNVFVRIILLYLITVFVLTLIVPYNDKLIA 308

Query: 357 XXXXXXXXXPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAP 416
                    PF+IA++ +G KVLPHI NA+IL++  SAGN  I  GSR +F LA    AP
Sbjct: 309 TGSGNARSSPFVIAMERAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAP 368

Query: 417 RWFGITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAH 476
           + F  T+K G+P++ VLF S+F  LA++  S   A  F+W   +V       W+LIS  H
Sbjct: 369 KIFLKTSKRGIPWVGVLFISSFLPLAYMSCSESSATVFSWFQELVSSNTLLRWILISANH 428

Query: 477 VRFIQTLEHRGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP-TFNGSDFVAA 535
           +   + L  +G SR DLP+   + P+ A+++           GF  F    F+   F + 
Sbjct: 429 IHMDRALRAQGYSRKDLPYSTTIAPYAAWFSGIMSFIFLLTGGFYNFIHGNFDIESFFSR 488

Query: 536 Y 536
           Y
Sbjct: 489 Y 489

>Kpol_1010.32 s1010 (82500..84299) [1800 bp, 599 aa] {ON}
           (82500..84299) [1800 nt, 600 aa]
          Length = 599

 Score =  218 bits (555), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 136/499 (27%), Positives = 230/499 (46%), Gaps = 13/499 (2%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
            D   + +  +  + + ++L  RH                     L   GP   +I ++ 
Sbjct: 74  NDSNMLSKEDIDGSNLNKDLNIRHLLTLAVGGAIGTGLFVNSGASLNTGGPASLVIGWVI 133

Query: 134 MATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVV 193
           ++T +F+V  SLGE+A                  PSI  +    Y   W +   LEL   
Sbjct: 134 VSTALFTVINSLGELAAAYPVVGGFSVYMTRFIDPSIAFSINLNYLVQWLVLLPLELVAA 193

Query: 194 GQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCM 253
              I++W D +   AW+ I++ ++ ++NM  VK +GE EF ++ IK++AI+GF I  + +
Sbjct: 194 SITIRYWNDKINSDAWVSIFYTVIGLLNMLDVKSFGETEFVLSFIKILAIIGFTILGIVL 253

Query: 254 VCGAGVTGPVGF-RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITA 312
            CG G  G     +YW +PG +         A  +F G  S  + AAF+Y G E++ ++A
Sbjct: 254 SCGGGPVGGYIGGKYWHDPGAF-----VGHTAGSQFKGLCSVFVTAAFSYSGIEMIAVSA 308

Query: 313 GEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX--XXXXXXXXXPFIIA 370
            E+ +PRKT+P A K+                   VP+DDP+L            P +IA
Sbjct: 309 AESIDPRKTIPVAAKRTFWLITASYVTILTLIGCLVPYDDPRLLNGSSSVDVASSPLVIA 368

Query: 371 IQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYI 430
           I+N G K LP + NA+IL  ++S  NS +Y  SR M  +A     P+  G   K G P  
Sbjct: 369 IENGGIKGLPSLMNAIILIAVLSVANSAVYACSRYMVSMAIIGNLPKQLGRIDKKGRPIN 428

Query: 431 AVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISR 490
           A L T  FG ++F+  S   A+ F WL  + G++  F W+ I+I+H+RF + ++ +G S 
Sbjct: 429 ATLVTLFFGLISFVAASDKQAEVFTWLSALSGLSTIFCWMGINISHIRFRRAMDIQGRSL 488

Query: 491 DDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPT----FNGSDFVAAYIXXXXXXXXX 546
           +++P+ + +  + ++Y             +T+  P      N + F   Y+         
Sbjct: 489 EEMPYLSQVGVYGSWYGCIILFLVLIAAFWTSLFPVGSSQANATTFFEGYLSLPILLACY 548

Query: 547 XXXQLYFRC-KLYWSLDEV 564
              + YF+  +L+   +E+
Sbjct: 549 VGHKFYFKNWRLFTPYNEI 567

>NCAS0D01870 Chr4 complement(343416..345203) [1788 bp, 595 aa] {ON}
           Anc_5.158
          Length = 595

 Score =  218 bits (554), Expect = 2e-62,   Method: Compositional matrix adjust.
 Identities = 128/424 (30%), Positives = 201/424 (47%), Gaps = 8/424 (1%)

Query: 86  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSL 145
           +  + ++L  RH                     L + GP   +I ++ ++T +F+V  SL
Sbjct: 75  NKSLNKDLSIRHLLTLAVGGAIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINSL 134

Query: 146 GEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVP 205
           GE+A                  PS   A    Y   W +   LEL      I++W   + 
Sbjct: 135 GELAAAFPVVGGFNVYITRFVDPSFAFAVNLNYLAQWLVLLPLELVAASITIKYWNSTIN 194

Query: 206 LSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVGF 265
             AW+ I++ ++T+ NM  VK +GE EF ++ +K++AI+GF I  + + CG G  G    
Sbjct: 195 SDAWVAIFYTVITLANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLSCGGGPKGGYLG 254

Query: 266 -RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 324
            +YW NPG +         +  +F G  S  + AAF+Y G E+  ++A E+ +PRKT+P+
Sbjct: 255 GKYWHNPGAF-----VGHTSGTKFKGLCSVFVTAAFSYSGIEMTAVSAAESKDPRKTIPK 309

Query: 325 AIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX--XXXXXXXXXPFIIAIQNSGTKVLPHI 382
           A K+                   VP+DDP+L            P +IAI+N G K L  +
Sbjct: 310 AAKRTFWLITASYVTILTLVGCLVPYDDPRLMSGTSSVDAAASPLVIAIENGGIKGLDSL 369

Query: 383 FNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALA 442
            NA+IL +IIS  NS +Y  SR M  +A     P+  G   K G P  A L T  FG L+
Sbjct: 370 MNAIILISIISVANSAVYACSRCMVSMAHIGNLPKKLGKVDKRGRPINATLVTLFFGLLS 429

Query: 443 FLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPW 502
           F+  S    + F WL  + G++  F W+ I+I+H+RF Q +  +  S D++P+ +    W
Sbjct: 430 FIAASDKQNEVFTWLSALSGLSTIFCWMAINISHIRFRQAMIKQNRSLDEMPYLSQTGVW 489

Query: 503 LAYY 506
            + Y
Sbjct: 490 GSLY 493

>KAFR0A01120 Chr1 complement(216442..218220) [1779 bp, 592 aa] {ON}
           Anc_3.284 YDR046C
          Length = 592

 Score =  218 bits (554), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 133/456 (29%), Positives = 213/456 (46%), Gaps = 8/456 (1%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           D D       +V D ++K+ +K RH                  +  L  AGP   +IAY 
Sbjct: 59  DSDLEEDTDTIVTDTQLKKTMKSRHVVMMSLGTGIGTGLLVANAQGLHKAGPAPLVIAYG 118

Query: 133 FMATIVFSVTQSLGEMAXXXXXX-XXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELS 191
            ++ + + + Q+ GEMA                      G A  ++++  W     LEL 
Sbjct: 119 MVSFVTYFMIQAAGEMAVVYPTLPGNFNAYISTFISKPFGFATVWLFFIQWLTVLPLELI 178

Query: 192 VVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCL 251
                +Q+W D++    ++VI++  L  ++ F VK YGE EF     K++ + GF+I+ +
Sbjct: 179 TAAMTVQYWNDSINADVYVVIFYVFLLFIHFFGVKAYGETEFIFNLCKILFVGGFIIFSI 238

Query: 252 CM-VCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGI 310
            + V GAG +G +G +YW +PG +     +S    GRF G    L+ A F+Y G EL  +
Sbjct: 239 VVNVGGAGNSGYIGAKYWHDPGAF-----TSDTNAGRFKGVCYVLVTAYFSYGGMELFAL 293

Query: 311 TAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX-XXXXXXPFII 369
           +  E  NPR++ P A K+                   VP +  +L           P+++
Sbjct: 294 SVNEQENPRRSTPTAAKQSIYRIVVIYLLTMILVGFNVPSNSNELMGSGGSVTHASPYVL 353

Query: 370 AIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPY 429
           A    G KV+PHI NAVIL ++IS GNS +Y   R+M  LA+   AP++     + G P 
Sbjct: 354 AASIHGVKVVPHIVNAVILISLISVGNSALYAAPRLMCALAQQGFAPKFMDYVDREGRPL 413

Query: 430 IAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGIS 489
            A++  S FG + F+  SS   + FNWL  I G+A  F W  I I+H+RF Q ++ +  S
Sbjct: 414 FALIVCSVFGVIGFVACSSKEEQVFNWLAAIAGLAELFTWSGIMISHIRFRQAMKLQNKS 473

Query: 490 RDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP 525
            D++ +K+    + +Y+           Q + A AP
Sbjct: 474 LDEVGYKSPFGVYGSYFGVFFNLLVFVAQFWVALAP 509

>Skud_16.2 Chr16 complement(1584..3074) [1491 bp, 496 aa] {ON}
           YPL265W (REAL)
          Length = 496

 Score =  215 bits (547), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 140/464 (30%), Positives = 220/464 (47%), Gaps = 23/464 (4%)

Query: 73  DEDE-----PYVDQGVVQD--AEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPV 125
           DE E         QGV+ +    +K+ LK+RH                     LK  GPV
Sbjct: 25  DEQELECGSETAKQGVLYNDRTRLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKIGPV 84

Query: 126 GSLIAYLFMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAIT 185
           G LIAYLF+  +V     ++ E+A                   S+G      + F W  T
Sbjct: 85  GLLIAYLFVGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDESVG------FTFGWIST 138

Query: 186 FAL----ELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVI 241
           ++     ELS    I+++WTD  P + +I ++  +    N++ ++FYGE E+    +K++
Sbjct: 139 YSSLMPGELSATAVIMKYWTDVSP-AVFITVFGVLFVATNIYTIRFYGEIEYVFGWLKLV 197

Query: 242 AIMGFLIYCLCMVCGAGVTGP--VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAA 299
            I   +I  L +  G GV G   +GF YWR+PGP+   +++  +  G+F+G+ +++ +  
Sbjct: 198 LIFILIISGLVIDLG-GVKGQERLGFHYWRDPGPFANYLVAGHI--GKFVGFWAAISSVV 254

Query: 300 FTYQGTELVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX 359
           ++Y G + + I AGE  N R  +    K V                  VP++D  +    
Sbjct: 255 YSYSGIQNIAILAGETKNSRYAIFHGAKNVFLRIIVLYLVTVFVLTLIVPYNDKLIATGT 314

Query: 360 XXXXXXPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWF 419
                 PF+IA+  +G KVLPHI NA+IL++  SAGN  I  GSR +F LA    AP+ F
Sbjct: 315 GTAKSSPFVIAMNRAGIKVLPHIVNALILTSAWSAGNLAIIEGSRNLFCLATKNQAPQIF 374

Query: 420 GITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRF 479
             T+K G+PY+ V+F S+F  LA++  S   A  F W   +V       W+LIS  H+  
Sbjct: 375 LKTSKRGIPYVGVIFISSFLPLAYMSCSESSATVFGWFQELVSSNTLLRWILISANHIHM 434

Query: 480 IQTLEHRGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAF 523
            + L+ +G SR DLP    + P+ A+++           GF  F
Sbjct: 435 DRALKAQGYSRSDLPCSTRIAPFAAWFSGIMSVIFLFTGGFYNF 478

>SAKL0D02948g Chr4 (243064..244848) [1785 bp, 594 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains
          Length = 594

 Score =  217 bits (553), Expect = 3e-62,   Method: Compositional matrix adjust.
 Identities = 140/486 (28%), Positives = 224/486 (46%), Gaps = 14/486 (2%)

Query: 88  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGE 147
           ++K+ +K RH                     L   GP G +I Y+  +T+++ V Q+  E
Sbjct: 75  KMKQTMKSRHITMISLGTGIGTGLLVANGKALHFGGPGGLVIGYVTTSTMLYCVIQACCE 134

Query: 148 MAXXXXXXXXXXXXXXXXXXPS-IGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPL 206
           +                    S    A  ++Y   WAI   LEL      I++W D++  
Sbjct: 135 LGVSYATLPGNYNSYPSFLVDSGFNFAVAWVYGLQWAIVLPLELVTSSMTIKYWNDSINP 194

Query: 207 SAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVGFR 266
             ++ I++  +  ++ F  + Y E EF   S KV+ ++GF+I  + + CGA  +G +G +
Sbjct: 195 DVFVAIFYCFIVFIHFFGSQGYAESEFIFNSCKVLMMVGFIIMGISVNCGASKSGYIGGK 254

Query: 267 YWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAI 326
           YW  PG +       + A   F G  S  + +AF Y G+E + +TA E  NPRK+VP+A 
Sbjct: 255 YWHTPGAF-----VGEKAIDHFKGICSVWVQSAFAYGGSEFIALTAAEQTNPRKSVPKAT 309

Query: 327 KKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXX--XXXXXXXPFIIAIQNSGTKVLPHIFN 384
           K+                   VP+D P L            PF+IA  + G KV+PHI N
Sbjct: 310 KRWLYRVLIVFLTPIILVGFLVPYDSPLLLGSPGQAASHASPFVIAAASHGVKVVPHIIN 369

Query: 385 AVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFL 444
           AVIL ++IS GNS  Y   R++  LA+  + P+ F    + G P + +LF + FG ++F+
Sbjct: 370 AVILISVISVGNSAFYSAPRILLSLAEQGMGPKVFTYVDRKGRPLVTMLFVAIFGLISFV 429

Query: 445 EVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLA 504
             S      F WL  IV ++  F W  IS++H+RF   ++ +G S  +L +KA    W +
Sbjct: 430 AASDNEETVFTWLSAIVSLSQLFTWSAISLSHIRFRDAMKTQGRSLGELGYKANTGYWGS 489

Query: 505 YYAXXXXXXXXXXQGFTAFAPTFNG-----SDFVAAYIXXXXXXXXXXXXQLYFRC-KLY 558
           +YA          Q + A AP  NG     ++F   Y+            +L++R  KL+
Sbjct: 490 WYAIAFNIIVLAAQFWVAIAPIGNGGKLDVNNFFQNYLAFPVLVFFYFGYKLWYRDWKLF 549

Query: 559 WSLDEV 564
              D+V
Sbjct: 550 IPADKV 555

>CAGL0B03773g Chr2 (373956..375773) [1818 bp, 605 aa] {ON} highly
           similar to uniprot|P06775 Saccharomyces cerevisiae
           YGR191w HIP1 Histidine permease
          Length = 605

 Score =  217 bits (553), Expect = 4e-62,   Method: Compositional matrix adjust.
 Identities = 129/436 (29%), Positives = 206/436 (47%), Gaps = 10/436 (2%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           E   YV+   + +  + ++L  RH                     L   GP   +I ++ 
Sbjct: 75  EAASYVED--INNTNLNKDLSVRHLLTLAVGGAIGTGLFVNSGASLTTGGPASLVIGWVI 132

Query: 134 MATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVV 193
           ++T +F+V  SLGE+A                  PS   A    Y   W +   LEL   
Sbjct: 133 VSTCLFTVINSLGELAAAFPVVGGFNVYITRFIEPSFAFAINLNYLAQWLVLLPLELVAA 192

Query: 194 GQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCM 253
              I++W D +   AW+ I++  + + NM  VK +GE EF ++ +K++AI+GF I  + +
Sbjct: 193 SITIRYWNDKINSDAWVAIFYTAIALANMLDVKSFGETEFILSMVKILAIIGFGILGIVL 252

Query: 254 VCGAGVTGPVGF-RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITA 312
            CG G  G     +YW NPG +         A  +F G  S  + AAF+Y G E+  ++A
Sbjct: 253 TCGGGPHGGYIGGKYWHNPGAF-----VGHSAGSQFKGLCSVFVTAAFSYSGIEMTAVSA 307

Query: 313 GEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX--XXXXXXXXXPFIIA 370
            E+ NP++T+P+A K+                   VP++DP+L            P +IA
Sbjct: 308 AESRNPKETIPKAAKRTFWLITVSYVGILTLIGCLVPYNDPRLLNGSSSVDAAASPLVIA 367

Query: 371 IQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYI 430
           I+N G K LP + NA+IL  I+S  NS +Y  SR M  +A     P++     K G P  
Sbjct: 368 IENGGIKGLPSLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKFLSKVDKRGRPLN 427

Query: 431 AVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISR 490
           A+L T  FG L+F+  S    + F WL  + G++  F W+ I+++ +RF   ++ +G S 
Sbjct: 428 AILLTLFFGLLSFIAASDKQEEVFTWLSALSGLSTIFCWMAINLSLIRFRDAMKAQGRSL 487

Query: 491 DDLPFKAALMPWLAYY 506
           D++PF +    W A+Y
Sbjct: 488 DEMPFLSQSGTWGAWY 503

>Ecym_1056 Chr1 (102260..104080) [1821 bp, 606 aa] {ON} similar to
           Ashbya gossypii AFR698C
          Length = 606

 Score =  217 bits (553), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 144/453 (31%), Positives = 210/453 (46%), Gaps = 12/453 (2%)

Query: 80  DQGVVQDAEVKRELKQ----RHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMA 135
           DQ  +QD     +LKQ    RH                     L N GP G  + +  M 
Sbjct: 76  DQESLQDNNKHEKLKQTIRPRHVVMISLGTGIGTGLLVGTGKALYNGGPGGLAVGFFVMG 135

Query: 136 TIVFSVTQSLGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVG 194
           T V+ V Q+ GEMA                   P  G A  ++Y   W   F LEL    
Sbjct: 136 TCVYCVIQAAGEMAVNYPALSGGFNAYPSFLVDPGFGFATAWLYCIQWLCVFPLELVTAS 195

Query: 195 QIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMV 254
             I++WT A+    ++ +++ ++ ++N F  + Y E EF+  + KV+ I+GF I  + + 
Sbjct: 196 ITIKYWTTAINPDIFVAVFYLLIIVINFFGARGYAEAEFFFNTCKVLMIIGFFIVGILVN 255

Query: 255 CGA-GVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAG 313
            GA G  G +G +YWR PG +G        A   F G VS+L+NAAF+   +E V +TA 
Sbjct: 256 TGAAGNDGYIGAKYWREPGSFG-----GHTAIDHFKGVVSTLVNAAFSLGCSEFVALTAA 310

Query: 314 EAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX-XXXXXXXXXPFIIAIQ 372
           E ANPRK+VP A KK+                  VP +  +L           P++IA+ 
Sbjct: 311 EQANPRKSVPSAAKKMLYKVFVVFLGSVTLIGFLVPKNSSELMGSTDSSVHVSPYVIAVA 370

Query: 373 NSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAV 432
           + G +V+PH  NAVIL +++S GNS  Y  SR++  LA+   AP  F    + G P +A+
Sbjct: 371 SHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLAEQGYAPPVFKYIDRQGRPLMAM 430

Query: 433 LFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDD 492
           + +   G L F+  S      F WLL I G++  F W  I I+H+RF + L  +G   D 
Sbjct: 431 MVSITMGCLCFVAASPKEETVFIWLLAISGLSQLFTWTSICISHIRFRKALLVQGRGWDG 490

Query: 493 LPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP 525
           L FKA    W +YY+          Q +T   P
Sbjct: 491 LGFKAQTGVWGSYYSAVIMILTFIAQFWTCLIP 523

>KAFR0D04120 Chr4 (816117..818063) [1947 bp, 648 aa] {ON} Anc_1.50
           YDR508C
          Length = 648

 Score =  218 bits (555), Expect = 5e-62,   Method: Compositional matrix adjust.
 Identities = 135/494 (27%), Positives = 222/494 (44%), Gaps = 13/494 (2%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           +D  +      +D  +++ +K RH                   + L  AGP G +I Y  
Sbjct: 116 KDPQFAPHAEEKDDHLQKTIKPRHVLLMSLGTGIGTGLLVGNGSALHKAGPGGLVIGYAI 175

Query: 134 MATIVFSVTQSLGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSV 192
           M + ++ + Q+ GEMA                    + G +  ++Y   W     LEL  
Sbjct: 176 MGSCLYCIIQACGEMAVAYSGLPGNFNAYPSFLVDEAFGFSVAWVYCLQWLCVMPLELVT 235

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
               IQ+WT  V    ++VI++ ++  +N+F  K Y E EF+  S KV+ + GF I  + 
Sbjct: 236 ASMTIQYWTTTVNADVFVVIFYVLIIFINVFGAKGYAEAEFFFNSCKVLMMAGFFILAIV 295

Query: 253 M-VCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
           +   GAG  G +G +YW NPG +         +  RF   +S+   AAF +  +E + I 
Sbjct: 296 INTGGAGNDGYIGAKYWHNPGAF-----RGDKSIDRFKDVMSTFTTAAFAFGASEFIAIG 350

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXX-XXXXXXXPFIIA 370
           A E +NPR+ +P A K +                  VP++  +L           P++IA
Sbjct: 351 ASEQSNPRRAIPSAAKTMIYRILFIFLTSITLVGFLVPYNSTELMGSGSAATKASPYVIA 410

Query: 371 IQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYI 430
           + + G +V+PH  NAVIL +++S  NS  Y   R+++ L++   AP WF    + G P  
Sbjct: 411 VASHGVRVVPHFINAVILLSVLSVANSAFYSSCRILYSLSQQGYAPSWFNYIDREGRPAR 470

Query: 431 AVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISR 490
           A++ ++ F  +AF   SS     F WLL I G++  F W+ I ++H+RF + ++ +G S 
Sbjct: 471 AMIMSALFSVIAFCACSSKEEDVFTWLLAISGLSQLFTWIAICVSHIRFRRAMKVQGRSV 530

Query: 491 DDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQ 550
           D++ FK+ +  W + YA          + + + AP   G D + A               
Sbjct: 531 DEIGFKSQVGVWGSSYAAIMMTLALIAEFWVSIAPI--GEDHLDAQNFFENYLAMPILIV 588

Query: 551 LYFR---CKLYWSL 561
           LYF    CK  W L
Sbjct: 589 LYFGYKICKRDWKL 602

>KAFR0D00520 Chr4 complement(82977..84773) [1797 bp, 598 aa] {ON}
           Anc_1.50 YDR508C
          Length = 598

 Score =  216 bits (551), Expect = 6e-62,   Method: Compositional matrix adjust.
 Identities = 126/426 (29%), Positives = 207/426 (48%), Gaps = 9/426 (2%)

Query: 86  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSL 145
           + ++++ ++ RH                     L NAGP G LI Y+ MA+ ++ + Q+ 
Sbjct: 77  NNQLQKTIQPRHVIMISLGTGIGTGLLVGNGATLHNAGPAGLLIGYIIMASCIYCIIQAC 136

Query: 146 GEMAXXXXXXXXXXXXXXXXXXPSI-GAANGYMYWFSWAITFALELSVVGQIIQFWTDAV 204
           GEMA                   +    A  ++Y   W     LEL      I++W + V
Sbjct: 137 GEMAVNYLTLIGGFNNYPSFLVDTAWNFAVAWVYCIQWLCVCPLELVTASMTIKYWNEKV 196

Query: 205 PLSAWIVIWWFILTIMNMFP-VKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGP 262
               ++ I++ ++  +N+F   + Y E EF+    K++ I GF I  + ++CG AG +G 
Sbjct: 197 DPDVFVTIFYLLIIAINLFGGARGYAEAEFFFNLCKILMIAGFFILGIILICGGAGTSGY 256

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
           +G  YW NPG +            RF G VS+L+ AAF++  TE + ITA E +NPRK +
Sbjct: 257 IGVSYWNNPGAF-----RGHTPGTRFKGIVSTLVTAAFSFGQTEFLAITASEQSNPRKAI 311

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX-XXXXXXXXXPFIIAIQNSGTKVLPH 381
           P A KKV                  VP++ P+L           P++IA+ + G ++ PH
Sbjct: 312 PSAAKKVIYRALFIYVGSIIIVGFLVPYNSPELLGSKSSQTKASPYVIAVASHGIRIAPH 371

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
             NAVIL +++S  NS+ Y  SR++  LAK   AP+ F    + G P   ++  S    +
Sbjct: 372 FINAVILISVLSVANSSFYSSSRMLLTLAKQGYAPKIFTYLDRKGRPLFGIIAASLLATI 431

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
           AF   S    + F+WLL I G++  F W  I ++H+RF + ++ +G S ++L +K+ +  
Sbjct: 432 AFCASSPKETEVFSWLLAISGLSQVFTWGTICLSHIRFRRAMKIQGRSLNELGYKSQVGV 491

Query: 502 WLAYYA 507
           W + YA
Sbjct: 492 WGSIYA 497

>Smik_16.115 Chr16 complement(214120..215931) [1812 bp, 603 aa] {ON}
           YGR191W (REAL)
          Length = 603

 Score =  216 bits (551), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 124/420 (29%), Positives = 201/420 (47%), Gaps = 8/420 (1%)

Query: 79  VDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIV 138
           ++Q  + +  + ++L  RH                     L   GP   +I ++ ++T +
Sbjct: 76  IEQEDINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWVIISTCL 135

Query: 139 FSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQ 198
           F+V  SLGE++                  PS   A    Y   W +   LEL      I+
Sbjct: 136 FTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVAASITIK 195

Query: 199 FWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAG 258
           +W D +   AW+ I++  + + NM  VK +GE EF ++ IK+++I+GF I  + + CG G
Sbjct: 196 YWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIVLSCGGG 255

Query: 259 VTGPVGF-RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAAN 317
             G     +YW +PG +         +  +F G  S  + AAF+Y G E+  ++A E+ N
Sbjct: 256 PHGGYIGGKYWHDPGAF-----VGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVSAAESKN 310

Query: 318 PRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX--XXXXXXXXXPFIIAIQNSG 375
           PR+T+P+A K+                   VP +DP+L            P +IAI+N G
Sbjct: 311 PRETIPKAAKRTFWLITASYVAILTLIGCLVPSNDPRLLNGSSSVDAASSPLVIAIENGG 370

Query: 376 TKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFT 435
            K LP + NA+IL  ++S  NS +Y  SR M  +A     P++     K G P  A+L T
Sbjct: 371 IKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPMNAILLT 430

Query: 436 SAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPF 495
             FG L+F+  S   A+ F WL  + G++  F W+ I+++H+RF Q ++ +  S D+LPF
Sbjct: 431 LFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERSLDELPF 490

>Kpol_543.78 s543 (193316..195133) [1818 bp, 605 aa] {ON}
           (193316..195133) [1818 nt, 606 aa]
          Length = 605

 Score =  216 bits (551), Expect = 8e-62,   Method: Compositional matrix adjust.
 Identities = 145/455 (31%), Positives = 221/455 (48%), Gaps = 11/455 (2%)

Query: 89  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEM 148
           ++ +LK RH                     L+ AGP G LI +    T++F++  +LGE+
Sbjct: 88  LQHKLKSRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWGITGTMIFTMVMALGEL 147

Query: 149 AXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLS- 207
           A                   S G AN + Y F W +   LE+      + +W   V  + 
Sbjct: 148 AVVFPVSGGFLTYATRFIDESFGFANNFNYMFQWLVALPLEIVAASITVDYWETPVRYTD 207

Query: 208 AWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVGF-R 266
            ++ ++W ++ I+NMF V+ YGE EF  + IKVIA++GF+I  + +VCG G  G     R
Sbjct: 208 GFVALFWLVVVIINMFGVRGYGEAEFVFSLIKVIAVIGFIILGIILVCGGGPVGGYVGGR 267

Query: 267 YWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAI 326
           YW +PG +     +      RF G+ S  + AAF++ G+ELVGI + E+ NPRK+VP+A 
Sbjct: 268 YWHDPGAF-----AGHSPGRRFKGFCSVFVTAAFSFAGSELVGIASAESKNPRKSVPQAA 322

Query: 327 KKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX-XXXXXXPFIIAIQNSGTKVLPHIFNA 385
           K+V                  VP+ DP+L           PF+IAI   G   LP + N 
Sbjct: 323 KQVFWRILLFYILCLLLVGLLVPYTDPRLLGSSGVDASASPFVIAIVTHGISGLPSVVNV 382

Query: 386 VILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLE 445
           VIL +++S GNS+IY  SR +  L++    P+      + G P + +   S FG +AF+ 
Sbjct: 383 VILISVLSVGNSSIYTCSRTLVALSEQGFLPKTVAYIDRKGRPLVGIAICSGFGLIAFVA 442

Query: 446 VSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAY 505
            S+   + FNWLL I G++ F  W  I   H+RF   L+  G S D+LPFK+ +    +Y
Sbjct: 443 ASNKKEQMFNWLLAISGISSFLTWGSICFCHIRFRSALKVNGRSDDELPFKSPVGIIGSY 502

Query: 506 YAXXXXXXXXXXQGFTAFAP---TFNGSDFVAAYI 537
           +           Q + A  P   + N  DF +AY+
Sbjct: 503 WGMCLAVLMLVAQFYNALFPIGSSPNAYDFFSAYL 537

>YKR039W Chr11 (515063..516871) [1809 bp, 602 aa] {ON}  GAP1General
           amino acid permease; Gap1p senses the presence of amino
           acid substrates to regulate localization to the plasma
           membrane when needed
          Length = 602

 Score =  216 bits (550), Expect = 9e-62,   Method: Compositional matrix adjust.
 Identities = 146/478 (30%), Positives = 217/478 (45%), Gaps = 11/478 (2%)

Query: 83  VVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVT 142
           +     +K  LK RH                   T L+  GP   LI +    T+++++ 
Sbjct: 80  ITAQTPLKHHLKNRHLQMIAIGGAIGTGLLVGSGTALRTGGPASLLIGWGSTGTMIYAMV 139

Query: 143 QSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW-T 201
            +LGE+A                   S G AN + Y   W +   LE+      + FW T
Sbjct: 140 MALGELAVIFPISGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVSASITVNFWGT 199

Query: 202 DAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTG 261
           D      ++ ++W  + I+NMF VK YGE EF  + IKVI ++GF+I  + + CG G TG
Sbjct: 200 DPKYRDGFVALFWLAIVIINMFGVKGYGEAEFVFSFIKVITVVGFIILGIILNCGGGPTG 259

Query: 262 PVGF-RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 320
                +YW +PG +     +      +F G  S  + AAF++ G+ELVG+ A E+  PRK
Sbjct: 260 GYIGGKYWHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVEPRK 314

Query: 321 TVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX-XXXXXXXXXPFIIAIQNSGTKVL 379
           +VP+A K+V                  VP++D  L           PF+IAI+  G K L
Sbjct: 315 SVPKAAKQVFWRITLFYILSLLMIGLLVPYNDKSLIGASSVDAAASPFVIAIKTHGIKGL 374

Query: 380 PHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFG 439
           P + N VIL  ++S GNS IY  SR M  LA+ +  P  F    + G P + +  TSAFG
Sbjct: 375 PSVVNVVILIAVLSVGNSAIYACSRTMVALAEQRFLPEIFSYVDRKGRPLVGIAVTSAFG 434

Query: 440 ALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAAL 499
            +AF+  S    + FNWLL + G++  F W  I I H+RF + L  +G   D+L FK+  
Sbjct: 435 LIAFVAASKKEGEVFNWLLALSGLSSLFTWGGICICHIRFRKALAAQGRGLDELSFKSPT 494

Query: 500 MPWLAYYAXXXXXXXXXXQGFTAFAPTFN---GSDFVAAYIXXXXXXXXXXXXQLYFR 554
             W +Y+           Q + A  P  +      F  AY+            ++Y R
Sbjct: 495 GVWGSYWGLFMVIIMFIAQFYVAVFPVGDSPSAEGFFEAYLSFPLVMVMYIGHKIYKR 552

>YGR191W Chr7 (880420..882231) [1812 bp, 603 aa] {ON}
           HIP1High-affinity histidine permease, also involved in
           the transport of manganese ions
          Length = 603

 Score =  216 bits (549), Expect = 1e-61,   Method: Compositional matrix adjust.
 Identities = 126/426 (29%), Positives = 203/426 (47%), Gaps = 11/426 (2%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           +ED    +Q  + +  + ++L  RH                     L   GP   +I ++
Sbjct: 73  NED---TEQEDINNTNLSKDLSVRHLLTLAVGGAIGTGLYVNTGAALSTGGPASLVIDWV 129

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
            ++T +F+V  SLGE++                  PS   A    Y   W +   LEL  
Sbjct: 130 IISTCLFTVINSLGELSAAFPVVGGFNVYSMRFIEPSFAFAVNLNYLAQWLVLLPLELVA 189

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
               I++W D +   AW+ I++  + + NM  VK +GE EF ++ IK+++I+GF I  + 
Sbjct: 190 ASITIKYWNDKINSDAWVAIFYATIALANMLDVKSFGETEFVLSMIKILSIIGFTILGIV 249

Query: 253 MVCGAGVTGPVGF-RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
           + CG G  G     +YW +PG +         +  +F G  S  + AAF+Y G E+  ++
Sbjct: 250 LSCGGGPHGGYIGGKYWHDPGAF-----VGHSSGTQFKGLCSVFVTAAFSYSGIEMTAVS 304

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX--XXXXXXXXXPFII 369
           A E+ NPR+T+P+A K+                   VP +DP+L            P +I
Sbjct: 305 AAESKNPRETIPKAAKRTFWLITASYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVI 364

Query: 370 AIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPY 429
           AI+N G K LP + NA+IL  ++S  NS +Y  SR M  +A     P++     K G P 
Sbjct: 365 AIENGGIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLNRVDKRGRPM 424

Query: 430 IAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGIS 489
            A+L T  FG L+F+  S   A+ F WL  + G++  F W+ I+++H+RF Q ++ +  S
Sbjct: 425 NAILLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKVQERS 484

Query: 490 RDDLPF 495
            D+LPF
Sbjct: 485 LDELPF 490

>Smik_13.1 Chr13 (1838..3409) [1572 bp, 523 aa] {ON} YFL055W (REAL)
          Length = 523

 Score =  214 bits (544), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 133/453 (29%), Positives = 212/453 (46%), Gaps = 13/453 (2%)

Query: 86  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSL 145
           +  VKR LK RH                     L+  GP+  L+ ++ +  I F+V +S+
Sbjct: 29  NTGVKRALKNRHISLLALGGIIGPGCLVGAGNALQKGGPLALLLGFVIIGIIAFAVMESI 88

Query: 146 GEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVP 205
           GEM                    ++ A  GY Y   +    A E + +  I+QFW   VP
Sbjct: 89  GEMITLYPSGGGFTTLARRFHSDALSAVCGYAYVIVFFAVLANEYNTLSSILQFWGPQVP 148

Query: 206 LSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPV-G 264
           L A+ +I+W +  I  +  V  +GE E+W++ +K++ ++ + I+ +  + G     P  G
Sbjct: 149 LYAYTLIFWIVFEIFQLIGVGVFGETEYWLSLLKILGLIVYYIFSIIYMSGGVRNKPAFG 208

Query: 265 FRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 324
           F YW++PG    G          F G     +  +  Y GTE V +TA E+ NP K+VP 
Sbjct: 209 FHYWKDPGSLSHG----------FKGIAVVFVFCSSFYSGTESVALTATESKNPTKSVPY 258

Query: 325 AIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLPHIFN 384
           A+++                   VPF+DP L          P  IAI  +G     H+ N
Sbjct: 259 AVRQTLWRIVVVYIGIAIFYGSTVPFNDPNLSVNTKVLKS-PIAIAISRAGWAGGSHLVN 317

Query: 385 AVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFL 444
           A IL + ISA N ++Y+GSR +  LA   LAP++   T K GVP  A+   +A G ++ +
Sbjct: 318 AFILFSCISAINGSLYIGSRTLTNLAYEGLAPKFLAWTDKRGVPIPAITIFNALGLISLM 377

Query: 445 EVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLA 504
            +S G + A+++++N+ GV  F  W +IS  H+R  +    +G   ++LP+KA   PW  
Sbjct: 378 NMSVGASNAYSYIVNLSGVGVFIVWGVISYTHLRLRKAWVAQGRLLEELPYKALFYPWTP 437

Query: 505 YYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYI 537
            ++          QG+T+  P F   +FV AYI
Sbjct: 438 IFSLISNIFLALIQGWTSLVP-FKAPEFVDAYI 469

>TBLA0B07760 Chr2 complement(1834605..1836581) [1977 bp, 658 aa]
           {ON} Anc_5.158 YGR191W
          Length = 658

 Score =  216 bits (551), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 131/482 (27%), Positives = 221/482 (45%), Gaps = 12/482 (2%)

Query: 80  DQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVF 139
           D+  +   ++ ++L  RH                   + L   GP   +I ++ ++T +F
Sbjct: 132 DEETLLATDMNKDLSVRHLLTLAVGGAIGTGLFVNSGSSLNTGGPASLVIGWVIVSTALF 191

Query: 140 SVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQF 199
           +V  SLGE+A                  PS   A    Y   W +   LEL      I++
Sbjct: 192 TVINSLGELAAAFPVVGGFSVYMDKFVDPSFAFAVNLNYLLQWLVLLPLELVAASITIRY 251

Query: 200 WTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGV 259
           W  ++   AW+ I++  + + NM  VK +GE EF ++ +K++AI+GF I  + + CG G 
Sbjct: 252 WNSSINSDAWVSIFYVAIGLANMLDVKSFGETEFVLSLVKILAIIGFFILGIVLDCGGGP 311

Query: 260 TGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 318
           +   +G +YW +PG +         +  +F G  S  + AAF++ G E+  ++A E+ NP
Sbjct: 312 SHEYIGGKYWHDPGAF-----VGTTSGSKFKGLCSVFVTAAFSFSGIEMTAVSAAESRNP 366

Query: 319 RKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX--XXXXXXXXXPFIIAIQNSGT 376
           R+T+P+A K+                   VP++DP+L            P +IAI+N   
Sbjct: 367 RETIPKAAKRTFWLITGSYVSILTLVGCLVPYNDPRLMNGSSSVDAASSPLVIAIENGHI 426

Query: 377 KVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTS 436
             LP + NA+IL  I+S  NS++Y  SR M  ++K +  P+ F    + G P  A+ F  
Sbjct: 427 HGLPSLMNAIILIAILSVANSSVYACSRCMVSMSKIETLPKVFAKVDRRGRPIPAICFVL 486

Query: 437 AFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFK 496
            FG L+F+  S   A+ F WL  + G++  F W+ I++ H+RF Q +  + IS D+LPF 
Sbjct: 487 FFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMGINLCHIRFRQGMHVQQISLDELPFL 546

Query: 497 AALMPWLAYYAXXXXXXXXXXQGFTAFAPT----FNGSDFVAAYIXXXXXXXXXXXXQLY 552
           +    W + Y             +T+  P      N + F   Y+            ++Y
Sbjct: 547 SQTGIWGSIYGIVILFLVLVASFWTSLFPVGSSKANATSFFEGYLSFPILLGCYIAHKVY 606

Query: 553 FR 554
           F+
Sbjct: 607 FK 608

>Smik_3.53 Chr3 complement(77146..79047) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  216 bits (550), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 132/445 (29%), Positives = 215/445 (48%), Gaps = 8/445 (1%)

Query: 89  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEM 148
           +K+ ++ RH                   T L +AGP G LI Y  M +I++ + Q+ GEM
Sbjct: 116 LKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYGIMGSILYCIIQACGEM 175

Query: 149 AXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLS 207
           A                      G A  ++Y   W     LEL      I++WT +V   
Sbjct: 176 ALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPD 235

Query: 208 AWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCM-VCGAGVTGPVGFR 266
            +++I++ ++  +N+F  + Y E EF+    K++ + GF I  + + V GAG  G +G +
Sbjct: 236 VFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGK 295

Query: 267 YWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAI 326
           YW +PG +     + + +  RF G V++L+ AAF + G+E + IT  E ANPRK VP A 
Sbjct: 296 YWHDPGAF-----NGKHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQANPRKAVPGAA 350

Query: 327 KKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXX-XXXXPFIIAIQNSGTKVLPHIFNA 385
           K++                  VP++  +L           P++IA+ + G +V+PH  NA
Sbjct: 351 KQMIYRILFLFLATIILLGFLVPYNSNQLLGSSGGGTKASPYVIAVASHGVRVVPHFINA 410

Query: 386 VILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLE 445
           VIL +++S  NS+ Y  +R++  L++   APR F    K G P IA+  ++ FG +AF  
Sbjct: 411 VILLSVLSMANSSFYSSARILLTLSEQGYAPRVFTYIDKAGRPLIAMGVSALFGVIAFCA 470

Query: 446 VSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAY 505
            S    + F WLL I G++  F W  I ++H+RF + ++ +G S  +L F++    W + 
Sbjct: 471 ASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFRSQTGVWGST 530

Query: 506 YAXXXXXXXXXXQGFTAFAPTFNGS 530
           YA          Q + A AP   G 
Sbjct: 531 YACIMMILILIGQFWVAIAPIGEGK 555

>Suva_7.485 Chr7 (836820..838631) [1812 bp, 603 aa] {ON} YGR191W
           (REAL)
          Length = 603

 Score =  215 bits (548), Expect = 2e-61,   Method: Compositional matrix adjust.
 Identities = 129/437 (29%), Positives = 206/437 (47%), Gaps = 11/437 (2%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           D+D   V Q  + +  + +EL  RH                     L   GP   +I ++
Sbjct: 73  DDD---VQQEDINNTNLSKELSVRHLLTLAVGGAIGTGLFVNTGAALSTGGPASLVIDWV 129

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
            ++T +F+V  SLGE++                  PS   A    Y   W +   LEL  
Sbjct: 130 IISTCLFTVINSLGELSAAFPVVGGFNVYSMRFVEPSFAFAVNLNYLAQWLVLLPLELVA 189

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
               I++W D +   AW+ I++  + + NM  VK +GE EF ++ IK++AI+GF I  + 
Sbjct: 190 ASITIKYWNDKINSDAWVAIFYATIAMANMLDVKSFGETEFVLSMIKILAIIGFTILGIV 249

Query: 253 MVCGAGVTGPVGF-RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
           + CG G  G     +YW +PG +         +  +F G  S  + AAF+Y G E+  ++
Sbjct: 250 LSCGGGPHGGYIGGKYWNDPGAF-----VGHDSGTKFKGLCSVFVTAAFSYSGIEMTAVS 304

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX--XXXXXXXXXPFII 369
           A E+ NPR+T+P+A K+                   VP +DP+L            P +I
Sbjct: 305 AAESKNPRETIPKAAKRTFWLITISYVTILTLIGCLVPSNDPRLLNGSSSVDAASSPLVI 364

Query: 370 AIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPY 429
           AI+N   K LP + NA+IL  ++S  NS +Y  SR M  +A     P++     K G P 
Sbjct: 365 AIENGRIKGLPSLMNAIILIAVVSVANSAVYACSRCMVAMAHIGNLPKFLRRVDKRGRPI 424

Query: 430 IAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGIS 489
            A++ T  FG L+F+  S   A+ F WL  + G++  F W+ I+++H+RF Q ++ +  S
Sbjct: 425 NAIVLTLFFGLLSFVAASDKQAEVFTWLSALSGLSTIFCWMAINLSHIRFRQAMKFQERS 484

Query: 490 RDDLPFKAALMPWLAYY 506
            D+LPF +    W + Y
Sbjct: 485 LDELPFISQTGVWGSIY 501

>KAFR0D04140 Chr4 (821341..823254) [1914 bp, 637 aa] {ON} 
          Length = 637

 Score =  216 bits (549), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 137/479 (28%), Positives = 218/479 (45%), Gaps = 13/479 (2%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
            DA +++ ++ RH                   + L  AGP   +I Y  M + ++ + Q+
Sbjct: 115 DDAHLQKSIRPRHVLMMSLGTGIGTGLLVGNGSALSKAGPGALVIGYGIMGSCLYCIIQA 174

Query: 145 LGEMAXXXXXXXXXXXXXXXXXXPSIGAANG--YMYWFSWAITFALELSVVGQIIQFWTD 202
            GEMA                     G A G  ++Y   W     LEL      I +WT 
Sbjct: 175 CGEMAVCYSGLPGNFNAYPSFLVDE-GMAFGVAWVYCLQWLCVMPLELVTASMTIDYWTT 233

Query: 203 AVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCM-VCGAGVTG 261
            V    ++VI++ ++T++N F  K Y E EF+  S KV+ + GF I  + +   GAG  G
Sbjct: 234 KVNSDVFVVIFFVLITLINTFGAKGYAEAEFFFNSCKVLMMAGFFILAIVINTGGAGNDG 293

Query: 262 PVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 321
            +G +YW NPG +         +  RF   +S+   AAF +  +E + I A E +NPR+ 
Sbjct: 294 YIGAKYWHNPGAF-----RGDKSIDRFKDVMSTFTTAAFAFGASEFIAIGASEQSNPRRA 348

Query: 322 VPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXX--PFIIAIQNSGTKVL 379
           +P A K +                  VP+D  +L            P++IA+ + G +V+
Sbjct: 349 IPSAAKTMIYRILFIFLTSITLVGFLVPYDSTELLGSGGSASSQASPYVIAVASHGVRVV 408

Query: 380 PHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFG 439
           PH  NAVIL +++S  NS  Y   R+++ LA+   AP+WF    + G P  A+L T+ FG
Sbjct: 409 PHFINAVILLSVLSVANSAYYSSCRILYSLAQQGYAPKWFEYIDREGRPARAMLVTTIFG 468

Query: 440 ALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAAL 499
            +AF   S      F WLL+I G++  F W  I ++H+RF + ++ +G S D++ FK+ +
Sbjct: 469 VIAFCSCSDKEEDVFAWLLSIAGLSQLFTWTAICLSHIRFRRAMKVQGRSVDEIGFKSQV 528

Query: 500 MPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKLY 558
             W + YA          + + + AP   G D + A               LYF  K+Y
Sbjct: 529 GVWGSGYAAIMMILALIAEFWVSIAPI--GEDHLDAQNFFENYLAMPILIVLYFGYKIY 585

>AFR230C Chr6 complement(855413..857227) [1815 bp, 604 aa] {ON}
           Non-syntenic homolog of Saccharomyces cerevisiae YKR039W
           (GAP1)
          Length = 604

 Score =  215 bits (547), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 132/414 (31%), Positives = 201/414 (48%), Gaps = 8/414 (1%)

Query: 87  AEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLG 146
           A + R LK RH                     L  AGP G LI +   AT++  +  SLG
Sbjct: 81  APLSRRLKNRHLQMIAIGGAIGVGLFVGSGKALATAGPAGVLIGWGLTATMILIMCLSLG 140

Query: 147 EMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW-TDAVP 205
           E+A                   S G AN + Y     +   LE+      + +W TD   
Sbjct: 141 ELAVTFPVSGGYITYAARFIDESWGFANNFNYMMQAMVVMPLEIVAASVTVGYWDTDPKY 200

Query: 206 LSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPV-G 264
             A++ ++W ++  +N+F V+ +GE E   + IKVI I+GF+I  + ++ G G    V G
Sbjct: 201 KLAFVALFWVVIVSINLFGVRGFGEAESIFSLIKVITIIGFIIMGVVLISGGGPDHEVIG 260

Query: 265 FRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 324
            +YW +PGP+            +F G  S  + AAF++ G+EL+G+ A E   PRK++P+
Sbjct: 261 GKYWNDPGPF-----VGNAPSDKFKGVCSVFVTAAFSFAGSELIGLAAAETREPRKSIPK 315

Query: 325 AIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXX-XXXXXXXXPFIIAIQNSGTKVLPHIF 383
           A K+V                  VP ++  L           PF+IA+     +VLP I 
Sbjct: 316 AAKQVFWRITLFYILSLLIVGLLVPSNNEHLLAPQQIDAAHSPFVIAMDMHRIRVLPSII 375

Query: 384 NAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAF 443
           N VIL+ +IS GNS++Y  SR M  LA+    P+ FG   + G P  A+ FTS FG L F
Sbjct: 376 NVVILTAVISVGNSSVYSSSRTMCALAEHGFLPKIFGYIDRKGRPLFAICFTSLFGLLCF 435

Query: 444 LEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKA 497
           +  +    + F+WLL I G++ FF WL I++AH+RF   L+ +G + ++L F +
Sbjct: 436 VAGAKEEGEIFDWLLAISGLSSFFTWLTINLAHMRFRMALKAQGRTTNELSFTS 489

>YFL055W Chr6 (17004..18680) [1677 bp, 558 aa] {ON}
           AGP3Low-affinity amino acid permease, may act to supply
           the cell with amino acids as nitrogen source in
           nitrogen-poor conditions; transcription is induced under
           conditions of sulfur limitation; plays a role in
           regulating Ty1 transposition
          Length = 558

 Score =  214 bits (544), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 144/466 (30%), Positives = 213/466 (45%), Gaps = 15/466 (3%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           DED P V +   Q   VKR LK RH                     L   GP+  L+ + 
Sbjct: 35  DED-PDVSRYDPQTG-VKRALKNRHISLLALGGVIGPGCLVGAGNALNKGGPLALLLGFS 92

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
            +  I FSV +S+GEM                    ++ A  GY Y   +    A E + 
Sbjct: 93  IIGIIAFSVMESIGEMITLYPSGGGFTTLARRFHSDALPAVCGYAYVVVFFAVLANEYNT 152

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
           +  I+QFW   VPL  +I+I+WF   I  +  V  +GE E+W+A +K++ ++ + I+ + 
Sbjct: 153 LSSILQFWGPQVPLYGYILIFWFAFEIFQLVGVGLFGETEYWLAWLKIVGLVAYYIFSIV 212

Query: 253 MVCGAGVTGPV-GFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
            + G     P  GF YW +PG    G          F G     +  +  Y GTE V + 
Sbjct: 213 YISGDIRNRPAFGFHYWNSPGALSHG----------FKGIAIVFVFCSTFYSGTESVALA 262

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAI 371
           A E+ NP K VP A+++                   VPFDDP L          P  IAI
Sbjct: 263 ATESKNPGKAVPLAVRQTLWRILVVYIGIAVFYGATVPFDDPNLSASTKVLKS-PIAIAI 321

Query: 372 QNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIA 431
             +G     H+ NA IL T ISA N ++Y+GSR +  LA   LAP+    T + GVP  A
Sbjct: 322 SRAGWAGGAHLVNAFILITCISAINGSLYIGSRTLTHLAHEGLAPKILAWTDRRGVPIPA 381

Query: 432 VLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRD 491
           +   +A G ++ + VS G A A+++++N+ GV  F  W +IS  H+R  +    +G S +
Sbjct: 382 ITVFNALGLISLMNVSVGAANAYSYIVNLSGVGVFIVWGVISYTHLRIRKAWVAQGRSIE 441

Query: 492 DLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYI 537
           +LP++A   PW    +          QG++ F P F+  +FV AYI
Sbjct: 442 ELPYEALFYPWTPVLSLAANIFLALIQGWSYFVP-FDAGNFVDAYI 486

>KNAG0G00900 Chr7 complement(170122..171963) [1842 bp, 613 aa] {ON}
           Anc_5.158 YGR191W
          Length = 613

 Score =  215 bits (547), Expect = 3e-61,   Method: Compositional matrix adjust.
 Identities = 130/411 (31%), Positives = 204/411 (49%), Gaps = 8/411 (1%)

Query: 88  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGE 147
           ++ ++L  RH                     L + GP   +I ++ ++T +F+V  SLGE
Sbjct: 95  QMNKDLDVRHLLTLAVGGAIGTGLFVNSGAALSSGGPASLVIDWVIISTCLFTVVNSLGE 154

Query: 148 MAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLS 207
           +A                  PS G A    Y   W +   LEL      I++W D +   
Sbjct: 155 LAAAFPVVGGFNVYITRFIDPSFGFAVNINYLAQWLVLLPLELVAASITIRYWNDKINSD 214

Query: 208 AWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVGF-R 266
           AW+ I++  +   NM  VK +GE EF ++ IK++AI+GF I  + + CG G  G     +
Sbjct: 215 AWVAIFYAAIAFANMLDVKSFGETEFILSMIKILAIVGFTILGIVLSCGGGPKGGYIGGK 274

Query: 267 YWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAI 326
           YW +PG +       + +  +F G  S  + AAF+Y G EL  ++A E+ NPR+T+P+A 
Sbjct: 275 YWHDPGAF-----VGETSGTKFKGLCSVFVTAAFSYSGMELTAVSAAESLNPRETIPKAA 329

Query: 327 KKVSXXXXXXXXXXXXXXXXXVPFDDPKLX--XXXXXXXXXPFIIAIQNSGTKVLPHIFN 384
           K+                   VP+++PKL            P +IAI+N G + LP + N
Sbjct: 330 KRTFWLITLSYVTILTLIGCLVPYNNPKLLNGSSSVDAASSPLVIAIENGGIRGLPSLMN 389

Query: 385 AVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFL 444
           A+IL  I+S  NS +Y  SR M  +A+ +  PR+ G   + G P  A L T  FG L+F+
Sbjct: 390 AIILIAIVSVANSAVYACSRCMVSMARIRNLPRFLGRVDRKGRPLNATLLTLFFGLLSFI 449

Query: 445 EVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPF 495
             S    + F WL  + G++  FAW+ I+++H+RF Q + H+GIS D+LP+
Sbjct: 450 AASDKQEEVFTWLSALSGLSTIFAWMAINLSHIRFRQAMAHQGISLDELPY 500

>SAKL0F16544g Chr6 complement(1364680..1366383) [1704 bp, 567 aa]
           {ON} similar to gnl|GLV|KLLA0B14685g Kluyveromyces
           lactis KLLA0B14685g and weakly similar to YOR348C
           uniprot|P15380 Saccharomyces cerevisiae YOR348C PUT4
           proline- specific permease (also capable of transporting
           alanine and glycine) putative proline-specific permease
          Length = 567

 Score =  214 bits (544), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 151/535 (28%), Positives = 242/535 (45%), Gaps = 23/535 (4%)

Query: 79  VDQGVVQDAE-----VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           V QG V D E     + R LK RH                     L   GP   LIAY  
Sbjct: 36  VSQGSVLDIESQKPGIVRGLKSRHVQLIALGSAIGTGLFIGSGGALSICGPAPLLIAYAV 95

Query: 134 MATIVFSVTQSLGEMAXXXXX--XXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELS 191
           M+  V+SV   + EM                       +    G+  +++ A+    E++
Sbjct: 96  MSLFVWSVMNQMTEMVTLIPLPGESTLYSLLKLYVNKPLSFMCGWNLFYAQAMIAPAEVT 155

Query: 192 VVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCL 251
               ++Q+WTDA P + +I I+  +   + M PVK +GE EFWV+SIK++ I+G +I  +
Sbjct: 156 ACALLVQYWTDANP-AIFISIFLVLSVAITMLPVKVFGESEFWVSSIKILTIVGLIIVGV 214

Query: 252 CMVCGAGVTGP--VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGT-ELV 308
            +  G G      +GF YW+ PG + P ++      G+FL + +++I + F++    E+V
Sbjct: 215 VIFFGGGPAQEHVLGFHYWKKPGAFKPYLVEG--GTGKFLAFWTAIIKSGFSFVLVPEIV 272

Query: 309 GITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX----XXXXXXXX 364
              A EA  PR+ +PRA K+                   V +D+ +L             
Sbjct: 273 SSCAAEAVAPRRNMPRACKRFIYRLALFYVFGILVVGVIVGYDNDRLLNAIASGQSSAAA 332

Query: 365 XPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTK 424
            PF+I I+ +G +VLPHI NA IL++  S G   +Y  SR +  +A    APR      K
Sbjct: 333 SPFVIGIKEAGIRVLPHIINAAILTSAYSCGTGLLYGASRTLHSMACKGDAPRILTTVNK 392

Query: 425 HGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLE 484
           +GVPY     TS F  LA+L  S+  +  FNWL NI  ++GF +W+L+SIA++RF   ++
Sbjct: 393 YGVPYYCTGITSLFCLLAYLNCSNSSSVVFNWLSNIATISGFVSWVLVSIAYIRFRNVID 452

Query: 485 HRGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP-TFNGSDFVAAYIXXXXXX 543
              ++ D +PF+      LAY A           GF  F    ++ S+F AAYI      
Sbjct: 453 VLKLN-DRIPFRVPYQKPLAYLAMGFFSILTLTNGFAVFIKGNWDTSNFFAAYITLGFVL 511

Query: 544 XXXXXXQLYF---RCKLYWSLDE-VXXXXXXXXXXXXXWEDSAPKTFWDRFWDVV 594
                  +Y+   RC+    +++ +             ++   P+ + ++ W V+
Sbjct: 512 VLFVGSTIYYKEWRCRDIAEIEQDILPKITLAEAEEYEYDIPVPRNWLEKIWMVI 566

>Kpol_543.79 s543 (197876..199693) [1818 bp, 605 aa] {ON}
           (197876..199693) [1818 nt, 606 aa]
          Length = 605

 Score =  214 bits (546), Expect = 4e-61,   Method: Compositional matrix adjust.
 Identities = 135/410 (32%), Positives = 202/410 (49%), Gaps = 8/410 (1%)

Query: 89  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEM 148
           ++ +LK RH                     L+ AGP G LI +    T++F++  +LGE+
Sbjct: 88  LQHKLKSRHLQMIAIGGAIGTGLFVGSGRALRTAGPAGILIGWSITGTMIFTMVMALGEL 147

Query: 149 AXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLS- 207
           A                   S G A  + Y   W +   LE+      + +W   V  + 
Sbjct: 148 AVMFPVSGGFTTYATRFIDESFGFACNFNYMLQWLVVLPLEIVAASITVAYWETPVRYTD 207

Query: 208 AWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVGF-R 266
            ++ ++W ++ I+NMF V+ YGE EF  + IKV A++GF+I  + +VCG G  G     R
Sbjct: 208 GFVALFWLVVVIINMFGVRGYGEAEFVFSIIKVTAVIGFIILGIVLVCGGGPVGGYVGAR 267

Query: 267 YWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAI 326
           YW NPG +  G  S Q    +F G+ S  + AAF++ G+EL+G+   EA NPRK VP A 
Sbjct: 268 YWHNPGAF-VGSTSGQ----KFHGFCSVFVTAAFSFAGSELIGLAGSEAKNPRKAVPSAA 322

Query: 327 KKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXX-PFIIAIQNSGTKVLPHIFNA 385
           K+V                  VP++DP+L           PF+IAI   G   LP + N 
Sbjct: 323 KQVFWRILLFYIICLLLIGFLVPYNDPRLISSSSVDASASPFVIAIVTHGISGLPSVINV 382

Query: 386 VILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLE 445
           VIL +++S GNS IY  SR +  L++    P+      + G P + +  +S FG +AF+ 
Sbjct: 383 VILISVLSVGNSAIYSCSRTLVALSEQGFLPKIVSYIDRKGRPLVGIAISSTFGLIAFVA 442

Query: 446 VSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPF 495
            S+   + FNWLL I G++ FF W  I I H+RF   L+ +G   D+LPF
Sbjct: 443 ASNKQNEMFNWLLAISGLSSFFTWSAICICHIRFRGALKAQGRGTDELPF 492

>Suva_2.203 Chr2 complement(347891..349705) [1815 bp, 604 aa] {ON}
           YDR046C (REAL)
          Length = 604

 Score =  214 bits (545), Expect = 5e-61,   Method: Compositional matrix adjust.
 Identities = 138/464 (29%), Positives = 217/464 (46%), Gaps = 13/464 (2%)

Query: 74  EDEPYVDQG---VVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIA 130
           ED+  ++ G   +  +  +K+ +K RH                  +  LK AGP   +I 
Sbjct: 68  EDDNDLEDGTRSMRSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIG 127

Query: 131 YLFMATIVFSVTQSLGEMAXXXXXX-XXXXXXXXXXXXPSIGAANGYMYWFSWAITFALE 189
           Y+ ++ + + + Q+ GEM                     S G A  +++   W     LE
Sbjct: 128 YVLVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFVSKSFGFATTWLFCIQWLTVLPLE 187

Query: 190 LSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIY 249
           L      I++W D +    +I I++  L  ++ F VK YGE EF   S K++ I GF+I 
Sbjct: 188 LITSSMTIKYWNDTINADVFIAIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIIL 247

Query: 250 CLCMVCG-AGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELV 308
            + + CG AGV G +G  YWRNPG +  G  ++     RF G    L+ A F++ G EL 
Sbjct: 248 SVIINCGGAGVDGYIGGEYWRNPGSFADGSSAT-----RFKGICFILVTAYFSFGGIELF 302

Query: 309 GITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXX-XXXXXXXPF 367
            ++  E ANPRK+ P A K+                   VP D+ +L           P+
Sbjct: 303 VLSINEQANPRKSTPVAAKRSIYRILIIYLLTMILIGFNVPHDNDQLMGSGSSATHASPY 362

Query: 368 IIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGV 427
           ++A    G KV+PHI NAVIL ++IS  NS +Y   R+M  LA+   AP++     + G 
Sbjct: 363 VLAASIHGVKVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGR 422

Query: 428 PYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRG 487
           P  A++  S  G + F+  SS   +AF WL  I G++  F W  I ++H+RF + ++ +G
Sbjct: 423 PLRALVVCSFVGLVGFVACSSQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQG 482

Query: 488 ISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSD 531
            S D++ +K+    W +YY           Q + A +P   GSD
Sbjct: 483 RSLDEVGYKSNTGIWGSYYGVIFNILVFMAQFWVALSPP--GSD 524

>KLTH0F01584g Chr6 complement(120227..122017) [1791 bp, 596 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 596

 Score =  214 bits (544), Expect = 7e-61,   Method: Compositional matrix adjust.
 Identities = 140/489 (28%), Positives = 229/489 (46%), Gaps = 15/489 (3%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           ++ ++K+ +  RH                     L N GP G  I Y  M + ++ + Q+
Sbjct: 75  RETKLKQTISSRHLFMISLGTGIGTGMLVGNGKALHNGGPAGLAIGYAIMGSCIYCIIQA 134

Query: 145 LGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
            GEMA                   P++G +  ++Y   W     LEL      I++WT A
Sbjct: 135 AGEMAVSYSSLSGNFNAYPSMLIDPALGFSVAWVYCLQWLCVLPLELVTATITIKYWTTA 194

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGP 262
           V    ++VI++ +  ++N+F  + Y E EF+  + KV+ I GF I  + + CG AG  G 
Sbjct: 195 VNPDVFVVIFYVLTVLVNLFGARGYAEAEFFFNTCKVLMITGFFILGIIVNCGGAGNDGY 254

Query: 263 VGFRYWRNPGP-WGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 321
           +G +YW +PG  +G   I        F G +++++ AAF +  TE + +TA E ANPR+ 
Sbjct: 255 LGGKYWHDPGALYGTKPIH------HFKGIIATMVTAAFAFGATEFIALTAAEQANPRRA 308

Query: 322 VPRAIKKVSXXXXXXXXXXXXXXXXXVPFD-DPKLXXXXXXXXXXPFIIAIQNSGTKVLP 380
           +P A KK+                  VP++ D  +          P++IAI + G KV+P
Sbjct: 309 IPSAAKKIVYRVLLIFLAPIILLGFLVPYNSDELMGSGGSATHASPYVIAIASHGVKVVP 368

Query: 381 HIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGA 440
           H  NAVIL +++S GNS  Y  SR++  L++   AP W     + G P  A+L +  FG 
Sbjct: 369 HFINAVILLSVLSVGNSAFYSSSRLLLSLSEQHYAPSWLNYIDREGRPIRAMLVSCIFGL 428

Query: 441 LAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALM 500
           +AF+  S      F WLL I G++  F W+ I ++H+RF + L  +G S  +L +K+   
Sbjct: 429 IAFVAASPKEETVFTWLLAISGLSQLFTWICICVSHIRFRKALVVQGKSLGELGYKSQTG 488

Query: 501 PWLAYYAXXXXXXXXXXQGFTAFAPT----FNGSDFVAAYIXXXXXXXXXXXXQLYFRC- 555
              +YYA          Q + A AP      + ++F   Y+            +++ R  
Sbjct: 489 VVGSYYATVIMACVLTGQFWVAIAPVGTDKLDANNFFENYLAMPILIALYFGYRVWKRDW 548

Query: 556 KLYWSLDEV 564
           KLY  L+++
Sbjct: 549 KLYIPLEQI 557

>KAFR0E01850 Chr5 (381160..382842) [1683 bp, 560 aa] {ON} Anc_5.158
           YGR191W
          Length = 560

 Score =  213 bits (541), Expect = 9e-61,   Method: Compositional matrix adjust.
 Identities = 125/426 (29%), Positives = 205/426 (48%), Gaps = 8/426 (1%)

Query: 84  VQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQ 143
           + +  + + L  RH                   T L + GP   ++ ++ ++T +F+V  
Sbjct: 38  LNNTNLSKNLSVRHLVTLAVGGSIGTGLFVNSGTALSDGGPASLVVGWVIISTCLFTVIN 97

Query: 144 SLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
           SLGE+A                  PS+G A    Y   W +   LEL      I++W D 
Sbjct: 98  SLGELAAAFPIVGGFNVYITRFVDPSVGFAVNLNYLAQWLVLLPLELVAASLTIKYWNDK 157

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPV 263
           +   AW+ I++  + + NM  VK +GE EF ++ +K++AI+GF I  + +  G G +G  
Sbjct: 158 INSDAWVAIFYVTIVLANMLEVKSFGETEFVLSMVKILAIIGFTILGIVLASGGGPSGGY 217

Query: 264 G-FRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
             F+YW NPG +  G  +S     +F G  S  + AAF++ G E++ ++A E+ NPRK +
Sbjct: 218 LGFKYWNNPGAFVGGTNAS-----KFKGLCSVFVTAAFSFSGIEMIAVSAAESKNPRKVI 272

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXX--XXXXPFIIAIQNSGTKVLP 380
           P+A K+                   VP++D +L            P +IAI+N G K LP
Sbjct: 273 PKAAKRTFWLVTSSYVVILTLVGCLVPYNDSRLLNAATSVDAAASPLVIAIENGGIKGLP 332

Query: 381 HIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGA 440
            + NA+IL  I+S  NS +Y  SR M  +A     P+      K G P  A++ T  FG 
Sbjct: 333 SLMNAIILIAIVSVANSAVYACSRCMVSMAHIGNLPKVLSKVDKKGRPMNALIVTLIFGL 392

Query: 441 LAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALM 500
           L+F+  S    + F WL  + G++  F W+ I+ + +RF + ++ +  S D+LP+ +   
Sbjct: 393 LSFIAASDKQNEVFTWLSALSGLSTIFCWMAINYSLIRFRRAMQVQNRSLDELPYLSQTG 452

Query: 501 PWLAYY 506
            W A+Y
Sbjct: 453 IWGAWY 458

>TBLA0A05180 Chr1 complement(1267962..1269992) [2031 bp, 676 aa]
           {ON} 
          Length = 676

 Score =  215 bits (547), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 133/459 (28%), Positives = 209/459 (45%), Gaps = 12/459 (2%)

Query: 86  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSL 145
           +AE+++ +K RH                  + PL  AGP   +I Y  M T ++ + Q+ 
Sbjct: 156 NAELRQTIKPRHVIMMSLGTGIGTGLLVGNAKPLAAAGPAPLVIGYGIMGTCIYCIIQAC 215

Query: 146 GEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAV 204
           GEMA                   P    A  ++Y   W     LEL      IQ+WT  V
Sbjct: 216 GEMAVAYGNLTGSFNTFPSFLVDPGFNFAVAWVYCIQWLCVCPLELVTASMTIQYWTTKV 275

Query: 205 PLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGA-GVTGPV 263
               ++VI++ ++ ++N F  K Y E EF   + KV+ I GF I  +C+  GA G  G +
Sbjct: 276 DPDVFVVIFYVLILLINFFGAKGYAEAEFIFNTCKVLMICGFFILAICIDTGAAGTDGYI 335

Query: 264 GFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 323
           G +YW +PG +       Q    RF G + + + AAF +  TE + +TA E +NPRK +P
Sbjct: 336 GAKYWNDPGAF-----RGQTKIERFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAIP 390

Query: 324 RAIKKVSXXXXXXXXXXXXXXXXXVPFD-DPKLXXXXXXXXXXPFIIAIQNSGTKVLPHI 382
            A KK+                  VP+D D  L          P+++AI   G +V  H 
Sbjct: 391 SAAKKIIYRVLVIFLNTIILIGFLVPYDSDQLLGSGGSATKASPYVLAISLHGVRVAQHF 450

Query: 383 FNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALA 442
            NAVIL ++IS GNS  Y  SR++  LA+   AP+ F    + G P IA+  ++    +A
Sbjct: 451 VNAVILISVISVGNSAFYSSSRLLMSLAQQGSAPKIFDYVDREGRPLIAMCCSAVIAVIA 510

Query: 443 FLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPW 502
           F   S    + F WL+ I G++  F W  I ++H+RF + ++ +G S  ++ + +     
Sbjct: 511 FCATSPKETEVFTWLMAIAGLSQLFTWFAICLSHLRFRRAMKVQGRSLGEMGYLSQTGIL 570

Query: 503 LAYYAXXXXXXXXXXQGFTAFAP----TFNGSDFVAAYI 537
            + YA          Q + A  P    T + + F + Y+
Sbjct: 571 GSLYAAIMMILALIAQFWVALVPMGTHTPDANSFFSNYL 609

>CAGL0L03267g Chr12 (374784..376577) [1794 bp, 597 aa] {ON} highly
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039w GAP1 general amino acid permease
          Length = 597

 Score =  213 bits (542), Expect = 1e-60,   Method: Compositional matrix adjust.
 Identities = 135/414 (32%), Positives = 201/414 (48%), Gaps = 8/414 (1%)

Query: 87  AEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLG 146
           A +K  LK RH                   T L+ AGP G LI +    T+++ +  ++G
Sbjct: 79  APLKHHLKNRHLQMIAIGGAIGTGLFVGSGTALRTAGPAGILIGWGLTGTMIYCMVMAMG 138

Query: 147 EMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW-TDAVP 205
           E++                   S G AN + Y   W     LE+      + +W TD   
Sbjct: 139 ELSVVFPISGGFTTYATRFIDESFGFANNFNYMLQWLCVLPLEIVAASITVNYWGTDPKY 198

Query: 206 LSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVGF 265
              ++ ++W ++ I+N+F VK YGE EF  + IKV+ ++GF+I  + + CG G  G    
Sbjct: 199 RDGFVALFWVVIVIINLFGVKGYGEAEFVFSIIKVLTVIGFIIMGIVLNCGGGPEGGYIG 258

Query: 266 -RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 324
            +Y+ +PG +         A  RF G  S  + AAF++ G+EL+GI A E+A PRK+VP+
Sbjct: 259 GKYFHDPGAF-----VGDTAGARFQGVCSVFVTAAFSFAGSELIGIAAAESAEPRKSVPK 313

Query: 325 AIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX-XXXXXXXXXPFIIAIQNSGTKVLPHIF 383
           A K+V                  VP+ D +L           PF+IAI + G + LP + 
Sbjct: 314 AAKQVFWRITLFYMLSLLMVGLLVPYTDERLIGASSVDAAASPFVIAITSHGIRGLPSVV 373

Query: 384 NAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAF 443
           N VIL  ++S GNS +Y  SR +  LA+    P+ FG   + G P   + FTSAFG +AF
Sbjct: 374 NVVILIAVLSVGNSAVYGCSRTLCALAQQNFLPKIFGYIDRSGRPLFGIAFTSAFGLVAF 433

Query: 444 LEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKA 497
           +  S    + F WLL + G++  F W  I   H+RF   L  +G S D+LPFKA
Sbjct: 434 VAQSKKEGEVFAWLLALSGLSSLFTWGGICFCHIRFRAALTAQGRSTDELPFKA 487

>Skud_3.38 Chr3 complement(63096..64997) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  213 bits (541), Expect = 3e-60,   Method: Compositional matrix adjust.
 Identities = 129/449 (28%), Positives = 214/449 (47%), Gaps = 8/449 (1%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           +   +K+ ++ RH                   T L +AGP G LI Y  M +I++ + Q+
Sbjct: 112 KSGSLKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQA 171

Query: 145 LGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
            GE+A                      G A  ++Y   W     LEL      I++WT +
Sbjct: 172 CGELALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 231

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCM-VCGAGVTGP 262
           V    +++I++ ++  +N+F  + Y E EF+    K++ + GF I  + + V GAG  G 
Sbjct: 232 VNPDVFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILSIIIDVGGAGNDGF 291

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
           +G +YW +PG +     + + +  RF G V++L+ AAF + G+E + IT  E +NPRK +
Sbjct: 292 IGGKYWHDPGAF-----NGKHSIDRFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAI 346

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFD-DPKLXXXXXXXXXXPFIIAIQNSGTKVLPH 381
           P A K++                  VP++ D  L          P++IAI + G +V+PH
Sbjct: 347 PGAAKQMIYRILFLFLATIIMLGFLVPYNSDQLLGSGGGGTKASPYVIAIASHGVRVVPH 406

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
             NAVIL +++S  NS+ Y  +R+   L++   AP++F    + G P IA+  ++ F  +
Sbjct: 407 FVNAVILLSVLSMANSSFYSSARLFLTLSEQGYAPKFFSYIDRAGRPLIAMGVSALFAVI 466

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
           AF   S    + F WLL I G++  F W  I  +H+RF + ++ +G S  +L FK+    
Sbjct: 467 AFCAASPKEEQVFTWLLAISGLSQLFTWTAICFSHIRFRRAMKVQGRSLGELGFKSQTGV 526

Query: 502 WLAYYAXXXXXXXXXXQGFTAFAPTFNGS 530
           W + YA          Q + A AP   G 
Sbjct: 527 WGSMYACIMMLLILIGQFWVAIAPIGEGK 555

>Suva_13.517 Chr13 (904704..906347) [1644 bp, 547 aa] {ON} YPL265W
           (REAL)
          Length = 547

 Score =  211 bits (536), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 140/453 (30%), Positives = 219/453 (48%), Gaps = 18/453 (3%)

Query: 79  VDQGVVQD--AEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMAT 136
           + QGV+ +   ++K+ LK+RH                     LK  GPVG LIAYLF+  
Sbjct: 32  LKQGVLHNDRTKLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKTGPVGLLIAYLFVGI 91

Query: 137 IVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFAL----ELSV 192
           +V     ++ E+A                   S+G      + F W  T++     ELS 
Sbjct: 92  VVGCNQIAIAEVASFMPATGATIRHAEQFIDESVG------FTFGWISTYSSLMPGELSA 145

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
              I+++WTD  P + +I I+  +  + N++ ++FYGE E+    +K+I I   +I  L 
Sbjct: 146 TAVIMRYWTDISP-AVFITIFGVLFVVTNIYTIRFYGEVEYVFGWLKLILIFILIISGLV 204

Query: 253 MVCGAGVTGP--VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGI 310
           +  G GV G   +GF YWR+PGP+   I+   +  G+F+G+ S+L +  ++Y G + + I
Sbjct: 205 IDLG-GVKGQERLGFHYWRDPGPFAEYIVGGSI--GKFVGFWSALSSVVYSYSGIQNIAI 261

Query: 311 TAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIA 370
            AGE  N R  +    K V                  VP++D  +          PF+IA
Sbjct: 262 LAGETKNSRHAIYHGAKNVFLRIIVLYLVTVFVLTLIVPYNDALIASGTGTAKSSPFVIA 321

Query: 371 IQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYI 430
           +  +G KVLPHI NA++L++  SAGN  I  GSR +F LA    AP+ F  T+K G+PY+
Sbjct: 322 MNRAGIKVLPHIVNALVLTSAWSAGNLAIIEGSRNLFCLATKNQAPKIFLKTSKRGIPYV 381

Query: 431 AVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISR 490
            V+F S F  LA++  S   +  F W   +V       W+LIS  H+   + L+ +G SR
Sbjct: 382 GVIFISCFLPLAYMSCSESSSTVFGWFQELVSSNTLLRWILISANHIYMDRALKAQGYSR 441

Query: 491 DDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAF 523
            DLP+   + P+ A+++           GF  F
Sbjct: 442 SDLPYSTPIAPYAAWFSGIMSFIFLLTGGFYNF 474

>Kwal_33.14276 s33 complement(596760..598550) [1791 bp, 596 aa] {ON}
           YKR039W (GAP1) - general amino acid permease [contig
           104] FULL
          Length = 596

 Score =  211 bits (538), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 128/441 (29%), Positives = 201/441 (45%), Gaps = 14/441 (3%)

Query: 89  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEM 148
           +KR LK RH                     L+  GP   ++A++   ++V+SV Q++GE+
Sbjct: 84  LKRHLKNRHLQMIAIGGSIGTGLFVGSGKALRIGGPAAVILAWILTGSMVYSVVQAIGEL 143

Query: 149 AXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWT-DAVPLS 207
                              PS G A  Y Y     +T  LE+      + +W  D     
Sbjct: 144 CVALPVSGSYLSYVSRFIDPSFGFAIAYNYLVGNLVTMPLEIVAASITVDYWNVDHKYAD 203

Query: 208 AWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGV--TGPVGF 265
            ++ +++  + ++N   VK YGE EF  + IKV+AI+GF+I  + +VCG G   TG +G 
Sbjct: 204 GFVALFYVTVLLINFLGVKGYGEAEFVFSIIKVLAIVGFIILGIVLVCGGGSNNTGYIGT 263

Query: 266 RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRA 325
           +YW NPG +  G          F G+ +  + +AF++ G+E+  + A E+ NPR+ +P+A
Sbjct: 264 KYWHNPGGFAHG----------FKGFAAIFVTSAFSFSGSEMFALGAAESKNPRRDLPKA 313

Query: 326 IKKVSXXXXXXXXXXXXXXXXXVPFDDPKL-XXXXXXXXXXPFIIAIQNSGTKVLPHIFN 384
            K+V                  VP+ +  L           PF+IAI+ +G   LP + N
Sbjct: 314 AKQVFWRITLFYLISLTLIGCLVPYTNKHLFASSSVDASASPFVIAIKEAGISGLPSVIN 373

Query: 385 AVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFL 444
            VIL  ++S GN+ ++  SR    LA     P+ F    + G P   ++ +  FG L+FL
Sbjct: 374 VVILVAVLSVGNTCVFASSRATLSLAHYGYLPKKFAYVDRKGRPLAGLILSMVFGLLSFL 433

Query: 445 EVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLA 504
             S      F W+L + G+  FF W  I + H+RF Q L  +G S D+L FKA    W +
Sbjct: 434 SSSKHKGVVFEWMLAVSGLCSFFTWGSICVCHLRFRQGLRAQGRSTDELAFKAQTGIWGS 493

Query: 505 YYAXXXXXXXXXXQGFTAFAP 525
            Y           Q + A  P
Sbjct: 494 IYGITLISVVLCFQFWVALFP 514

>Skud_2.191 Chr2 complement(342307..344136) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  212 bits (539), Expect = 4e-60,   Method: Compositional matrix adjust.
 Identities = 128/451 (28%), Positives = 208/451 (46%), Gaps = 8/451 (1%)

Query: 81  QGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFS 140
           + +  D+++K+ +K RH                  +  L   GP   +I Y+ ++ + + 
Sbjct: 83  ESITSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFVTYF 142

Query: 141 VTQSLGEMAXXXXXX-XXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQF 199
           + Q+ GEMA                      G A  ++Y F W     LEL      IQ+
Sbjct: 143 MIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWLTVLPLELITASMTIQY 202

Query: 200 WTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AG 258
           W D +    +I+I++  L  +++F VK YGE EF     K++ I GF+I  + + CG AG
Sbjct: 203 WNDKLNPDVYILIFYIFLLFIHVFGVKAYGETEFIFNCCKILMIAGFIILSVVINCGGAG 262

Query: 259 VTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 318
             G +G  YW NPG +     +   +  RF      L+   F++ G EL  ++  E +NP
Sbjct: 263 DDGYIGGAYWHNPGAF-----AGDTSIARFKNVCYILVTGYFSFGGMELFALSVQEQSNP 317

Query: 319 RKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX-XXXXXXPFIIAIQNSGTK 377
           RK+ P A K+                   VP++D +L           P+++A    G K
Sbjct: 318 RKSTPVAAKRSIYRIVIIYLLTMILIGFNVPYNDDQLMGAGGSATHASPYVLAASIHGVK 377

Query: 378 VLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSA 437
           ++PHI NAVIL +++S  NS++Y G R++  L++   AP++     + G P  A++    
Sbjct: 378 IVPHIINAVILISVVSVANSSLYAGPRLICSLSQQGYAPKFLDYVDREGRPLRALIVCCI 437

Query: 438 FGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKA 497
           FG +AF+  SS     F WL  I G++  F W  I ++H+RF Q ++ +G S D+L +KA
Sbjct: 438 FGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLDELGYKA 497

Query: 498 ALMPWLAYYAXXXXXXXXXXQGFTAFAPTFN 528
               W + Y           Q + A AP  N
Sbjct: 498 TTGIWGSVYGFFFNILVFIAQFWVALAPLGN 528

>AGR040C Chr7 complement(782283..784004) [1722 bp, 573 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YBR069C
           (TAT1)
          Length = 573

 Score =  211 bits (536), Expect = 6e-60,   Method: Compositional matrix adjust.
 Identities = 131/442 (29%), Positives = 205/442 (46%), Gaps = 15/442 (3%)

Query: 87  AEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLG 146
           A++K+ +K RH                   + L  AGP G ++ Y+  + +++ + ++ G
Sbjct: 63  AKMKKTIKTRHLLMITLGTGIGTGLLVGNGSALAKAGPAGLILGYVVSSAMLYLIVEAAG 122

Query: 147 EMAXXXXXXX-XXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVP 205
           E+                    P++G +  ++Y   W   F L+L     IIQ+WTD  P
Sbjct: 123 ELGICYSGMTGNYTAYSSLLVDPAMGFSVSWVYCIQWMTVFPLQLVTAAMIIQYWTDINP 182

Query: 206 LSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGPVG 264
              ++ I + ++  +N+F  K Y E EF+    KV+ I+GF+I  + + CG AG +G +G
Sbjct: 183 -DIFVAIIYAVIVFINLFGAKGYAEAEFFFNLCKVLMIIGFVILGVVINCGGAGTSGYIG 241

Query: 265 FRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 324
            +YW  P P+  G          F G       AAF Y G E++ ++A E  NPRK++  
Sbjct: 242 DKYWHEPRPFMNG----------FKGLCFVFCYAAFAYGGIEVMVLSASEQENPRKSISS 291

Query: 325 AIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLPHIFN 384
           A KKV                  VP D P L          P +IA+   G K++PHI N
Sbjct: 292 ACKKVIYRIVLIYLLTTVIVCFLVPADHPSLASEGSRAS--PLVIAVSFHGVKIVPHIIN 349

Query: 385 AVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFL 444
           AVIL  ++S GNS++Y   R++  LA+   AP+ F    + G P  A      FG LAFL
Sbjct: 350 AVILIAVVSVGNSSLYSAPRLLLSLAEQGYAPKIFTYIDRQGRPLPAFFVAMVFGLLAFL 409

Query: 445 EVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLA 504
             S      F WLL I G++  F W+ I I+H+RF   ++ +G S  ++ +KA    W +
Sbjct: 410 AASPAQDDVFGWLLAISGLSQMFIWMSICISHIRFRDAMKAQGRSMGEVGYKARTGYWGS 469

Query: 505 YYAXXXXXXXXXXQGFTAFAPT 526
           + A          Q + A +P 
Sbjct: 470 WIAVVTAFLILIAQFWVAISPV 491

>KLLA0F27093g Chr6 (2501049..2502740) [1692 bp, 563 aa] {ON} similar
           to uniprot|P43548 Saccharomyces cerevisiae YFL055W AGP3
           Low-affinity amino acid permease may act to supply the
           cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 563

 Score =  210 bits (535), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 134/453 (29%), Positives = 210/453 (46%), Gaps = 13/453 (2%)

Query: 86  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSL 145
           D+ VKR+LK RH                     L   GP+  L+ +  +  + F + +S+
Sbjct: 53  DSGVKRQLKDRHISLLALGGIIGPGCLIGAGNALAIGGPLALLLGFGIIGILAFIMMESI 112

Query: 146 GEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVP 205
           GEM                    ++ A  GY Y   +    A E + +  I+QFW   VP
Sbjct: 113 GEMITLYPSGGGFTTLTRRFHSDALSAVCGYAYAVVFFAVLANEYNTLSSIMQFWGPQVP 172

Query: 206 LSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPV-G 264
           L  +I+I+W    +  +  V  +GE E+W+A  K++ ++ + I+ +  + G     P  G
Sbjct: 173 LYGYILIFWAAFQVFQLLGVGAFGETEYWLAWFKILGLLTYYIFSIVYISGGVKNRPAFG 232

Query: 265 FRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 324
           F+YW +PG    G          F G  +  +  +  Y GTE V + A E+ NPR+ VP 
Sbjct: 233 FQYWNDPGALSNG----------FKGIANVFVFCSTFYSGTESVALAATESKNPRRAVPI 282

Query: 325 AIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLPHIFN 384
           AI++                   VP++D  L          P  IAI  +G     H+ N
Sbjct: 283 AIRQTFWRILIVYLGISIFYGVTVPYNDENLNFATKVLKS-PIAIAISRAGWPAGVHLVN 341

Query: 385 AVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFL 444
           A IL T ISA N ++Y+GSR +  LA   LAP+    T + GVP  A+   +A G ++ +
Sbjct: 342 AFILITCISAINGSLYIGSRTLTHLANEGLAPKLLAWTDRRGVPIPAITVFNALGLISLM 401

Query: 445 EVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLA 504
            VS     A+N+++N+ GV  F  W +IS+ H+RF +  + +G +RD+LP+KA L P   
Sbjct: 402 NVSVTAVDAYNYIVNLSGVGVFIVWGIISLTHLRFRKAWKLQGHTRDELPYKAKLFPVFP 461

Query: 505 YYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYI 537
             +          QG++ F P F+  +FV AYI
Sbjct: 462 IVSIIANIFLGLVQGWSYFKP-FDAKNFVDAYI 493

>NDAI0C02950 Chr3 (676753..678582) [1830 bp, 609 aa] {ON} Anc_5.158
          Length = 609

 Score =  211 bits (537), Expect = 7e-60,   Method: Compositional matrix adjust.
 Identities = 124/416 (29%), Positives = 199/416 (47%), Gaps = 14/416 (3%)

Query: 86  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSL 145
           +  + ++L  RH                     L + GP   +I ++ ++T +F+V  +L
Sbjct: 89  NENLNKDLSIRHLITLAVGGSIGVGLFVNSGAALASGGPASLVIDWVIISTCLFTVINAL 148

Query: 146 GEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVP 205
           GE+A                  PS+  A    Y   W +   LEL      I++W D + 
Sbjct: 149 GELAAAYPVVGGFNVYITRFVDPSVAFAINLNYLAQWLVLLPLELVAASITIKYWNDTIN 208

Query: 206 LSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVGF 265
             AW+ I++ ++ + NM  VK +GE EF ++ +K++AI+GF I  + + CG G  G    
Sbjct: 209 SDAWVAIFYSVIALANMLDVKSFGETEFVLSMVKILAIIGFTILGIVLACGGGPQGGFLG 268

Query: 266 -RYWRNPGPW---GPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 321
             YW +PG +    PG         +F G  S  + AAF+Y G EL  ++A E+ +PRKT
Sbjct: 269 GHYWHDPGSFVGDKPGT--------QFKGLCSVFVTAAFSYSGIELTAVSAAESKDPRKT 320

Query: 322 VPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX--XXXXXXXXXPFIIAIQNSGTKVL 379
           +P+A K+                   VPFDDP+L            P +I+I+N+G K L
Sbjct: 321 IPKATKRTFWLVTASYVTILTIIGCLVPFDDPRLLNGSSSVDAAASPLVISIKNAGIKGL 380

Query: 380 PHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFG 439
             + NA+IL +I+S  NS +Y  SR M  +A     P+      K G P  A+L T  FG
Sbjct: 381 DSLMNAIILISIVSVANSAVYACSRCMVSMAHIGNLPKVLSRVDKRGRPVNAILSTLFFG 440

Query: 440 ALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPF 495
            L+F+  S   A+ F WL  + G++  F W+ I+ +H+RF   ++ +  + D+LP+
Sbjct: 441 LLSFIAASDKQAEVFTWLSALSGLSTIFCWMAINYSHIRFRAAMKVQNKTLDELPY 496

>TPHA0A04700 Chr1 (1064463..1066172) [1710 bp, 569 aa] {ON}
           Anc_5.158 YGR191W
          Length = 569

 Score =  210 bits (534), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 130/438 (29%), Positives = 209/438 (47%), Gaps = 9/438 (2%)

Query: 73  DEDEPYVDQGVVQDAE-VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAY 131
           D D  + +    +  E + ++L  RH                   T L   GP   +I +
Sbjct: 61  DSDSLHGNNVAFEYGENLNKDLDIRHLLTLAIGGSIGTGLFVNSGTSLNTGGPASLIIGW 120

Query: 132 LFMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELS 191
           + +++ +F+V  +LGE+A                  PS   A    Y   W ++  LEL 
Sbjct: 121 VIISSALFTVINALGELAATFPIVGGFNVYMTRFVDPSFAFAVNLNYLILWIVSLPLELV 180

Query: 192 VVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCL 251
                I++W   +   AW+ I++  + ++NM  VKF+ E EF ++ IK++AI+GF I  +
Sbjct: 181 AASITIRYWNREINSDAWVTIFFVFIALLNMMDVKFFSEAEFVMSIIKILAIVGFFILGI 240

Query: 252 CM-VCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGI 310
            + V G    G +G +YW +PG +         A  RF G  S  + AAF+Y G E+  +
Sbjct: 241 VLAVGGGPTGGYIGGKYWNDPGAF-----HGDSAGSRFKGLCSVFVIAAFSYSGVEMTAV 295

Query: 311 TAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXX--XXXXXXXXPFI 368
           +A E+ NPRKT+P+A K+                   VP++D +L            P +
Sbjct: 296 SAAESKNPRKTIPKATKRTFWVITFSYISILTLIGILVPYNDKRLLSGSSSVDASASPLV 355

Query: 369 IAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVP 428
           IAI+N+G K LP + NA+IL  ++S  NS +YV SRVM  +A T   P+ F    K G P
Sbjct: 356 IAIENAGIKGLPSLMNAIILIALLSVANSCVYVCSRVMVSMALTNTLPKVFSKVDKRGRP 415

Query: 429 YIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGI 488
             ++  T   G L+F+  S    + F WL  I G++  F W+ I++AH+RF   L+ +  
Sbjct: 416 LYSIFATLFVGLLSFIAASDKQEEVFTWLSAICGLSTIFCWIGINLAHIRFRAALKFQNR 475

Query: 489 SRDDLPFKAALMPWLAYY 506
           S D+L + +    W ++Y
Sbjct: 476 SLDELAYISQSGIWGSWY 493

>KLTH0F04048g Chr6 (359492..361243) [1752 bp, 583 aa] {ON} weakly
           similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative
           proline-specific permease
          Length = 583

 Score =  210 bits (535), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 142/521 (27%), Positives = 226/521 (43%), Gaps = 18/521 (3%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           Q+ +V R+LK RH                     L   GP   LI+Y+ M+  V+ +   
Sbjct: 63  QEHQVARKLKSRHIQLIALGGAIGTGLFIGSGGALSVCGPAPLLISYMIMSFFVWCIMNF 122

Query: 145 LGEMAXXX--XXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTD 202
           L EM                       +    G   +++ ++    E++    +IQ+WTD
Sbjct: 123 LTEMVCMMPISGETSMFAMTGTYLNKPLSFMCGINLFYAMSMIAPSEITATAILIQYWTD 182

Query: 203 AVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGP 262
           A   + +I I+  +   + M PV F+GE EFWV+ IK+  I G +I  + +  G      
Sbjct: 183 ANS-AIFISIFIVVTVSLTMLPVHFFGESEFWVSIIKLFCITGLVILGIVIFFGGAPNQD 241

Query: 263 --VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGT-ELVGITAGEAANPR 319
             +GF YW++PG + P ++      G+FL   +++I + F+Y    E+V   A EA +PR
Sbjct: 242 KVLGFHYWKHPGAFNPHLVPGNT--GKFLACWTAIIKSGFSYVLVPEVVVSCAAEAKDPR 299

Query: 320 KTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXX----XXXXPFIIAIQNSG 375
           + +PR  ++                   V +D+ +L              PF+I IQ  G
Sbjct: 300 RNMPRVAQRFVYRLALFYVCGSLTIGIMVGYDNSRLLNAIAAGESNAAASPFVIGIQEVG 359

Query: 376 TKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFT 435
            +VLPHI NA IL++  S G S +Y  SRV+  +A     P+ F  T + G PY +    
Sbjct: 360 IRVLPHIINACILTSAYSCGTSVLYGASRVLHSMAVNGAVPKIFATTNRFGTPYYSTAAA 419

Query: 436 SAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPF 495
           S F  LA+L  S   +  F WL NI  ++GF  W+L+ + ++RF + +EH  ++ D +PF
Sbjct: 420 SVFCLLAYLNCSDSSSVVFTWLSNIATISGFVDWMLVCVVYLRFRKVIEHANLT-DKMPF 478

Query: 496 KAALMPWLAYYAXXXXXXXXXXQGFTAF-APTFNGSDFVAAYIXXXXXXXXXXXXQLYFR 554
           +   M  LAY +           G+  F A  +N SDF A Y              +Y++
Sbjct: 479 RKRFMKPLAYLSCGFFAILSLTNGYAVFVADNWNVSDFFACYTTLGLAAVLYIGAAIYYK 538

Query: 555 CKLYWSLDEVXXXXXXXXXXXXXWEDS----APKTFWDRFW 591
                 LDEV              E       PK + ++ W
Sbjct: 539 TIKLRDLDEVAAEIIPKIAMADEEEKGEVPIVPKNWLEKVW 579

>YCL025C Chr3 complement(76018..77919) [1902 bp, 633 aa] {ON}
           AGP1Low-affinity amino acid permease with broad
           substrate range, involved in uptake of asparagine,
           glutamine, and other amino acids; expression is
           regulated by the SPS plasma membrane amino acid sensor
           system (Ssy1p-Ptr3p-Ssy5p)
          Length = 633

 Score =  211 bits (537), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 129/445 (28%), Positives = 212/445 (47%), Gaps = 8/445 (1%)

Query: 89  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEM 148
           +K+ ++ RH                   T L +AGP G LI Y  M +I++ + Q+ GEM
Sbjct: 116 LKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEM 175

Query: 149 AXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLS 207
           A                      G A  ++Y   W     LEL      I++WT +V   
Sbjct: 176 ALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPD 235

Query: 208 AWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCM-VCGAGVTGPVGFR 266
            +++I++ ++  +N+F  + Y E EF+    K++ + GF I  + + V GAG  G +G +
Sbjct: 236 VFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGFIGGK 295

Query: 267 YWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAI 326
           YW +PG +     + + A  RF G  ++L+ AAF + G+E + IT  E +NPRK +P A 
Sbjct: 296 YWHDPGAF-----NGKHAIDRFKGVAATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAA 350

Query: 327 KKVSXXXXXXXXXXXXXXXXXVPFD-DPKLXXXXXXXXXXPFIIAIQNSGTKVLPHIFNA 385
           K++                  VP++ D  L          P++IA+ + G +V+PH  NA
Sbjct: 351 KQMIYRILFLFLATIILLGFLVPYNSDQLLGSTGGGTKASPYVIAVASHGVRVVPHFINA 410

Query: 386 VILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLE 445
           VIL +++S  NS+ Y  +R+   L++   AP+ F    + G P IA+  ++ F  +AF  
Sbjct: 411 VILLSVLSMANSSFYSSARLFLTLSEQGYAPKVFSYIDRAGRPLIAMGVSALFAVIAFCA 470

Query: 446 VSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAY 505
            S    + F WLL I G++  F W  I ++H+RF + ++ +G S  +L FK+    W + 
Sbjct: 471 ASPKEEQVFTWLLAISGLSQLFTWTAICLSHLRFRRAMKVQGRSLGELGFKSQTGVWGSA 530

Query: 506 YAXXXXXXXXXXQGFTAFAPTFNGS 530
           YA          Q + A AP   G 
Sbjct: 531 YACIMMILILIAQFWVAIAPIGEGK 555

>Suva_3.189 Chr3 complement(285493..287394) [1902 bp, 633 aa] {ON}
           YCL025C (REAL)
          Length = 633

 Score =  211 bits (537), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 130/445 (29%), Positives = 210/445 (47%), Gaps = 8/445 (1%)

Query: 89  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEM 148
           +K+ ++ RH                   T L +AGP G LI Y  M +I++ + Q+ GEM
Sbjct: 116 LKKTIQPRHVLMIALGTGIGTGLLVGNGTALVHAGPAGLLIGYAIMGSILYCIIQACGEM 175

Query: 149 AXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLS 207
           A                      G A  ++Y   W     LEL      I++WT +V   
Sbjct: 176 ALVYSNLTGGYNAYPSFLVDDGFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTSVNPD 235

Query: 208 AWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCM-VCGAGVTGPVGFR 266
            +++I++ ++  +N+F  + Y E EF+    K++ + GF I  + + V GAG  G +G +
Sbjct: 236 VFVIIFYVLVITINIFGARGYAEAEFFFNCCKILMMTGFFILGIIIDVGGAGNDGYIGGK 295

Query: 267 YWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAI 326
           YW  PG +     +   A  RF G V++L+ AAF + G+E + IT  E +NPRK +P A 
Sbjct: 296 YWHEPGAF-----NGVHAIDRFKGVVATLVTAAFAFGGSEFIAITTAEQSNPRKAIPGAA 350

Query: 327 KKVSXXXXXXXXXXXXXXXXXVPFD-DPKLXXXXXXXXXXPFIIAIQNSGTKVLPHIFNA 385
           K++                  VP++ D  L          P++IAI + G +V PH  NA
Sbjct: 351 KQMIYRILFLFLATIIIVGFLVPYNSDQLLGSSGGGTKASPYVIAIASHGVRVAPHFVNA 410

Query: 386 VILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLE 445
           VIL +++S  NS+ Y  +R+   L++   AP+ F    + G P IA+  ++ F  +AF  
Sbjct: 411 VILLSVLSMANSSFYSSARLFLTLSEQGYAPKIFSYIDRAGRPLIAMCVSALFAVIAFCA 470

Query: 446 VSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAY 505
            S    + F WLL I G++  F W  I ++H+RF + ++ +G S  +L FK+    W + 
Sbjct: 471 ASPKEDQVFTWLLAISGLSQLFTWTAICLSHIRFRRAMKVQGRSLGELGFKSQTGVWGSI 530

Query: 506 YAXXXXXXXXXXQGFTAFAPTFNGS 530
           Y+          Q + A AP   G 
Sbjct: 531 YSCIMMILILIGQFWVAIAPIGEGK 555

>Kpol_2002.44 s2002 complement(89144..90370,90372..91028) [1884 bp,
           627 aa] {ON} complement(89144..90370,90372..91028) [1884
           nt, 628 aa]
          Length = 627

 Score =  211 bits (536), Expect = 1e-59,   Method: Compositional matrix adjust.
 Identities = 137/453 (30%), Positives = 211/453 (46%), Gaps = 9/453 (1%)

Query: 76  EPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMA 135
           EP  +   V+D  +K+ +K RH                   + L  AGP G +  Y  M 
Sbjct: 98  EPEAEMASVED-NLKQTIKPRHVIMISLGTGIGTGLLVGNGSALVKAGPAGLVTGYAIMG 156

Query: 136 TIVFSVTQSLGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVG 194
           T V+ + QS GEMA                   P           F+     +  +    
Sbjct: 157 TCVYCIIQSAGEMAVVYSKLNGGFNAYPTMLVEPGFWVCCRLGVLFTMVDCLSFGIGYCF 216

Query: 195 QIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCM- 253
              ++WT  V    ++VI++ ++ ++N+F  + Y E EF+    KV+ + GF I  + + 
Sbjct: 217 DDYKYWTTRVDPDVFVVIFYVLIIVINVFGARGYAEAEFFFNCCKVLMMAGFFILGIIIN 276

Query: 254 VCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAG 313
           V GAG  G +G  YWRNPG +             F G V++L+ AAF + GTE + +TA 
Sbjct: 277 VGGAGNDGYLGNIYWRNPGAF-----RGDKGIDHFKGVVATLVTAAFAFGGTEFIALTAA 331

Query: 314 EAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXX-XXXXXXXPFIIAIQ 372
           E +NPRK +P A KKV                  VPF  P+L           P++IA+ 
Sbjct: 332 EQSNPRKAIPSAAKKVLYRIVLVYLTSIILIGFLVPFTSPELLGSGSAATAASPYVIAVA 391

Query: 373 NSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAV 432
           + G +V+PH  NAVIL +++S GNS  Y  SR++  L+K   AP+WF    + G P  A+
Sbjct: 392 SHGVRVVPHFINAVILLSVLSVGNSAFYSSSRLLLSLSKQGYAPKWFDYVDREGRPSRAM 451

Query: 433 LFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDD 492
           + ++ FG +AF   S    + F WLL I G++  F W+ I ++H+RF   ++ +G S  +
Sbjct: 452 IVSALFGVIAFCATSPKETEVFTWLLAISGLSQIFTWISICLSHIRFRAAMKAQGRSMGE 511

Query: 493 LPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP 525
           + FKA    W +YY+          Q + A AP
Sbjct: 512 VGFKAQTGIWGSYYSIFLMILTLIGQFWVAIAP 544

>KLTH0A00308g Chr1 (23428..25053) [1626 bp, 541 aa] {ON} weakly
           similar to uniprot|P53388 Saccharomyces cerevisiae
           YPL265W Dicarboxylic amino acid permease, mediates
           high-affinity and high-capacity transport of L-
           glutamate and L-aspartate
          Length = 541

 Score =  209 bits (531), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 134/457 (29%), Positives = 220/457 (48%), Gaps = 17/457 (3%)

Query: 73  DEDEPYVDQGVVQD--AEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIA 130
           + +EP  ++GV+ +    +K+ LK+RH                     LK AGP G  +A
Sbjct: 34  NANEP--EEGVLYNDRTRLKQGLKERHIKMLTLVGVFGTGLFLSSGGTLKKAGPAGMFLA 91

Query: 131 YLFMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFAL-- 188
           Y+ +  +V     ++ E+A                   S+G      + F W  T++   
Sbjct: 92  YVVVGIVVGCNQIAIAEVASFMPATGATIRHAEQFIDESVG------FTFGWISTYSSLM 145

Query: 189 --ELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGF 246
             ELS    ++++WTD  P + WI I+  +  + N++ ++FYGE E++   +K+I I+  
Sbjct: 146 PGELSATAVVMRYWTDINP-AVWITIFGILFVLTNIYTIRFYGEVEYFFGWMKIILIIIL 204

Query: 247 LIYCLCMVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTE 306
           ++  L +  G      +GF YWR PGP+   I+  ++  G+F+G+ ++L +  ++Y G +
Sbjct: 205 IVTGLVIDLGGAKQERLGFHYWREPGPFAEYIVKGEI--GKFVGFWAALSSVVYSYSGIQ 262

Query: 307 LVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXP 366
            + I AGE  N R  +    + V                  VP++D  +          P
Sbjct: 263 NIAILAGETKNSRHAIFHGARNVFLRIIVLYLIAVLVLTLIVPYNDKLIATGTGTAKSSP 322

Query: 367 FIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHG 426
           ++IAIQ +  K+LPHI NA+IL++  SAGN  I  GSR +F LA    AP+ F  T K G
Sbjct: 323 YVIAIQRANIKILPHIINAIILTSAWSAGNLAIVEGSRNLFALASKNQAPKIFLTTNKRG 382

Query: 427 VPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHR 486
           +PY+ + F SAF  L+++ VSS  A  F+W   +V       W+LIS  H+   + L+ +
Sbjct: 383 IPYVGIAFISAFLPLSYMSVSSSSANVFSWFQELVSSNTLLRWILISANHIHMDRALKAQ 442

Query: 487 GISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAF 523
           G SR DLP    L P+ A+++           GF  F
Sbjct: 443 GYSRSDLPHSTCLGPFAAWFSGIMSLIFLLTGGFYNF 479

>NCAS0A10680 Chr1 complement(2127039..2128820) [1782 bp, 593 aa]
           {ON} 
          Length = 593

 Score =  210 bits (534), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 129/442 (29%), Positives = 205/442 (46%), Gaps = 8/442 (1%)

Query: 87  AEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLG 146
           + +K+ +K RH                  ++ L   GP   +I Y+ ++ + + + Q+ G
Sbjct: 73  SHLKKAMKSRHVIMMCVGTGIGTGLLVANASGLSYGGPGSLVIGYVLVSFVTYFMIQAAG 132

Query: 147 EMAXXXXXX-XXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVP 205
           EMA                      G A  ++++  W   F LEL      I++W D + 
Sbjct: 133 EMAVAYPTLPGNFNSYTSMFISKPFGFATVWLFFIQWLTVFPLELITASLTIKYWNDKIN 192

Query: 206 LSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGPVG 264
              +IVI++  L  ++ F VK YGE EF   S KV+ I GF+I  + + CG AG  G +G
Sbjct: 193 ADVFIVIFYVFLLFIHFFGVKAYGEAEFIFNSCKVLMIAGFIILSIVINCGGAGKDGYIG 252

Query: 265 FRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPR 324
            +YWR+PG +  G      +  +F G    L+ A F+Y G EL  ++  E  NPRK+ P+
Sbjct: 253 AKYWRDPGSFAEG-----DSVEKFKGICYILVTAYFSYGGAELFSLSVNEQENPRKSTPQ 307

Query: 325 AIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX-XXXXXXPFIIAIQNSGTKVLPHIF 383
           A K+                   VP ++ +L           P+++A    G KV+PH  
Sbjct: 308 AAKQSIYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPYVLAASIHGVKVVPHFI 367

Query: 384 NAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAF 443
           NAVIL ++IS  NS +Y   R+M  LA+   AP++     + G P  A++  + FG + F
Sbjct: 368 NAVILISVISVANSALYASPRLMCSLAEQGYAPKFLDYVDREGRPLRALILCAVFGVIGF 427

Query: 444 LEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWL 503
           +  SS   + F WL  I G++  F W  I ++HVRF Q ++  G S +++ F+A    W 
Sbjct: 428 VSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHVRFRQCMKLHGRSEEEIGFRAVTGIWG 487

Query: 504 AYYAXXXXXXXXXXQGFTAFAP 525
           + Y           Q + A AP
Sbjct: 488 SMYGISFNMLVFIAQFWVALAP 509

>SAKL0D02970g Chr4 (245449..247254) [1806 bp, 601 aa] {ON}
           uniprot|Q875S5 Saccharomyces kluyveri BAP2
          Length = 601

 Score =  210 bits (534), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 138/453 (30%), Positives = 208/453 (45%), Gaps = 9/453 (1%)

Query: 81  QGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFS 140
             V  +++ K+ +K RH                     L   GP G LI Y  ++ + + 
Sbjct: 74  NSVRSNSKFKQSMKSRHVVMMSLGTGIGTGLLVANGKSLHFGGPAGLLIGYSLVSVVAYI 133

Query: 141 VTQSLGEMAXXXXXX-XXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQF 199
           + Q+ GEMA                    S G A  ++Y   W     LEL      I++
Sbjct: 134 MMQAAGEMAVAYPTLPGNFNVYSSIFISKSFGFATVWLYCLQWLTVLPLELITASLTIKY 193

Query: 200 WTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGV 259
           W  ++   A+I I++ ++  ++ F    YGE EF  ++ KV  I GF+I  + + CG   
Sbjct: 194 WNSSINPDAFIAIFYAVIVFIHFFGAAGYGEAEFIFSTCKVSMIAGFIILSIVINCGGAG 253

Query: 260 TGPVGF-RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 318
           TG      YWRNPG +  G   S +  G F G    L+ A F+Y G EL  +T  E ANP
Sbjct: 254 TGGYIGGEYWRNPGAFAGG---SPI--GHFKGIAYVLVTAYFSYGGMELFALTVNEQANP 308

Query: 319 RKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX--XXXXXXPFIIAIQNSGT 376
           RK VP A KK                   VP++  +L            P++IA+ + G 
Sbjct: 309 RKAVPSATKKCIYRILIIYMLTMILIGFLVPYNSDELMGSSGKSATHASPYVIAVASHGV 368

Query: 377 KVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTS 436
           KV+PHI NAVIL +++S GNS +Y   R++  LA+   AP+ F    + G P +A++  S
Sbjct: 369 KVVPHIINAVILISVVSVGNSAMYSAPRLLNSLAEQGYAPKIFSYVDRAGRPLVALVGCS 428

Query: 437 AFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFK 496
            FG L+F+  S    + F WL  I G++  F W  I ++HVRF   ++++G S  +L +K
Sbjct: 429 IFGLLSFVAASDKEEQVFTWLAAIAGLSELFTWSAICLSHVRFRDAMKYQGYSLSELGYK 488

Query: 497 AALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNG 529
           +    W + YA          Q + A AP  NG
Sbjct: 489 SKTGYWGSIYAIFFNIIVFVAQFWVALAPIGNG 521

>Suva_2.716 Chr2 complement(1256781..1258592) [1812 bp, 603 aa] {ON}
           YKR039W (REAL)
          Length = 603

 Score =  210 bits (534), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 142/455 (31%), Positives = 220/455 (48%), Gaps = 11/455 (2%)

Query: 89  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEM 148
           +K  LK RH                     L+ AGP G LI +    T+++S+  ++GE+
Sbjct: 87  LKHTLKSRHLHMIAVGGAIGTGLFVGSGKALRTAGPAGILIGWTVTGTMIYSMVMAVGEL 146

Query: 149 AXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW-TDAVPLS 207
           A                   S G A  + Y   W IT  LE+      + +W  DA    
Sbjct: 147 AVVFPVSGGFTTYATRFIDESFGFAINFNYMLQWLITLPLEIVSASITVNYWGVDAKYRD 206

Query: 208 AWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVGF-R 266
            ++ ++W    I+N+F VK YGE EF  A IKV+ I+GF+I  + ++CG G  G     +
Sbjct: 207 GFVALFWVFTVIINLFGVKGYGEAEFVFAIIKVVTIIGFIIMAVILICGGGPVGGYIGAK 266

Query: 267 YWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAI 326
           YW +PG +         A  +F G+ +  I A+F++ G+E+VG+   E+ NPRK+VP A 
Sbjct: 267 YWHHPGAF-----VGDTAGQKFKGFCTVFITASFSFGGSEVVGVAGSESENPRKSVPGAA 321

Query: 327 KKVSXXXXXXXXXXXXXXXXXVPFDDPKLX-XXXXXXXXXPFIIAIQNSGTKVLPHIFNA 385
           K+V                  VP++D +L           PF+IA+ N G + LP + N 
Sbjct: 322 KQVFWRITLFYVLCLLLIGMLVPYNDKRLIGASSVDAAASPFVIAVVNQGIRGLPSVINV 381

Query: 386 VILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLE 445
           VIL +++S GNS+IY+ SR +  LA+    P+      ++G P +A+   SAFG +AF+ 
Sbjct: 382 VILISVLSVGNSSIYLCSRTLTALAEQGFLPKIVAYIDRNGRPLVAIGIASAFGLIAFVA 441

Query: 446 VSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAY 505
            SS   + FNWLL + G++  F+W  I I H+RF + L  +G S D+LPF + +    +Y
Sbjct: 442 ESSHEGEVFNWLLALSGLSSLFSWSAICICHIRFRRALVAQGRSTDELPFVSTVGIAGSY 501

Query: 506 YAXXXXXXXXXXQGFTAFAP---TFNGSDFVAAYI 537
           +           Q +    P   + N  DF  AY+
Sbjct: 502 WGIFICVLMLIAQFYVGLFPAGASPNAKDFFMAYL 536

>NDAI0A05620 Chr1 (1268907..1270622) [1716 bp, 571 aa] {ON} 
          Length = 571

 Score =  209 bits (532), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 129/454 (28%), Positives = 207/454 (45%), Gaps = 12/454 (2%)

Query: 81  QGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFS 140
           + +V    +K+ +K RH                  +  L  +GP   +I Y+ ++ + + 
Sbjct: 45  RSIVTKTHLKKAMKSRHVVMMSIGTGIGTGLLVANAKGLYFSGPASLIIGYVLVSFVTYF 104

Query: 141 VTQSLGEMAXXXXXX-XXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQF 199
           + Q+ GEMA                      G A  ++++  W   F LEL      +++
Sbjct: 105 MIQAAGEMAVAYPTLPGSFNSYTSTFISKPFGFATVWLFFIQWLTVFPLELITASLTVKY 164

Query: 200 WTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AG 258
           W D +    +I+I++  L  ++ F VK YGE EF   S KV+ + GF+I  + + CG AG
Sbjct: 165 WNDKINADVFIIIFYAFLLFIHFFGVKAYGETEFIFNSCKVLMVAGFIILSIVINCGGAG 224

Query: 259 VTGPVGFRYWRNPGPW--GPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAA 316
             G +G +YW +PG +  GP I        RF G    L++A F+Y G EL  ++  E  
Sbjct: 225 TDGYIGAKYWHDPGSFADGPPIT-------RFKGVCFILVSAYFSYGGAELFSLSVNEQE 277

Query: 317 NPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFD-DPKLXXXXXXXXXXPFIIAIQNSG 375
           NPRK+ P A K+                   VP + D  +          P+++A     
Sbjct: 278 NPRKSTPAAAKQSIYRILIIYLATMILIGFNVPHNSDELMGAGSAATHASPYVLAASLHS 337

Query: 376 TKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFT 435
            KV+PH  NAVIL ++IS  NS +Y   R+M  LA+   AP++     + G P   ++  
Sbjct: 338 VKVVPHFINAVILISVISVANSALYAAPRLMCSLAEQGYAPKFLNYVDREGRPLRGLILC 397

Query: 436 SAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPF 495
           + FG + F+  SS   + F WL  I G++  F W  I ++H+RF Q ++  G S D++ F
Sbjct: 398 ALFGVIGFVSASSKEEEVFTWLAAIAGLSELFTWSGIMLSHIRFRQAMKFNGKSTDEIGF 457

Query: 496 KAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNG 529
           KA    W +YY           Q + A +P  +G
Sbjct: 458 KAVTGIWGSYYGCAFNILVFIAQFWVALSPPGSG 491

>AGR039C Chr7 complement(779720..781480) [1761 bp, 586 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 586

 Score =  209 bits (532), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 130/457 (28%), Positives = 209/457 (45%), Gaps = 9/457 (1%)

Query: 73  DEDEPYVDQGVVQDAE-VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAY 131
           D +    D G+ +  + +K  +K RH                     L   GP G +I Y
Sbjct: 51  DLEGKDADNGLNKTQQTLKHNIKTRHLTMISLGTGIGTGLLVASGKALHFGGPAGLVIGY 110

Query: 132 LFMATIVFSVTQSLGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALEL 190
           +  +T+++ V Q+  E+                       G A   +Y   WA    LEL
Sbjct: 111 VTTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDKGFGFAVALVYGLQWATVLPLEL 170

Query: 191 SVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYC 250
                 +++WT +V    ++ I++  L  ++ F  + Y E EF   S+KV+ + GF+I  
Sbjct: 171 VTASMTVKYWTSSVNPDVFVAIFYVFLLFIHFFGSRGYAEAEFIFNSLKVLLMAGFIIMA 230

Query: 251 LCMVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGI 310
           + +  GA   G +G +YW +PG +G        A  RF G  S  + AAF Y G+E + +
Sbjct: 231 ISLTAGASEQGYIGGQYWHDPGAFG-----GDRAIDRFKGICSVWVQAAFAYGGSEFIAL 285

Query: 311 TAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX--XXXXXXPFI 368
           TA E ANPR++VP+A K+                   VP +  +L            PF+
Sbjct: 286 TAAEQANPRESVPKATKRWLYRVVVVFLLPVILIGFLVPHNSDQLLSAEGGSGSRASPFV 345

Query: 369 IAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVP 428
           IA    G +V+PHI N +IL+++IS GNS +Y   R++  LA+  + P+ F    + G P
Sbjct: 346 IAAALHGVRVVPHIINFIILTSVISVGNSAMYSAPRILLSLAEHGMCPKIFTYVDRQGRP 405

Query: 429 YIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGI 488
            + ++F S FG +AF+  S+     F WL  I G++  F W  I+++HVRF + +  +G 
Sbjct: 406 LVTLIFVSLFGLIAFVAASNQEENVFTWLSAIAGLSQLFTWTAIAVSHVRFRRAMRVQGR 465

Query: 489 SRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP 525
           S  +L ++A      +YYA          Q + A AP
Sbjct: 466 SLGELGYRANTGALGSYYAIFFNVIVLIAQFWIAIAP 502

>KLTH0C05170g Chr3 (449510..451306) [1797 bp, 598 aa] {ON} similar
           to uniprot|P38084 Saccharomyces cerevisiae YBR068C BAP2
           High-affinity leucine permease functions as a
           branched-chain amino acid permease involved in the
           uptake of leucine isoleucine and valine contains 12
           predicted transmembrane domains and to YDR046C
           uniprot|P41815 Saccharomyces cerevisiae YDR046C BAP3
           Amino acid permease involved in the uptake of cysteine,
           leucine, isoleucine and valine
          Length = 598

 Score =  209 bits (533), Expect = 2e-59,   Method: Compositional matrix adjust.
 Identities = 131/452 (28%), Positives = 206/452 (45%), Gaps = 9/452 (1%)

Query: 81  QGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFS 140
           Q  + D  ++R ++ RH                     L+  GP G +I Y  ++ + + 
Sbjct: 71  QTDLTDGRLRRSIRPRHVAMMSVCTGIGTGLLVANGKSLRYGGPGGLIIGYAAVSVVAYI 130

Query: 141 VTQSLGEMAXXXXXX-XXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQF 199
           + Q+ GEMA                      G A+ ++Y   W   F LEL      I++
Sbjct: 131 MMQAAGEMAVAYPSMPGNFNAYSSVFISKPFGFASVWLYCLQWLTVFPLELITASLTIKY 190

Query: 200 WTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AG 258
           WTD+V    +I I++  +  ++ F  + YGE EF     KV+ I GF+I  + + CG AG
Sbjct: 191 WTDSVNADVFIAIFYVFILFIHFFGSRGYGESEFIFGLCKVLMIAGFVILAIVINCGGAG 250

Query: 259 VTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 318
            +G +G RYW +PG +  G  +S     +F G+   L+   F+Y GTEL  +T  E ++P
Sbjct: 251 NSGYIGARYWHDPGAFAVGDPAS-----KFKGFCYVLVTGYFSYGGTELYAMTVNEQSSP 305

Query: 319 RKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXX--XXXXXXXPFIIAIQNSGT 376
           R+ +  A K+                   VP    +L            P+++A+   G 
Sbjct: 306 RRAIHSATKQCIYRILVIYMLTMVLIGFLVPHTSDELMGSGGKSATHASPYVLAVSLHGV 365

Query: 377 KVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTS 436
           KV+PHI NAVIL  ++S GNS +Y G RV+  LA+   AP++     + G P +A++  S
Sbjct: 366 KVVPHIVNAVILIAVVSVGNSAMYSGPRVLNALAEQGYAPKFLAYIDRAGRPLMALIACS 425

Query: 437 AFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFK 496
             G LAF+  S      F WL  I G++  F W  I ++H+RF Q +++ G S   L +K
Sbjct: 426 VIGLLAFVAASDHEEDVFTWLAAIAGLSELFTWSAILLSHIRFRQAMKYHGYSLSQLGYK 485

Query: 497 AALMPWLAYYAXXXXXXXXXXQGFTAFAPTFN 528
           +    W + Y           Q + A AP  N
Sbjct: 486 SITGLWGSIYGVCFNILVFVAQFWVALAPIGN 517

>NCAS0B08580 Chr2 complement(1646220..1648103) [1884 bp, 627 aa]
           {ON} Anc_1.50
          Length = 627

 Score =  209 bits (533), Expect = 4e-59,   Method: Compositional matrix adjust.
 Identities = 138/468 (29%), Positives = 218/468 (46%), Gaps = 10/468 (2%)

Query: 74  EDEPYVDQGVVQDA-EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           E +P  +     DA E+K+ +K RH                   T L N+GP G +I Y 
Sbjct: 93  EGKPRTEPEKDDDARELKKTIKPRHVVMISLGTGIGTGMLVGNGTSLANSGPAGLVIGYA 152

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELS 191
            M + ++ + Q+ GE+A                   P+ G A  ++Y   W     LEL 
Sbjct: 153 IMGSCIYCIIQATGELAVLYTKLTGGFNAYPSMLIDPAFGFAVAWVYCIQWLCVCPLELV 212

Query: 192 VVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFP-VKFYGEFEFWVASIKVIAIMGFLIYC 250
                I++WT  V    ++VI++ ++  +N+      Y E EF+  S K++ + GF I  
Sbjct: 213 TASMTIKYWTTKVDPDVFVVIFYCLILCINVLGGAAGYAEAEFFFNSFKILMLTGFFILG 272

Query: 251 LCMVCG-AGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVG 309
           + ++CG AG  G +G R W NPG +            RF G VS+L+NAAF +  +E +G
Sbjct: 273 IVVICGGAGNDGYIGTRLWHNPGSF-----RGDKPVDRFKGVVSTLVNAAFAFGMSEFLG 327

Query: 310 ITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFD-DPKLXXXXXXXXXXPFI 368
           +TA E +NPRK +P A KK+                  VP+D D  L          P++
Sbjct: 328 VTASEQSNPRKAIPSAAKKMLYRIICIYLGSVTIVGFLVPYDSDQLLGSSGAATKASPYV 387

Query: 369 IAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVP 428
           +AI   G +V+PH  NAVIL +++S GNS  Y  SR +  L++   AP +     ++G P
Sbjct: 388 LAISLHGVRVVPHFINAVILLSVLSVGNSAFYSSSRQLLSLSQLGYAPSFLNYVDRNGRP 447

Query: 429 YIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGI 488
             A   ++  G +AF   S    + F WLL I G++  F W  I ++H+RF + +  +G 
Sbjct: 448 LKAYCVSALVGVIAFCATSPKEDQVFVWLLAISGLSQLFTWFSICLSHLRFRRAMRVQGR 507

Query: 489 SRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAY 536
           S  ++ FK+ +  + + Y+          Q +TA  P   G   V A+
Sbjct: 508 SMGEVGFKSQVGIYGSLYSCVMMVLILIAQFWTALVPVGEGKPDVQAF 555

>TBLA0G03120 Chr7 (825095..827116) [2022 bp, 673 aa] {ON} 
          Length = 673

 Score =  210 bits (534), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 124/425 (29%), Positives = 201/425 (47%), Gaps = 7/425 (1%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           +D   K  +K RH                  +  L  +GP G ++ Y  ++ + + V Q+
Sbjct: 150 EDMPKKGGMKARHVIMMTLATGIGTGLLVANAKSLHFSGPAGLVVGYFMVSFVTYFVVQA 209

Query: 145 LGEMAXXXXXX-XXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
            GEMA                      G A  +++  +W     LEL      +++WT +
Sbjct: 210 AGEMAIAYPTLPGGFNTYQSLFISKPFGFATVWIFALNWLTILPLELITSSITVKYWTTS 269

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGP 262
           +    +++I++  L  ++   ++ Y E EF+  S K++ I GF+I+ + + CG AG  G 
Sbjct: 270 INPDIFVLIFYLFLLFVHFIGLRLYAEAEFFFNSCKILMITGFIIFSIVVNCGGAGHDGY 329

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
           +G +YW +PGP+     +S     RF      LINA F+Y GTEL  ++  E  NPRK V
Sbjct: 330 IGGKYWHDPGPF-----ASDNGAARFKEVCYVLINAYFSYGGTELYVLSVNEQENPRKAV 384

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLPHI 382
           P A K                    VP++ P L          P+++A Q  G K++PH 
Sbjct: 385 PVAAKTSVYRVAIIYLLTMILIGFNVPYNSPDLMGNANSKDASPYVLAAQIHGVKIVPHF 444

Query: 383 FNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALA 442
            NAVIL ++IS  NS ++ G R++  LA+   AP++     + G P +A+   S FG +A
Sbjct: 445 INAVILLSVISVANSALFAGPRLLATLAEQGFAPKFLTYVDRAGRPLLALCVCSLFGVIA 504

Query: 443 FLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPW 502
           F   S    + F WL  I G++  FAW  I ++H+RF   +++ G S D++ +KA    W
Sbjct: 505 FAATSKKEDEVFTWLAAIAGLSELFAWSGILLSHIRFRWAMKYHGKSMDEVGYKAITGIW 564

Query: 503 LAYYA 507
            +YY 
Sbjct: 565 GSYYG 569

>Smik_2.201 Chr2 complement(355785..357614) [1830 bp, 609 aa] {ON}
           YBR068C (REAL)
          Length = 609

 Score =  209 bits (531), Expect = 6e-59,   Method: Compositional matrix adjust.
 Identities = 130/452 (28%), Positives = 204/452 (45%), Gaps = 8/452 (1%)

Query: 81  QGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFS 140
           Q    D+++K+ +K RH                  +  L   GP   +I Y+ ++ I + 
Sbjct: 83  QSFTSDSKLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLHYGGPAALVIGYVLVSFITYF 142

Query: 141 VTQSLGEMAXXXXXX-XXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQF 199
           + Q+ GEMA                      G A  ++Y F W     LEL      IQF
Sbjct: 143 MIQAAGEMAVTYPTLPANFNAYSSIFISKPFGFATVWLYCFQWTTVLPLELITASMTIQF 202

Query: 200 WTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AG 258
           W D +    +I+I++  L  ++ F VK YGE EF     K++ I GF++  + + CG AG
Sbjct: 203 WNDKINPDIYILIFYVFLLFVHFFGVKAYGETEFIFNCCKILMIAGFIVLSVVINCGGAG 262

Query: 259 VTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 318
             G +G  YW  PG +     +   +  RF      L+ A F++ G EL  ++  E  NP
Sbjct: 263 NDGYIGGAYWHKPGAF-----AGDTSIARFKNVCYILVTAYFSFGGMELFVLSVQEQTNP 317

Query: 319 RKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPF-DDPKLXXXXXXXXXXPFIIAIQNSGTK 377
           RK+ P A K+                   VP+ DD  L          P+++A    G +
Sbjct: 318 RKSTPVAAKRSIYRIVVIYLLTMILIGFNVPYNDDQLLGAGGSATHASPYVLAASIHGVR 377

Query: 378 VLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSA 437
           ++PHI NAVIL +++S  NS++Y G R++  LA+   AP++     + G P  A++    
Sbjct: 378 IVPHIINAVILISVVSVANSSLYAGPRLICSLAQQGYAPKFLDYVDREGRPLRALIVCCV 437

Query: 438 FGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKA 497
            G +AF+  SS     F WL  I G++  F W  I ++H+RF Q ++ +G S ++L +KA
Sbjct: 438 IGVIAFVAASSKEEIVFTWLAAIAGLSELFTWTSIMLSHLRFRQAMKVQGRSLNELGYKA 497

Query: 498 ALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNG 529
               W + Y           Q + A AP  NG
Sbjct: 498 TTGIWGSIYGSFFNILVFIAQFWVALAPLGNG 529

>SAKL0D04664g Chr4 complement(365852..367633) [1782 bp, 593 aa] {ON}
           highly similar to uniprot|P19145 Saccharomyces
           cerevisiae YKR039W GAP1 General amino acid permease;
           localization to the plasma membrane is regulated by
           nitrogen source
          Length = 593

 Score =  208 bits (529), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 142/458 (31%), Positives = 218/458 (47%), Gaps = 11/458 (2%)

Query: 86  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSL 145
           ++ +KR LK RH                     L+ AGP G LI +    T+++ +  ++
Sbjct: 74  NSPLKRHLKNRHLQMIAIGGAIGTGLFVGSGKALRTAGPAGILIGWALTGTMIYCMVMAM 133

Query: 146 GEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW-TDAV 204
           GE+A                   S G AN + Y   W +   LE+      + +W TD  
Sbjct: 134 GELAVTFPVSGGFTTYATRFIDESFGYANNFNYMLQWLVVLPLEIVAASITVNYWGTDPK 193

Query: 205 PLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVG 264
               ++ +++ ++  +NMF VK YGE EF  + IKVI ++GF+I  + +VCG G  G   
Sbjct: 194 YRDGFVALFYVVIVSINMFGVKGYGEAEFVFSFIKVITVIGFIILGIILVCGGGPVGGYI 253

Query: 265 FR-YWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 323
               W NPG +         A  RF G  S  + AAF++ G+ELVG+ + E ANPRK++P
Sbjct: 254 GGANWHNPGAF-----VGNTAGKRFKGVCSVFVTAAFSFAGSELVGLASAETANPRKSLP 308

Query: 324 RAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX-XXXXXXXXXPFIIAIQNSGTKVLPHI 382
           RA K+V                  VP++D +L           PF++AI+N G K LP +
Sbjct: 309 RAAKQVFWRITLFYIISLCLIGLLVPYNDTRLIGASSVDAAASPFVLAIKNHGIKGLPSV 368

Query: 383 FNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALA 442
            N VIL  ++S GNS ++  SR +  LA+    P+ FG   + G P + + FTS FG L+
Sbjct: 369 VNVVILIAVLSVGNSAVFGCSRTLTALAEQGFLPKIFGYIDRKGRPLVGIGFTSFFGLLS 428

Query: 443 FLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPW 502
           F+  S    + F+WLL + G++  F W+ I I H+RF + L  +G S D+L F +    W
Sbjct: 429 FIAASPKEGEVFDWLLALSGLSSLFTWMAICICHLRFRRALSAQGRSTDELSFVSPAGVW 488

Query: 503 LAYYAXXXXXXXXXXQGFTAFAPTF---NGSDFVAAYI 537
            + Y           Q + A  P     +  DF  +Y+
Sbjct: 489 GSIYGTVLIMLILAAQFWIALFPIGSPPDAKDFFESYL 526

>TPHA0A00240 Chr1 complement(28756..30567) [1812 bp, 603 aa] {ON}
           Anc_5.158 YGR191W
          Length = 603

 Score =  208 bits (530), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 135/489 (27%), Positives = 221/489 (45%), Gaps = 13/489 (2%)

Query: 84  VQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQ 143
           +  + + ++L  RH                     L   GP   +I +  ++T +F+V  
Sbjct: 81  IHTSNMNQDLNVRHLITLAVGGAIGTGLFVNSGASLNTGGPASLVIGWTIVSTALFTVIN 140

Query: 144 SLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
           SLGE+A                  PS   +    Y   W +   LEL      I++W D 
Sbjct: 141 SLGELAAAYPVVGGFNVYMTRFVDPSFAFSVNLNYLVQWLVLLPLELVAASLTIRYWDDT 200

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPV 263
           +   AW+ I++ ++ I N+  VK +GE EF ++ +K++AI+GF I  + + CG G  G  
Sbjct: 201 INSDAWVAIFYTLILIANLLDVKSFGETEFILSLVKILAIIGFFILGIVLTCGGGPKGGY 260

Query: 264 GF-RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
              +YW +PG +         A  +F G  S  + AAF+Y G E++ ++A E+ NPRKT+
Sbjct: 261 IGGKYWHDPGAF-----VGDSAGTQFKGLCSVFVTAAFSYAGIEMIAVSAAESQNPRKTI 315

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX--XXXXXXXXXPFIIAIQNSGTKVLP 380
           P A K+                   V ++D +L            P +IAI+N G K LP
Sbjct: 316 PTAAKRTFWIITFSYITILTLVGCLVAYNDTRLLNGSSSVDVAASPLVIAIENGGIKGLP 375

Query: 381 HIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGA 440
            + NA+IL  I+S  NS +Y  SR M  +A     P+   +  K G P  A+  T  FG 
Sbjct: 376 SLMNAIILIAILSVANSAVYACSRCMVSMALIGNLPKGLSVVDKRGRPLRAIFTTLFFGL 435

Query: 441 LAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALM 500
           L+F+  S    + F WL  + G++  F W+ I+IAH+RF Q +  +  S D++P+ +   
Sbjct: 436 LSFVAASDKQEEVFTWLSALSGLSTIFCWMGINIAHIRFRQAMTVQNRSLDEMPYLSQTG 495

Query: 501 PWLAYYAXXXXXXXXXXQGFTAFAPT-FNGSD---FVAAYIXXXXXXXXXXXXQLYFRC- 555
            + +YY             +T+  P   +G+D   F   Y+            +LYF+  
Sbjct: 496 IYGSYYGTAILFLVLIASFWTSLFPLGGDGADAEAFFEGYLSFPILIACYIGHKLYFKNW 555

Query: 556 KLYWSLDEV 564
           ++   L+E+
Sbjct: 556 RIMTPLEEI 564

>Smik_4.284 Chr4 complement(515341..517155) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  208 bits (530), Expect = 8e-59,   Method: Compositional matrix adjust.
 Identities = 132/462 (28%), Positives = 215/462 (46%), Gaps = 11/462 (2%)

Query: 74  EDEPYVDQG---VVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIA 130
           ED+  ++ G   +  +  +K+ +K RH                  +  LK AGP   +I 
Sbjct: 68  EDDNDLEDGTRSMKSNNRLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIG 127

Query: 131 YLFMATIVFSVTQSLGEMAXXXXXX-XXXXXXXXXXXXPSIGAANGYMYWFSWAITFALE 189
           Y+ ++ + + + Q+ GEM                     S G A  +++   W     LE
Sbjct: 128 YVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWIFCIQWLTVLPLE 187

Query: 190 LSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIY 249
           L      I++W D +    +IVI++  L  ++ F VK YGE EF  +S K++ I GF+I 
Sbjct: 188 LITSSMTIKYWNDKINSDVFIVIFYVFLLFIHFFGVKAYGETEFIFSSCKILMIAGFIIL 247

Query: 250 CLCMVCG-AGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELV 308
            + + CG AGV G +G +YWR+PG +  G  ++     RF G    L+ A F++ G EL 
Sbjct: 248 SVVINCGGAGVDGYIGGKYWRDPGSFAEGNGAT-----RFKGICFILVTAYFSFGGIELF 302

Query: 309 GITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXX-XXXXXXXPF 367
            ++  E +NPRK+ P A K+                   VP ++ +L           P+
Sbjct: 303 VLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHASPY 362

Query: 368 IIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGV 427
           ++A      +V+PHI NAVIL ++IS  NS +Y   R+M  LA+   AP++     + G 
Sbjct: 363 VLAASIHKVRVVPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLDYIDREGR 422

Query: 428 PYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRG 487
           P  A+      G + F+  S    +AF WL  I G++  F W  I ++H+RF + ++ +G
Sbjct: 423 PLRALFVCCLVGVIGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQG 482

Query: 488 ISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNG 529
            S D++ +KA    W +YY           Q + A +P  NG
Sbjct: 483 RSLDEVGYKANTGIWGSYYGVFFNILVFMAQFWVALSPIGNG 524

>SAKL0D02926g Chr4 (240708..242459) [1752 bp, 583 aa] {ON}
           uniprot|Q875S6 Saccharomyces kluyveri TAT1
          Length = 583

 Score =  207 bits (528), Expect = 9e-59,   Method: Compositional matrix adjust.
 Identities = 124/442 (28%), Positives = 205/442 (46%), Gaps = 15/442 (3%)

Query: 88  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGE 147
           ++K+ +K RH                     L  AGP G +I Y   + +++ + Q+ GE
Sbjct: 69  KMKKSIKSRHLLMISLGTGIGTGLLVGNGKALAKAGPAGLVIGYAVASIMLYCIIQAAGE 128

Query: 148 MAXXXXXXX-XXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPL 206
           +                    P++G +  ++Y   W     L+L      +++WT+A P 
Sbjct: 129 LGICYSGMAGNYTAYSSLLVDPALGFSVSWVYCVQWMTVLPLQLVTAAMTVRYWTNANP- 187

Query: 207 SAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGPVGF 265
             ++ +++ ++ ++NMF  K Y E EF     KV+ I GF+I  + + CG AG +G +G 
Sbjct: 188 DIFVAVFFVVIMVINMFGAKGYAEAEFLFNICKVLMIAGFVILGIAINCGGAGTSGYIGA 247

Query: 266 RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRA 325
           +YW +PG +  G          F G       AAF+Y G E++ +TA E  NPRK++P A
Sbjct: 248 KYWHSPGSFAAG----------FKGVCYVFCYAAFSYGGIEVMVLTASEQENPRKSIPNA 297

Query: 326 IKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX--XXXXXXPFIIAIQNSGTKVLPHIF 383
            KKV                  VP++  +L            P +IA+ + G K++PHI 
Sbjct: 298 CKKVIYRILMIYMLTTIIVCFLVPYNSSELMGSSGESASHASPLVIAVASHGVKIVPHII 357

Query: 384 NAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAF 443
           NAVIL ++IS GNS++Y   R++  L++   AP++     + G P I    T     +AF
Sbjct: 358 NAVILISVISVGNSSMYSAPRLLLSLSEQGYAPKFLNYVDRQGRPLICFAITLLVALIAF 417

Query: 444 LEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWL 503
           +  S      F WLL I G++  F W  I ++HVRF   +  +G+S   + +K+    W 
Sbjct: 418 VAASDAEEDIFAWLLAISGLSQIFIWTSICLSHVRFRDAMHAQGLSLGQIGYKSQTGYWG 477

Query: 504 AYYAXXXXXXXXXXQGFTAFAP 525
           +++A          Q + A AP
Sbjct: 478 SWFAIVISVLVLIAQFWVAIAP 499

>Kpol_2000.92 s2000 (208509..210422) [1914 bp, 637 aa] {ON}
           (208509..210422) [1914 nt, 638 aa]
          Length = 637

 Score =  209 bits (531), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 128/449 (28%), Positives = 213/449 (47%), Gaps = 8/449 (1%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           +  ++K+ +K RH                     L  AGP   +I Y  M T ++ + Q+
Sbjct: 116 KSEDLKKTIKPRHVIMISLGTGIGTGLLVGNGPVLSKAGPAALVIGYAIMGTCLYCIIQA 175

Query: 145 LGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
            GE+A                   P++G +  ++Y   W     LEL      I++WT  
Sbjct: 176 AGELAVVYSDLNGGFNAYPSFLVDPALGFSVAWVYCLQWLCVCPLELVTASMTIKYWTTK 235

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGP 262
           V    ++VI++ ++  +N F  + Y E EF+    KV+ + GF I  + +  G AG  G 
Sbjct: 236 VDPDVFVVIFYVLIIAINTFGARGYAEAEFFFNCCKVLMMTGFFILGIIITAGGAGNDGY 295

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
           +G +YW +PG +     +   +  RF G + + + AAF +  TE + +TA E +NPRK +
Sbjct: 296 LGAKYWHDPGAF-----NGDKSIDRFKGVMDTFVTAAFAFGATEFIALTAAEQSNPRKAI 350

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFD-DPKLXXXXXXXXXXPFIIAIQNSGTKVLPH 381
           P A KKV                  VP++ D  L          P++IA+ + G +V+PH
Sbjct: 351 PSAAKKVLYRIVCIFLASITLIGFLVPYNSDQLLGSGGSGIKASPYVIAVSSHGVRVVPH 410

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
             NAVIL +++S GNS  Y  SR++  LA+   AP+WF    + G P+ A+L ++ FG +
Sbjct: 411 FINAVILLSVLSVGNSAFYSSSRLLLSLAQQGYAPKWFDYVDREGRPFRAMLMSALFGVI 470

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
           AF   S    + F+WLL I G++  F W+ I ++H+RF + ++ +G S  ++ + +    
Sbjct: 471 AFCATSPKETEVFSWLLAISGLSQLFTWITICVSHIRFRRAMQVQGRSLGEVGYLSQSGV 530

Query: 502 WLAYYAXXXXXXXXXXQGFTAFAPTFNGS 530
           + + YA          Q + A AP   G 
Sbjct: 531 YGSAYAAIMLFLALIAQFWVAIAPIGEGK 559

>KLTH0H13398g Chr8 complement(1169665..1171428) [1764 bp, 587 aa]
           {ON} similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 587

 Score =  207 bits (527), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 137/490 (27%), Positives = 220/490 (44%), Gaps = 22/490 (4%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           D  +P +D G      +K+ LK RH                     L   GP+  +I + 
Sbjct: 58  DSFKPPLD-GSFHSDNLKKSLKARHLIMIAIGGSIGTGLFIGSGKALAVGGPLALIIGWT 116

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
              T +      LGE+                   PSI      +Y   W     LE+  
Sbjct: 117 VAGTQMVGTIHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIA 176

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
               +++W  +VP  AW+ I++  + ++N+  V+ +GE EF  + IKV+ I+GF+I C+ 
Sbjct: 177 AAMTVEYWGSSVPPVAWVAIFYAFIALVNLLGVRGFGEAEFIFSLIKVLTIIGFIILCVV 236

Query: 253 MVCGAGVTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
           ++CG G     VG +YW +PGP   G          F G  +  + A+++  GTE+  + 
Sbjct: 237 LICGGGPKHEFVGAKYWSDPGPLANG----------FKGVAAVFVIASYSLGGTEMACLA 286

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAI 371
           +GE  +P K +P AIK+V                  VP+ +  L          PF+IAI
Sbjct: 287 SGET-DP-KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLMGGSSVDNS-PFVIAI 343

Query: 372 QNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIA 431
           +  G K LP + NAVIL +++S GNS I+  SR +  +A   L PR FG   + G P + 
Sbjct: 344 RLHGIKALPSVVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRIFGYIDRAGRPLVG 403

Query: 432 VLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRD 491
           +L   AFG LAFL  SS     F WL+ I G+A    WL I+++H+RF   ++ +G+S D
Sbjct: 404 ILTNLAFGLLAFLVKSSSSDDVFTWLMAIAGLATCVVWLSINVSHIRFRMAMKAQGVSLD 463

Query: 492 DLPFKAALMPWLAYYAXXXXXXXXXXQGFTAF-------APTFNGSDFVAAYIXXXXXXX 544
           +L F +A+  + + Y+          Q + +        +P+    +F   Y+       
Sbjct: 464 ELEFVSAVGVYGSVYSATINVLILVAQFYVSLWPVGGWSSPSTRTENFFQNYLCSLILLL 523

Query: 545 XXXXXQLYFR 554
                ++Y+R
Sbjct: 524 LFAGHKIYYR 533

>YDR046C Chr4 complement(548762..550576) [1815 bp, 604 aa] {ON}
           BAP3Amino acid permease involved in the uptake of
           cysteine, leucine, isoleucine and valine
          Length = 604

 Score =  207 bits (528), Expect = 1e-58,   Method: Compositional matrix adjust.
 Identities = 130/462 (28%), Positives = 213/462 (46%), Gaps = 10/462 (2%)

Query: 73  DEDEPYVD--QGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIA 130
           +ED    D  + +  +  +K+ +K RH                  +  L  AGP   +I 
Sbjct: 68  EEDNDLEDGTKSMKSNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLSLAGPGSLVIG 127

Query: 131 YLFMATIVFSVTQSLGEMAXXXXXX-XXXXXXXXXXXXPSIGAANGYMYWFSWAITFALE 189
           Y+ ++ + + + Q+ GEM                     S G A  +++   W     LE
Sbjct: 128 YVMVSFVTYFMVQAAGEMGVTYPTLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLE 187

Query: 190 LSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIY 249
           L      +++W D +    +IVI++  L  ++ F VK YGE EF   S K++ + GF+I 
Sbjct: 188 LITSSMTVKYWNDTINADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIIL 247

Query: 250 CLCMVCG-AGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELV 308
            + + CG AGV G +G +YWR+PG +  G         RF G    L++A F++ G EL 
Sbjct: 248 SVVINCGGAGVDGYIGGKYWRDPGSFAEG-----SGATRFKGICYILVSAYFSFGGIELF 302

Query: 309 GITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX-XXXXXXPF 367
            ++  E +NPRK+ P A K+                   VP ++ +L           P+
Sbjct: 303 VLSINEQSNPRKSTPVAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGGSATHASPY 362

Query: 368 IIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGV 427
           ++A      +V+PHI NAVIL ++IS  NS +Y   R+M  LA+   AP++     + G 
Sbjct: 363 VLAASIHKVRVIPHIINAVILISVISVANSALYAAPRLMCSLAQQGYAPKFLNYIDREGR 422

Query: 428 PYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRG 487
           P  A++  S  G + F+  S    +AF WL  I G++  F W  I ++H+RF + ++ +G
Sbjct: 423 PLRALVVCSLVGVVGFVACSPQEEQAFTWLAAIAGLSELFTWSGIMLSHIRFRKAMKVQG 482

Query: 488 ISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNG 529
            S D++ +KA    W +YY           Q + A +P  NG
Sbjct: 483 RSLDEVGYKANTGIWGSYYGVFFNMLVFMAQFWVALSPIGNG 524

>Skud_15.138 Chr15 (245592..247370) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  207 bits (527), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 136/502 (27%), Positives = 225/502 (44%), Gaps = 24/502 (4%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           D  +P +D G    + +KR LK RH                     +   GP+G ++ + 
Sbjct: 63  DSFKPPLD-GSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWT 121

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
              + +      LGE+                   PSI      +Y   W     LE+  
Sbjct: 122 IAGSQIIGTVHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIA 181

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
               +Q+W  ++    W+ I++ ++  +N+F  + +GE EF  +++K I + GF+I C+ 
Sbjct: 182 AAMTVQYWNSSIDPVIWVAIFYAVIVSINLFGARGFGEAEFAFSTVKAITVGGFIILCIV 241

Query: 253 MVCGAGVTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
           ++CG G     +G +YW +PG    G          F G +S L+ A+++  G E+  + 
Sbjct: 242 LICGGGPDHEFIGAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGIEMTCLA 291

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAI 371
           +GE  +P K +P AIK+V                  VP+ +  L          PF+IAI
Sbjct: 292 SGET-DP-KGLPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSSVDNS-PFVIAI 348

Query: 372 QNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIA 431
           +    KVLP I NAVIL +++S GNS I+  SR +  +A   L P WFG   + G P + 
Sbjct: 349 KLHHIKVLPSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVG 408

Query: 432 VLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRD 491
           ++  S FG LAFL  S   ++ FNWL+ I G+A    WL I+++HVRF   ++ +G S D
Sbjct: 409 IMANSLFGLLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHVRFRLAMKAQGKSLD 468

Query: 492 DLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP-------TFNGSDFVAAYIXXXXXXX 544
           +L F +A+  W + Y+          Q + +  P             F   Y+       
Sbjct: 469 ELEFVSAVGIWGSVYSALINCLILIAQFYCSLWPIGGWTSSKERAKIFFQNYLCALIMVF 528

Query: 545 XXXXXQLYFRCKL--YWSLDEV 564
                ++Y+RC++  +W + E+
Sbjct: 529 IFVIHKIYYRCQMGKWWGVKEL 550

>Ecym_2663 Chr2 complement(1278309..1280078) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR039C
          Length = 589

 Score =  207 bits (526), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 128/456 (28%), Positives = 204/456 (44%), Gaps = 8/456 (1%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           +  E Y         ++K  +K RH                     L   GP G LI YL
Sbjct: 55  EGQEEYATGLNKTQQKLKHNIKTRHLTMISLGTGIGTGLLVASGKALHYGGPGGLLIGYL 114

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELS 191
             +T+++ V Q+  E+                       G A   +Y   WAI   LEL 
Sbjct: 115 TTSTMLYCVVQACCELGVAYATLPGNYNAYPTFLVDRGFGFAVALVYGLQWAIVLPLELV 174

Query: 192 VVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCL 251
                I++WT++V    ++ I++  +  ++ F  + Y E EF   ++KV+ + GF+I  +
Sbjct: 175 TASMTIKYWTESVNPDVFVAIFYLFIVFIHFFGSRGYAESEFIFNTLKVLLMAGFIIMGI 234

Query: 252 CMVCGAGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
            + CGA   G +G +YW NPG +     + + +     G  S  + +AF Y G+E + +T
Sbjct: 235 SLNCGASKLGYIGAKYWSNPGTF-----AGERSINHLKGICSVWVQSAFAYGGSEFIALT 289

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXX--PFII 369
           A E ANPR++VP A K+                   VP+   +L            PF+I
Sbjct: 290 AAEQANPRESVPSATKRWLYRVVVVFLIPIALICFLVPYTSDQLLSSSGASASHASPFVI 349

Query: 370 AIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPY 429
           A    G K++PHI NA+IL+++IS GNS +Y   R++  LA+  L P+ F    + G P 
Sbjct: 350 AAAYHGVKIVPHIINAIILTSVISVGNSGMYSAPRILLSLAENGLCPKIFTYVDRAGRPL 409

Query: 430 IAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGIS 489
             +LF   FG L+F+  S      F WL  I G++  F W  I+++H+RF   ++ +G S
Sbjct: 410 ATLLFVCVFGLLSFVAASKNQESVFTWLTAIAGLSQLFTWTSIALSHIRFRAAMKVQGRS 469

Query: 490 RDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP 525
             +L + +      +YYA          Q + A AP
Sbjct: 470 LGELGYTSTTGAIGSYYAVFFNIVVLVAQFWIAIAP 505

>KAFR0C00400 Chr3 (83280..85028) [1749 bp, 582 aa] {ON} 
          Length = 582

 Score =  206 bits (525), Expect = 2e-58,   Method: Compositional matrix adjust.
 Identities = 130/458 (28%), Positives = 210/458 (45%), Gaps = 11/458 (2%)

Query: 86  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSL 145
           D  +K+ +K RH                  +  L   GP   +I Y+ ++ + + + Q+ 
Sbjct: 63  DRHLKKAMKSRHVIMMTLGTGVGTGLLVANAKGLSYGGPGALVIGYILVSFVTYFMIQAA 122

Query: 146 GEMAXXXXXX-XXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAV 204
           GEMA                     +G A  +++   W     LEL      IQ+W D++
Sbjct: 123 GEMAVTYPTLPGSFNTYTSTFISKPVGFATVWLFLIQWLTVLPLELITGTMTIQYWNDSI 182

Query: 205 PLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCM-VCGAGVTGPV 263
               WIVI++  L  +++F VK YGE EF   + K++ I GF+I+ + +   GAG  G +
Sbjct: 183 NADVWIVIFYVFLLCVHVFGVKAYGELEFIFNTCKILFIGGFIIFSIVVNAGGAGTDGYI 242

Query: 264 GFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 323
           G +YW+NPG +     +S  + GRF      L+ A F+Y GTEL  ++  E ANPR++ P
Sbjct: 243 GAKYWKNPGSF-----ASSTSAGRFKDVCYVLVTAYFSYGGTELYVLSVNEQANPRRSTP 297

Query: 324 RAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX-XXXXXXPFIIAIQNSGTKVLPHI 382
           +A K+                   VP D+ +L           P+++A    G KV+PHI
Sbjct: 298 KAAKQSIYRILIIYLLTMILIGFNVPHDNDQLMGAGGSSTHASPYVLAASIHGVKVVPHI 357

Query: 383 FNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALA 442
            NAVIL  + S GNS++Y   R+   LA+   AP+      + G P IA+   +  G +A
Sbjct: 358 INAVILICVTSMGNSSLYAAQRLFASLAEQGYAPKCLAYIDREGRPIIALAACAVVGVIA 417

Query: 443 FLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPW 502
           F   SS   + F WL  I  ++  F W  I ++H+RF   ++ +G   ++L +KA    W
Sbjct: 418 FAAASSQEEQVFTWLAAIAALSELFTWSTILLSHIRFRMAMKVQGKDLNELGYKALTGVW 477

Query: 503 LAYYAXXXXXXXXXXQGFTAFAP---TFNGSDFVAAYI 537
            + +           Q + A +P   T +   F  +Y+
Sbjct: 478 GSMWGFGFCVLVFIAQFWVALSPPGGTISAEGFFESYL 515

>KLLA0C01606g Chr3 complement(123485..125347) [1863 bp, 620 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p-Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 620

 Score =  207 bits (526), Expect = 4e-58,   Method: Compositional matrix adjust.
 Identities = 121/425 (28%), Positives = 203/425 (47%), Gaps = 8/425 (1%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           + A +KR++K RH                     L   GP G  I Y  M + ++S+ Q+
Sbjct: 98  KGASLKRDIKPRHVVMMSLATGIGTGLLVGNGKALATGGPAGLTIGYAIMGSCLYSIIQA 157

Query: 145 LGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
            GE+A                   P++  A   +Y   W   F LE+      I++W  +
Sbjct: 158 AGELAVAYPTLTGNFNNYPSFLVDPAMCFATAALYCIQWLCVFPLEVISAAITIKYWNTS 217

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGP 262
           +  + W VI++ ++  +NM     Y E +F+  + K++   GF I  + + CG AG +  
Sbjct: 218 INPNVWCVIFYVMIIGINMCGSAGYAEADFFFNTCKILMFAGFFILGIIINCGGAGDSVY 277

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
           +G +YW +PG +     +      RF   VS+L+ AAF +  +E V +TA E ANPRK +
Sbjct: 278 IGGKYWNDPGAF-----NGDTGISRFKAIVSTLVTAAFAFGASEAVALTASEQANPRKAI 332

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXX-PFIIAIQNSGTKVLPH 381
           P A K+V                  VP++ P+L           P++IA+ + G KV+P 
Sbjct: 333 PSAAKQVLYRIIAIYLASIILVGFLVPYNSPELMGSGSSSVHSSPYVIAVASHGVKVVPS 392

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
             NAVIL +++S GN + Y  SR++  L++   AP++F    + G P  A++  +  G +
Sbjct: 393 FINAVILISVLSVGNFSFYSSSRILLCLSEIGYAPKFFQYVDRQGRPLYAMIVGALVGCI 452

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
            F+  SS     F WL+ + G++  F W  I I+HVRF + ++ +  S  +L F++ +  
Sbjct: 453 CFVSASSAEESVFTWLMAVSGLSQLFTWTNICISHVRFRKAMQVQNRSIGELGFRSQVGV 512

Query: 502 WLAYY 506
           W +YY
Sbjct: 513 WGSYY 517

>NCAS0B07900 Chr2 (1500061..1501920) [1860 bp, 619 aa] {ON}
           Anc_1.244
          Length = 619

 Score =  206 bits (525), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 133/414 (32%), Positives = 202/414 (48%), Gaps = 10/414 (2%)

Query: 86  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSL 145
            A ++  LK R                   ST L+  GP G +I +   +T+++S+  +L
Sbjct: 100 KAPLQHTLKGRQQTMIAIGGAIGSGLFVGSSTALRTGGPAGLIIGWGLTSTMIYSMVMAL 159

Query: 146 GEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW-TDAV 204
           GE+A                   S G AN + Y   W +   LE+      + +W T   
Sbjct: 160 GELAVVFPVAGGFTTYATRFVDESFGYANNFNYALQWLVVLPLEIVSASITVNYWGTPTR 219

Query: 205 PLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVG 264
               ++ ++W ++ I+NMF VK +GE EF  + IKV  ++GF+I  + +VCG G  G   
Sbjct: 220 YRDGFVALFWLVIVIINMFGVKGFGEAEFVFSIIKVTTVIGFIILGIVLVCGGGPKGGFV 279

Query: 265 F-RYWRNPGPW-GPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
             +YW +PG + G G      +  +F G  S  + AAF++ G+EL+GITA EAANPRK++
Sbjct: 280 GAKYWHDPGAFVGHG------SGAQFKGVCSVFVTAAFSFAGSELIGITAAEAANPRKSI 333

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX-XXXXXXXXXPFIIAIQNSGTKVLPH 381
           P A K+V                  VP++D +L           PF+IAI   G K LP 
Sbjct: 334 PGAAKQVVWRIVLFYMGTLTMIGLLVPYNDKRLIGASSVDAAASPFVIAIVTHGIKGLPS 393

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
           + N VIL  ++S GNS I+  SR +  L+     P+ FG   + G P + +  TS FG L
Sbjct: 394 VINVVILIAVLSVGNSAIFACSRTIAALSDQGFLPKVFGYIDRSGRPLVGIAITSTFGLL 453

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPF 495
           AF+  S    + FNWLL + G++  F W  I + H+RF   L+ +G   ++L F
Sbjct: 454 AFVAASKKEGEVFNWLLALSGLSSLFTWGGICLCHIRFRMALKAQGRDTNELTF 507

>NCAS0A08920 Chr1 (1765699..1767498) [1800 bp, 599 aa] {ON}
           Anc_1.368
          Length = 599

 Score =  206 bits (524), Expect = 5e-58,   Method: Compositional matrix adjust.
 Identities = 140/499 (28%), Positives = 224/499 (44%), Gaps = 24/499 (4%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           D  +P +D G      +KR LK RH                     +   GP+  +I + 
Sbjct: 70  DSFKPPLD-GSFDTNNLKRSLKARHLIMIAIGGSIGTGLFVGSGQAIATGGPLAVVIGWA 128

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
              + +      LGE+                   PS+      +Y   W     LE+  
Sbjct: 129 IAGSQIIGTIHGLGEITVRFPVVGAFANYSTRFLDPSLSFVISTIYVIQWFFVLPLEIIS 188

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
               +Q+W  ++    W+ I++  +  +N+F  + +GE EF  +S+KV+ I GF+I C+ 
Sbjct: 189 SAMTVQYWNQSIDPVVWVAIFYCAIVSINLFGARGFGEAEFVFSSVKVLTICGFIILCIV 248

Query: 253 MVCGAGVTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
           ++CG G     VG +YW +PG    G          F G +S L+ A+++  GTE+V + 
Sbjct: 249 LICGGGPDHDFVGAKYWHDPGCLAHG----------FPGVLSVLVVASYSLGGTEMVCLA 298

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAI 371
           +GE  +P K +P AIK+                   VP+ +  L          PF+IAI
Sbjct: 299 SGET-DP-KELPSAIKQTFWRILFFFLVSLTLIGFLVPYTNENLLGGSSVNNS-PFVIAI 355

Query: 372 QNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIA 431
           +    KVLP I NAVIL +I+S GNS I+  SR +  +A   L PR+FG   + G P   
Sbjct: 356 KLHQIKVLPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLTG 415

Query: 432 VLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRD 491
           ++  S FG LAFL  SS  ++ F+WL+ I G+A    WL I+I+H+RF   ++ +G S D
Sbjct: 416 IITNSLFGLLAFLVKSSSMSEVFDWLMAIAGLATCIVWLSINISHIRFRLAMKAQGRSLD 475

Query: 492 DLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP-------TFNGSDFVAAYIXXXXXXX 544
           +L F +A+  W + Y+          Q + A  P       +     F  +Y+       
Sbjct: 476 ELEFVSAVGIWGSAYSAVINSLILVAQFYCALWPIGGWENSSIRAKKFFQSYLCALIMIV 535

Query: 545 XXXXXQLYFRCKL--YWSL 561
                ++++R K   +WS+
Sbjct: 536 LFVGHKIFYRYKTGKWWSM 554

>KLTH0F01606g Chr6 complement(122821..124635) [1815 bp, 604 aa] {ON}
           similar to uniprot|P48813 Saccharomyces cerevisiae
           YDR508C GNP1 High-affinity glutamine permease also
           transports Leu Ser Thr Cys Met and Asn expression is
           fully dependent on Grr1p and modulated by the
           Ssy1p-Ptr3p- Ssy5p (SPS) sensor of extracellular amino
           acids
          Length = 604

 Score =  206 bits (523), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 139/477 (29%), Positives = 220/477 (46%), Gaps = 12/477 (2%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           +   +K+ +K RH                     L N GP   LI Y  ++T+++ V QS
Sbjct: 83  KHKTLKQNIKPRHVLMISLATGIGTGMLVGNGKSLHNGGPASLLIGYAIVSTMLYCVIQS 142

Query: 145 LGEMAXXXXXXXXXXXXXXXXXXPSIGA-ANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
             E+A                      A +  ++Y   W     LEL      I++W D+
Sbjct: 143 ASELAIIYTSLSGGFNAYPALLVDKAFAFSVSWVYCLQWLCILPLELVTASMTIKYWNDS 202

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGP 262
           +   A++VI++ +L ++N      Y E EF+  + KV+ ++GF I  + + CG AG  G 
Sbjct: 203 INPDAFVVIFYVVLIVINFIGAAGYAEAEFFFNTCKVLMLIGFFILGIIVNCGGAGNDGY 262

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
           +G  YW +PG +            RF G V+ L+NAAF Y G E   +TA E  NP+K++
Sbjct: 263 LGSVYWHDPGAF-----RGNNGINRFKGLVAVLVNAAFAYGGAEFSVLTAAEQQNPQKSI 317

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXX-XXXXXXXPFIIAIQNSGTKVLPH 381
             A KK+                  VP++ P+L           PF+IAI + G KV+PH
Sbjct: 318 RSASKKLVYRIIGIYLMTAALLGFLVPYNSPELLGSGSAATHASPFVIAIASHGVKVVPH 377

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
           I NAVIL +++S  NS +Y  SR++  L++   AP+ F    + G P   +L +  FG L
Sbjct: 378 IINAVILLSVLSVANSALYSSSRILLSLSEQGFAPKLFNYVDRRGRPVRCLLVSCVFGLL 437

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
            F+  S      F WLL I G++  F W  IS++HVRF +++  +G S D+L +++    
Sbjct: 438 CFVAASPKEETVFTWLLAISGLSELFTWFSISLSHVRFRRSMIVQGRSLDELGYQSWTGV 497

Query: 502 WLAYYAXXXXXXXXXXQGFTAFAPT----FNGSDFVAAYIXXXXXXXXXXXXQLYFR 554
           W AYYA          Q + A +P      + ++F   Y+            +L++R
Sbjct: 498 WGAYYAMIMILLILIGQFWVAISPVGSNKLDANNFFENYLAMPILIGLYLGYKLWYR 554

>Suva_11.273 Chr11 (498611..500416) [1806 bp, 601 aa] {ON} YKR039W
           (REAL)
          Length = 601

 Score =  206 bits (523), Expect = 6e-58,   Method: Compositional matrix adjust.
 Identities = 145/479 (30%), Positives = 222/479 (46%), Gaps = 13/479 (2%)

Query: 83  VVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVT 142
           +     +K +LK RH                     L+  GP   LI +  M T+++++ 
Sbjct: 79  ITAQTPLKHQLKNRHLQMIAIGGAIGTGLLVGSGKALRTGGPASLLIGWGSMGTMIYAMV 138

Query: 143 QSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW-T 201
            +LGE+A                   S G A  + Y   W +T  LE+      + +W T
Sbjct: 139 MALGELAVVFPISGGFTTYATRFIDESFGFAANFNYMLQWLVTLPLEIVSASITVNYWGT 198

Query: 202 DAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAG-VT 260
           D      ++ ++W ++  +NMF VK YGE EF  + IKVI I+GF+I  + + CG G   
Sbjct: 199 DPKYRDGFVALFWLVIVCINMFGVKGYGEAEFVFSIIKVITIIGFIILGIILNCGGGPEK 258

Query: 261 GPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 320
           G +G +Y+ +PG +     +      +F G  S  + AAF++ G+ELVG+ A E+ +PRK
Sbjct: 259 GYIGGKYFHDPGAF-----AGDTPGAKFKGVCSVFVTAAFSFAGSELVGLAASESVDPRK 313

Query: 321 TVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX-XXXXXXXXXPFIIAIQNSGTKVL 379
           +VP+A K+V                  VP++D +L           PF+IAI   G K L
Sbjct: 314 SVPKAAKQVFWRITLFYILSLLMIGLLVPYNDSRLIGASSVDAAASPFVIAIVTHGIKGL 373

Query: 380 PHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFG 439
           P + N VIL  ++S GNS I+  SR    LA+    P+ F    + G P + ++ TSA G
Sbjct: 374 PSVVNVVILIAVLSVGNSAIFACSRTFVALAEQGFLPQIFAYVDRKGRPLVGIIITSAVG 433

Query: 440 ALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAAL 499
            +AF+  S+     FNWLL + G++  F W  I I H+RF + L  +G S D+L FK+  
Sbjct: 434 LIAFVAASNKEEDVFNWLLALSGLSSLFTWGGICICHIRFRKALTSQGRSVDELSFKSPT 493

Query: 500 MPWLAYYAXXXXXXXXXXQGFTAFAPTFNGS----DFVAAYIXXXXXXXXXXXXQLYFR 554
             W +Y+           Q + A  P  NGS     F  AY+            ++Y R
Sbjct: 494 GVWGSYWGLFMIVIMFIAQFYVALFPV-NGSPSAEGFFEAYLSFPLVLAMYIGHKIYKR 551

>KAFR0D04130 Chr4 (818573..820507) [1935 bp, 644 aa] {ON} 
          Length = 644

 Score =  206 bits (525), Expect = 8e-58,   Method: Compositional matrix adjust.
 Identities = 128/454 (28%), Positives = 212/454 (46%), Gaps = 10/454 (2%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           +DA +++ ++ RH                   + L  AGP G +I Y  M T ++ + Q+
Sbjct: 123 EDAHLRKSIQPRHVLMSSLATGVGTGLLVGNGSALHKAGPAGLVIGYAIMGTCLYCIIQA 182

Query: 145 LGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
            GEMA                      G A  ++Y   W     LEL      I +WT  
Sbjct: 183 CGEMAVSYSNLPGNFNAYPTFLVDEGFGFAVAWVYCIQWLCVMPLELVTASMTIDYWTTK 242

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCM-VCGAGVTGP 262
           V    ++VI++ ++ ++N+F  K Y E +F+  + KV+ I GF I  + +   GAG +G 
Sbjct: 243 VNNDIFVVIFYVLIILINVFGAKGYAEADFFFNTCKVLMITGFFILAIIINAGGAGTSGY 302

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
           +G +YW +PG +         +  RF   +++   AAF +  +E + I A E +NPR+ +
Sbjct: 303 IGAKYWHDPGAF-----RGDRSIDRFKDVMATFTTAAFAFGASEFIAIGASEQSNPRRAI 357

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXX-XXXXPFIIAIQNSGTKVLPH 381
           P A K +                  VP+D  +L           P+++AI + G +V+PH
Sbjct: 358 PSAAKIMIYRILFIFLSSIALVGFLVPYDSSELMGSGSGGTKASPYVLAISSHGVRVVPH 417

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
             NAVIL  ++S  NS  Y   R++F L++   AP+WF    + G P  A++ +  FG +
Sbjct: 418 FINAVILLAVLSVSNSAFYSSCRILFSLSQQGYAPQWFNYIDREGRPARAMIISILFGII 477

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
           AF   SS   + F WLL I G++  F W+ I ++H+RF + +  +G S  +L F++ L  
Sbjct: 478 AFCACSSKEEEVFTWLLAISGLSQIFTWMAICLSHIRFRRAMHVQGRSISELGFRSQLGV 537

Query: 502 WLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAA 535
           W + YA          + + + AP   G D + A
Sbjct: 538 WGSVYAATMLFLALIAEFWVSIAPI--GEDHLDA 569

>NDAI0A07490 Chr1 complement(1713048..1714838) [1791 bp, 596 aa]
           {ON} 
          Length = 596

 Score =  205 bits (522), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 129/444 (29%), Positives = 199/444 (44%), Gaps = 8/444 (1%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
            D  +K+ +K RH                     L  AGP   ++ Y  ++ + + + Q+
Sbjct: 74  DDDHMKKAMKSRHVIMMTLGTGIGTGLLVANGKGLALAGPAPLVLGYGLVSFVTYFMIQA 133

Query: 145 LGEMAXXXXXX-XXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
            GEMA                      G A  +++   W     LEL      I++W D 
Sbjct: 134 AGEMAVTYPTMPASFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKYWNDT 193

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGP 262
           +    +IVI++  L  ++ F VK YGE EF   S K++ I GF+I  + + CG AG  G 
Sbjct: 194 INPDVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMIAGFIILSIVINCGGAGRDGY 253

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
           +G +YW NPG +     +S+    RF G    L+   F+Y GTEL  ++  E  NPRK+ 
Sbjct: 254 IGNKYWINPGAF-----ASESPAARFKGVAYILVTGYFSYGGTELFSLSVNEQKNPRKST 308

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX-XXXXXXPFIIAIQNSGTKVLPH 381
           P A K+                   VP D  +L           P+++A    G KV+PH
Sbjct: 309 PAAAKQSIYRILIIYLLTMILIGFNVPHDSDQLMGAGGSATHASPYVLAASLHGVKVVPH 368

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
             NAVIL +++S  NS +Y   R+M  LA+   AP+WF    + G P  A+     FG +
Sbjct: 369 FINAVILISVVSVANSALYASPRLMRSLAEQGYAPKWFNYVDREGRPLRALCICGLFGVI 428

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
            F+  S    +AF WL  I G++  F W  I I+H+RF   ++ +G S ++L ++A    
Sbjct: 429 GFVACSPQEEQAFTWLAAIAGLSELFTWSSIFISHIRFRMAMKVQGKSLEELGYRATTGI 488

Query: 502 WLAYYAXXXXXXXXXXQGFTAFAP 525
           W + Y+          Q + A +P
Sbjct: 489 WGSVYSVFFNMLVFIAQFWVALSP 512

>Kwal_33.13204 s33 complement(120622..122445) [1824 bp, 607 aa] {ON}
           YDR508C (GNP1) - high-affinity glutamine permease
           [contig 121] FULL
          Length = 607

 Score =  205 bits (522), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 132/444 (29%), Positives = 208/444 (46%), Gaps = 10/444 (2%)

Query: 86  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSL 145
           + ++K+ +  RH                     L N GP G +I Y  M + ++ + Q+ 
Sbjct: 87  ETKLKQTITFRHVFMMSLGTGIGTGMLVGNGKALHNGGPAGLVIGYAIMGSCLYCIIQAA 146

Query: 146 GEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAV 204
           GE+A                    + G +  ++Y   W     LEL      I++WT +V
Sbjct: 147 GELAVSYSSLSGNFNAYPSMLIEQAFGFSVAWIYCLQWLCVLPLELVTASITIKYWTTSV 206

Query: 205 PLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGPV 263
               ++ I++ ++ ++NMF  + Y E EF+    KV+ I+GF I  + + CG AG  G +
Sbjct: 207 NPDIFVAIFYVLIILVNMFGARGYAEAEFFFNCCKVLMIIGFFILGIIVNCGGAGNDGYI 266

Query: 264 GFRYWRNPGP-WGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
           G RYW NPG  +G   I        F G +S+++ AAF +  TE + +TA E ANPR+ +
Sbjct: 267 GGRYWNNPGAFYGTKPIH------HFKGIISTMVTAAFAFGATEFIALTAAEQANPRRAI 320

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXX-XXXXXXXPFIIAIQNSGTKVLPH 381
           P A KKV                  VP + P+L           P++IA+ + G +V+PH
Sbjct: 321 PSAAKKVVYRILLIFLAPIVLIGFLVPHNSPELMGSGSSATHASPYVIAVASHGVRVVPH 380

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
             NAVIL +++S GNS  Y  SR++  LA    AP W     + G P  A+L +  FG +
Sbjct: 381 FINAVILLSVLSVGNSAFYSSSRLLLALADQHYAPAWLKFIDRSGRPMRAMLVSCVFGLI 440

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
           +F+  S      F WLL I G++  F W+ I ++H+RF + L  +G    +L +K+    
Sbjct: 441 SFVAASPKEETVFTWLLAISGLSQLFTWISICVSHIRFRKALIVQGKPIGELGYKSQTGV 500

Query: 502 WLAYYAXXXXXXXXXXQGFTAFAP 525
             +YYA          Q + A AP
Sbjct: 501 AGSYYATFIMGCILIGQFWVAIAP 524

>Kpol_534.22 s534 (50849..52627) [1779 bp, 592 aa] {ON}
           (50849..52627) [1779 nt, 593 aa]
          Length = 592

 Score =  205 bits (521), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 130/447 (29%), Positives = 203/447 (45%), Gaps = 14/447 (3%)

Query: 80  DQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVF 139
           + G      +K+ LK RH                     L   GP+  +I +    + + 
Sbjct: 69  EDGSFHTGNLKKSLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAVAGSQIV 128

Query: 140 SVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQF 199
                LGE+                   PSI      +Y   W     LE+      +Q+
Sbjct: 129 GTIHGLGEITVRFPVVGAFASYTTRFLDPSISFVVSTIYVLQWFFVLPLEIIASAITVQY 188

Query: 200 WTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGV 259
           W D++    ++ I++ ++  +N+F  + +GE EF  +++K+I I GF+I C+ ++ G G 
Sbjct: 189 WNDSIDPVVFVAIFYCVIVSINLFGARGFGEAEFIFSTVKIITICGFIILCIVLIAGGGP 248

Query: 260 TGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 318
               +G +YW NPG    G          F G +S L+ A+++  GTE+  + +GE  +P
Sbjct: 249 DHEYIGAKYWHNPGSLAHG----------FKGVLSVLVVASYSLGGTEMTCLASGET-DP 297

Query: 319 RKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKV 378
            K +P AIK+V                  VP+ +P L          PF+IAI+    KV
Sbjct: 298 -KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNPNLLGGSSVDNS-PFVIAIKIHNIKV 355

Query: 379 LPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAF 438
           LP I NAVIL +I+S GNS I+  SR +  +A   L P WFG   + G P   ++  S F
Sbjct: 356 LPSIVNAVILVSILSVGNSCIFASSRTLCSMAHQHLIPWWFGYIDRAGRPLTGIIINSLF 415

Query: 439 GALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAA 498
           G LAFL  SS   + F+WL+ I G+A    WL I+I HVRF   ++ +  + D+L F +A
Sbjct: 416 GLLAFLVKSSSVTEVFDWLMAIAGLATCIVWLSINICHVRFRLAMKAQNRTLDELEFVSA 475

Query: 499 LMPWLAYYAXXXXXXXXXXQGFTAFAP 525
           +  W + Y+          Q + A  P
Sbjct: 476 VGIWGSVYSGIVNALILVAQFYIALWP 502

>KNAG0H01150 Chr8 (193585..195438) [1854 bp, 617 aa] {ON} 
          Length = 617

 Score =  205 bits (522), Expect = 1e-57,   Method: Compositional matrix adjust.
 Identities = 127/456 (27%), Positives = 210/456 (46%), Gaps = 8/456 (1%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           D D     +  + ++ +K+ +K RH                  ++ L  +GP   ++AY 
Sbjct: 85  DNDLESGTRSFISESHLKKSMKSRHVVMMTLGTGIGTGLLVANASGLHASGPAPLVLAYG 144

Query: 133 FMATIVFSVTQSLGEMAXXXXXX-XXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELS 191
            ++ + + + Q+ GEMA                      G A  +++   W     LEL 
Sbjct: 145 LVSFVTYFMIQAAGEMAVTYPTLPGNFNSYMSLFVSKPFGFATVWLFLLQWLTVLPLELI 204

Query: 192 VVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCL 251
                I++W D +    ++VI++  L  ++ F V+ YGE EF   S K++ I GF+I+ +
Sbjct: 205 TSSLTIKYWNDKINSDVFVVIFYVFLLFIHFFGVQAYGETEFIFNSCKILMIAGFIIFSI 264

Query: 252 CMVCG-AGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGI 310
            + CG AG  G +G +YW +PG +     +S    GRF G    L+ A F+Y GTEL  +
Sbjct: 265 VVNCGGAGHDGYIGGKYWHDPGAF-----TSHTNIGRFKGICFILVTAYFSYGGTELYVL 319

Query: 311 TAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX-XXXXXXPFII 369
           +  E  NPRK+ P+A K+                   VP D+ +L           P+++
Sbjct: 320 SVNEQENPRKSTPQAAKQSIYRIVVIYLLTMILIGFNVPHDNDQLMGSHGSATHASPYVL 379

Query: 370 AIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPY 429
           A    G +++PH  NAVIL ++IS  NS++Y   R++  LA+   AP++     + G P 
Sbjct: 380 AASIHGVRIVPHFINAVILISVISVANSSLYASPRLLCSLAQQGYAPKFLTYIDRQGRPL 439

Query: 430 IAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGIS 489
            A+   S FG + F   S+   + F WL  I G++  F W  I ++HVRF Q ++ +G  
Sbjct: 440 TALATCSLFGVIGFAAASNQEEQVFTWLAAIAGLSELFTWSGIMLSHVRFRQAMKVQGRD 499

Query: 490 RDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP 525
            ++L +KA    W + Y           Q + A AP
Sbjct: 500 LNELGYKAVSGVWGSVYGVFFNILVFFAQFWVALAP 535

>Ecym_2662 Chr2 complement(1275924..1277693) [1770 bp, 589 aa] {ON}
           similar to Ashbya gossypii AGR038C
          Length = 589

 Score =  204 bits (518), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 128/451 (28%), Positives = 202/451 (44%), Gaps = 8/451 (1%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
              ++K+ +K RH                  ++ L   GP G LI Y F++ I + + Q+
Sbjct: 67  HSTKLKQNMKTRHVVLMSLGTGIGTGLLVANASSLHFGGPGGLLIGYFFVSIISYIMMQA 126

Query: 145 LGEMAXXXXXX-XXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
            GEMA                      G A  +++   W     LEL     ++++WT  
Sbjct: 127 AGEMAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCIQWTTILPLELITSSIVVKYWTTK 186

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGA-GVTGP 262
           +    +++I++  +  ++    + YGE EF   S KV+ + GF+I  + + CGA G  G 
Sbjct: 187 INADIFVLIFYLFILCIHFCGARGYGETEFIFNSCKVLMVAGFIIVGILINCGAVGDDGY 246

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
           +G +YW  PG +  G         RF G    L+ A F+Y G EL  ++  E  NPRK +
Sbjct: 247 IGGKYWHEPGAFAAG-----SGIDRFKGIAYVLVTAYFSYGGMELYALSVNELPNPRKAI 301

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXX-XPFIIAIQNSGTKVLPH 381
           P A  K                   VP D  KL           P+++A+   G K++PH
Sbjct: 302 PSACAKGVYRILIIYMLTMVIIGFLVPHDSNKLLGSGSSGVHPSPYVLALSLHGIKIVPH 361

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
           I NAVIL ++IS GNS +Y G R++  LA+   AP+      + G P +A++  S FG +
Sbjct: 362 IINAVILISVISVGNSAMYSGPRLLCSLAQQGYAPKILDYVDRQGRPLMALIICSVFGLI 421

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
           AF+  S      F WL  I G++  F W  I ++H RF + ++ +G S + L +++    
Sbjct: 422 AFVAASKYEEDIFGWLAAISGLSELFTWTAICLSHFRFRRAMKLQGRSLETLGYRSTTGE 481

Query: 502 WLAYYAXXXXXXXXXXQGFTAFAPTFNGSDF 532
           W + YA          Q + A  P  NG  F
Sbjct: 482 WGSLYAVVFNVFVLIAQLWVAMIPMDNGGKF 512

>KNAG0F00270 Chr6 complement(27784..29688) [1905 bp, 634 aa] {ON}
           Anc_1.50 YDR508C
          Length = 634

 Score =  205 bits (521), Expect = 2e-57,   Method: Compositional matrix adjust.
 Identities = 125/444 (28%), Positives = 218/444 (49%), Gaps = 8/444 (1%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           +++++K+ +K+RH                  +  L++AGP G +I Y  M + ++ + Q+
Sbjct: 113 ENSDLKQTIKKRHVLLISLGTGIGTGLLVGNAKVLRDAGPGGLVIGYSIMGSCLYCIIQA 172

Query: 145 LGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
            GE+A                    + G A  ++Y   W     LEL      I++WT +
Sbjct: 173 CGELAVCYSSLPSNFNIYPTFLVDKAFGFAVAWVYCLQWLCVCPLELVTASMTIKYWTTS 232

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGP 262
           V    ++ I++ ++ ++N F  + Y E EF+  S KV+ + GF I  + + CG AG +G 
Sbjct: 233 VNPDIFVSIFFVLIIVINTFGARGYAEAEFFFNSCKVLMMAGFFILGIIITCGGAGTSGY 292

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
           +G +YW +PG +     +       F G +++   AAF +  +E + +TA E +NPRK +
Sbjct: 293 IGAKYWHSPGAF-----NGNRPIDHFKGVMATFTTAAFAFGASEFISLTAAEQSNPRKAI 347

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXX-XXXXXXXPFIIAIQNSGTKVLPH 381
           P+A K +                  VP++ P L           P+++A+ + G +V+PH
Sbjct: 348 PKAAKMMIYRILFVFLSSITLIGFLVPYNSPYLLGSGSDATKASPYVVAVASHGVRVVPH 407

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
             NAVIL +++S GNS  Y  SR++  LA+   AP+ F    K G P +A++ ++ F  +
Sbjct: 408 FINAVILLSVLSVGNSAFYSSSRLLNSLAQQGYAPKMFTYIDKRGRPLVAMVCSTLFMTI 467

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
           AF   S    + F WLL I G++  F W+ I I+H+RF + L+ +G S  ++ FK+ +  
Sbjct: 468 AFCAASPKEEQVFTWLLAISGLSQLFTWVAICISHLRFRRALKVQGHSLGEIGFKSQVGI 527

Query: 502 WLAYYAXXXXXXXXXXQGFTAFAP 525
           + + YA          Q + A AP
Sbjct: 528 YGSLYAATMLILALIAQFWVALAP 551

>Skud_4.300 Chr4 complement(525086..526900) [1815 bp, 604 aa] {ON}
           YBR068C (REAL)
          Length = 604

 Score =  204 bits (519), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 129/448 (28%), Positives = 207/448 (46%), Gaps = 8/448 (1%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
            +  +K+ +K RH                  +  LK AGP   +I Y+ ++ I + + Q+
Sbjct: 82  SNNHLKKSMKSRHVVMMSLGTGIGTGLLVANAKGLKLAGPGSLVIGYVLVSFITYFMVQA 141

Query: 145 LGEMAXXXXXX-XXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
            GEM                     S G A  +++   W     LEL      I++W D+
Sbjct: 142 AGEMGVAYATLPGNFNAYNSIFISKSFGFATTWLFCIQWLTVLPLELITSSMTIKYWNDS 201

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGP 262
           +    +IVI++  L  ++ F VK YGE EF   S K++ + GF+I  + + CG AGV G 
Sbjct: 202 INADVFIVIFYVFLLFIHFFGVKAYGETEFIFNSCKILMVAGFIILSVVINCGGAGVDGY 261

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
           +G +YWR+PG +  G  ++     RF G    L+ A F++ G EL  ++  E +N RK+ 
Sbjct: 262 IGGKYWRDPGSFADGSNAT-----RFKGICFILVTAYFSFGGIELFVLSINEQSNARKST 316

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXX-XXXXXXXPFIIAIQNSGTKVLPH 381
           P A K+                   VP ++ +L           P+++A      +V+PH
Sbjct: 317 PLAAKRSVYRILIIYLLTMILIGFNVPHNNDQLMGSGSAATHASPYVLAASIHKVRVIPH 376

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
           I NAVIL ++IS  NS +Y   R+M  LA+   APR+     + G P  A+   +  G +
Sbjct: 377 IINAVILISVISVANSALYAAPRLMCSLAQQGYAPRFLNYIDREGRPLRALAVCALVGVV 436

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
            F+  S    +AF WL  I G++  F W  I ++H+RF + ++ +G S  +L +KA    
Sbjct: 437 GFVACSPQEEQAFTWLAAIAGLSEIFTWSGIMLSHIRFRKAMKVQGRSLGELGYKANTGI 496

Query: 502 WLAYYAXXXXXXXXXXQGFTAFAPTFNG 529
           W +YY           Q + A +P  NG
Sbjct: 497 WGSYYGVFFNILVFMAQFWVALSPIGNG 524

>Sklu_YGOB_Anc_1.368 Chr4 complement(849414..850103,850105..851040)
           [1626 bp, 541 aa] {ON} ANNOTATED BY YGOB -
          Length = 541

 Score =  202 bits (515), Expect = 3e-57,   Method: Compositional matrix adjust.
 Identities = 131/429 (30%), Positives = 198/429 (46%), Gaps = 14/429 (3%)

Query: 80  DQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVF 139
           + G      +KR LK RH                     L   GP+  +I +L   T + 
Sbjct: 68  ENGSFDPDSLKRSLKSRHLIMIAIGGSIGTGLFVGSGKALAIGGPLAVIIGWLIAGTQMV 127

Query: 140 SVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQF 199
                LGE+                   PS+      +Y   W     LE+      IQF
Sbjct: 128 GTIHGLGEITVRFPVVGAFADYGTRFLDPSLSFVVSSIYVLQWFFVLPLEIIASAMTIQF 187

Query: 200 WTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGV 259
           W  ++    W+ I++  +  +N+F V+ +GE EF  +SIKVI I GF+I C+ ++ G G 
Sbjct: 188 WNTSIDPVVWVAIFYVTIVAINLFGVRGFGEAEFLFSSIKVITISGFIILCIVLIVGGGP 247

Query: 260 TGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 318
           T   VG RYW +PG    G          F G  S  + A+++  G+E+  + +GE  +P
Sbjct: 248 THEYVGARYWHDPGALAHG----------FKGVASVFVTASYSLGGSEMACLASGET-DP 296

Query: 319 RKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKV 378
            K +P AIK+V                  VP+ +  L          PF+IA      KV
Sbjct: 297 -KELPSAIKQVFWRIIFFFLVSLTLVGFLVPYTNQNLLGGSSVNNS-PFVIACNLYHIKV 354

Query: 379 LPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAF 438
           LP I NAVIL +I+S GNS I+  SR +  +A   L P+ FG   + G P + ++  S F
Sbjct: 355 LPSIINAVILVSIMSVGNSCIFASSRTLCSMAHQGLIPQIFGYVDRAGRPLVGIITNSLF 414

Query: 439 GALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAA 498
           G LAFL  SS  ++ FNWL+ I G+A    WL I+++H+RF   ++ +  + D+L F +A
Sbjct: 415 GLLAFLVKSSSMSEVFNWLMAIAGLATCVVWLSINVSHIRFRMAMKAQDKTLDELEFVSA 474

Query: 499 LMPWLAYYA 507
           +  W + Y+
Sbjct: 475 VGIWGSVYS 483

>AEL030W Chr5 (577803..579551) [1749 bp, 582 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YOL020W (TAT2) Newly
           annotated start codon according to experimentaly
           determined 5' end of mRNA using 5' RACE.
          Length = 582

 Score =  203 bits (516), Expect = 4e-57,   Method: Compositional matrix adjust.
 Identities = 131/454 (28%), Positives = 208/454 (45%), Gaps = 15/454 (3%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           D  +P VD G      +KR LK RH                     L   GP+  LI + 
Sbjct: 53  DSFKPPVD-GSFDPDNLKRTLKSRHLIMIAIGGSIGTGLFIGSGKALATGGPLAVLIGWT 111

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
              T +      LGE+                   PS+      +Y   W     LE+  
Sbjct: 112 LAGTQMVGTIHGLGEVTVRFPVVGAFANYSTRFLDPSVSFVVSSIYVLQWFFVLPLEIIA 171

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
               ++FWT +V    W+ +++ ++  +N+F V+++G+ +F  + IK++ I GF+I CL 
Sbjct: 172 SAITMEFWTTSVDPVVWVAVFYTLIISINLFGVRWFGKPKFVFSVIKMVPICGFIILCLV 231

Query: 253 MVCGAGVTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
           ++ G G T   +G RYW +PG    G          F G  + ++ A+++  G+E+  + 
Sbjct: 232 LILGGGPTHEFIGARYWHDPGALANG----------FKGVAAVMVTASYSLGGSEMTCLA 281

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAI 371
           +GE  +P K +P AIK++                  VP+ + +L          PF+IAI
Sbjct: 282 SGET-DP-KEIPHAIKQIFWRIIFFFLVSLTLVGFLVPYTNDQLLGGSNVNNS-PFVIAI 338

Query: 372 QNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIA 431
           +    +VLPHI N VIL +I+S GNS I+  SR +  +A   L PR FG   + G P   
Sbjct: 339 KMHNIRVLPHIINGVILVSILSVGNSCIFASSRTLCSMAHQGLLPRIFGYVDRAGRPLTG 398

Query: 432 VLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRD 491
           +L  S FG LAFL  SS     F WL+ + G+A    WL I+++H+RF   ++ +G S D
Sbjct: 399 ILTNSLFGLLAFLVKSSSTGTVFTWLMAVAGLATAVVWLSINVSHIRFRLAMKAQGKSLD 458

Query: 492 DLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP 525
           +L F +A+  W + Y+          Q + +  P
Sbjct: 459 ELEFVSAVGMWGSVYSGVMNVVVLVAQFYVSLWP 492

>NCAS0I01530 Chr9 (286882..288669) [1788 bp, 595 aa] {ON} 
          Length = 595

 Score =  202 bits (514), Expect = 1e-56,   Method: Compositional matrix adjust.
 Identities = 129/448 (28%), Positives = 201/448 (44%), Gaps = 8/448 (1%)

Query: 81  QGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFS 140
             +  D  +K+ +K RH                  +  L  AGP   +I Y  ++ I + 
Sbjct: 69  NSIQSDDNLKKAMKSRHVIMMSLGTGIGTGLLVANAKGLYLAGPASLVIGYFMVSFITYF 128

Query: 141 VTQSLGEMAXXXXXX-XXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQF 199
           V Q+ GEMA                      G A  +++   W     LEL      I++
Sbjct: 129 VIQAAGEMAVTYPTLPGGFNNYASIFVSKPFGFATVWLFCIQWLTVLPLELITASMTIKY 188

Query: 200 WTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AG 258
           W D +    ++VI +  L  ++ F V+ YGE EF   S K++ I GF+I  + + CG AG
Sbjct: 189 WNDKINADVFVVILYVFLLFIHFFGVRAYGEAEFIFNSCKILMIGGFVILSIVVNCGGAG 248

Query: 259 VTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 318
           V G +G +YWR+PG +     +S  A  RF G    L+ A F+Y G EL  ++  E  NP
Sbjct: 249 VDGYIGGKYWRDPGAF-----ASDNAASRFKGVAFVLVTAYFSYGGVELFALSVNEQENP 303

Query: 319 RKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX-XXXXXXPFIIAIQNSGTK 377
           R++ P A K+                   VP +  +L           P+++A+   G K
Sbjct: 304 RRSTPAAAKQSIYRILIIYLLTMILIGFNVPHNSDQLMGAGGSATHASPYVLAVSIHGVK 363

Query: 378 VLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSA 437
           V+PHI NAVIL ++ S  NS +Y   R++  LA+   AP++F    + G P  A++  S 
Sbjct: 364 VVPHIINAVILISVTSVANSALYASPRLLRSLAEQGYAPKYFNYVDREGRPLRALILCSI 423

Query: 438 FGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKA 497
           FG +AF   S      F WL  I G++  F W  I ++HVRF   ++ +G S ++L + +
Sbjct: 424 FGVIAFCACSDQEEVIFTWLAAIAGLSELFTWSSILLSHVRFRLAMKAQGKSLNELGYIS 483

Query: 498 ALMPWLAYYAXXXXXXXXXXQGFTAFAP 525
               W + Y           Q + A +P
Sbjct: 484 ITGIWGSLYGCFFNVLVFIAQFWVALSP 511

>Ecym_2716 Chr2 (1386630..1388408) [1779 bp, 592 aa] {ON} similar to
           Ashbya gossypii AEL030W
          Length = 592

 Score =  202 bits (513), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 138/490 (28%), Positives = 215/490 (43%), Gaps = 22/490 (4%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           D  +P VD G    + +KR LK RH                     L   GP+  +I + 
Sbjct: 63  DSFKPPVD-GSFDPSNMKRALKSRHLIMIAIGSSIGTGLFVGSGKALATGGPLALIIGWT 121

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
              T +      LGE+                   PS+      +Y   W     LE+  
Sbjct: 122 LAGTQMIGTIHGLGELTVRLPVVGAFADYSTRFLDPSVSFVISSIYVMQWFFVLPLEIIA 181

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
               ++FWT +V    W+ +++ ++  +N+  V+ +GE EF  +S+KVI I GF+I C+ 
Sbjct: 182 SCITMRFWTQSVDPIIWVALFYTMIVSINLLGVRGFGEAEFIFSSVKVITICGFIILCIV 241

Query: 253 MVCGAGVTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
           ++ G G T   VG RYW +PGP   G          F G  + ++ A+++  G+E+  + 
Sbjct: 242 LILGGGPTHQYVGSRYWHDPGPLANG----------FKGVAAVMVTASYSLGGSEMTCLA 291

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAI 371
           +GE  +P K +P AIK++                  VP+ +  L          PF++A+
Sbjct: 292 SGET-DP-KELPHAIKQIFWRILFFFLVSLTLVGFLVPYTNENLLGGSSAENS-PFVLAL 348

Query: 372 QNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIA 431
                KV+PHI N VIL +I+S GNS I+  SR +  +A   L P  FG   + G P + 
Sbjct: 349 YLHHVKVVPHIVNGVILVSILSVGNSCIFASSRTLCSMAHQGLIPHIFGYVDRGGRPLVG 408

Query: 432 VLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRD 491
           +L  S FG LAFL   S  +  F+WL+ I G+A    WL I+++HVRF   ++ +  S D
Sbjct: 409 ILANSIFGLLAFLVKFSSISNVFSWLMAIAGLATCVVWLSINVSHVRFRLAMKAQNKSLD 468

Query: 492 DLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSD-------FVAAYIXXXXXXX 544
           +L F +++  W + YA          Q + A  P     D       F   Y+       
Sbjct: 469 ELQFVSSVGVWGSVYAGVLNFLTLVAQFYIALWPVEGWKDSKSRAEAFFKNYLCALILIA 528

Query: 545 XXXXXQLYFR 554
                + YFR
Sbjct: 529 MFAAHKCYFR 538

>YOL020W Chr15 (286172..287950) [1779 bp, 592 aa] {ON}  TAT2High
           affinity tryptophan and tyrosine permease,
           overexpression confers FK506 and FTY720 resistance
          Length = 592

 Score =  202 bits (513), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 132/484 (27%), Positives = 217/484 (44%), Gaps = 21/484 (4%)

Query: 81  QGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFS 140
            G    + +KR LK RH                     +   GP+G +I +    + +  
Sbjct: 70  DGSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVIGWAIAGSQIIG 129

Query: 141 VTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW 200
               LGE+                   PSI      +Y   W     LE+      +Q+W
Sbjct: 130 TIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIAAAMTVQYW 189

Query: 201 TDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVT 260
             ++    W+ I++ ++  +N+F V+ +GE EF  ++IK I + GF+I C+ ++CG G  
Sbjct: 190 NSSIDPVIWVAIFYAVIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCVVLICGGGPD 249

Query: 261 GP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPR 319
              +G +YW +PG    G          F G +S L+ A+++  G E+  + +GE  +P 
Sbjct: 250 HEFIGAKYWHDPGCLANG----------FPGVLSVLVVASYSLGGIEMTCLASGET-DP- 297

Query: 320 KTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVL 379
           K +P AIK+V                  VP+ +  L          PF+IAI+    K L
Sbjct: 298 KGLPSAIKQVFWRILFFFLISLTLVGFLVPYTNQNLLGGSSVDNS-PFVIAIKLHHIKAL 356

Query: 380 PHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFG 439
           P I NAVIL +++S GNS I+  SR +  +A   L P WFG   + G P + ++  S FG
Sbjct: 357 PSIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVGIMANSLFG 416

Query: 440 ALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAAL 499
            LAFL  S   ++ FNWL+ I G+A    WL I+++H+RF   ++ +G S D+L F +A+
Sbjct: 417 LLAFLVKSGSMSEVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLDELEFVSAV 476

Query: 500 MPWLAYYAXXXXXXXXXXQGFTAFAPT---FNGSD----FVAAYIXXXXXXXXXXXXQLY 552
             W + Y+          Q + +  P     +G +    F   Y+            ++Y
Sbjct: 477 GIWGSAYSALINCLILIAQFYCSLWPIGGWTSGKERAKIFFQNYLCALIMLFIFIVHKIY 536

Query: 553 FRCK 556
           ++C+
Sbjct: 537 YKCQ 540

>KNAG0J02210 Chr10 complement(409847..411592) [1746 bp, 581 aa] {ON}
           
          Length = 581

 Score =  201 bits (512), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 128/491 (26%), Positives = 214/491 (43%), Gaps = 20/491 (4%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           + + + D     + ++ + ++ RH                   + L  +GP+G +I Y+ 
Sbjct: 69  KRKEHDDSTAGDENDLNKAIRSRHLIMISLGTGIGTGLLVGTGSVLSQSGPLGLIIGYIV 128

Query: 134 MATIVFSVTQSLGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSV 192
            + +VF + Q+ GE+                    P+ G A  ++Y   W I   L+L  
Sbjct: 129 SSLMVFLIIQAAGELGIVYSNVVGNFTRYPTILVDPAFGFAISFLYTIQWMIVLPLQLVT 188

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
               IQFW   V L  +++  + ++ ++N+   + Y E EF+    K++ + GF+I  + 
Sbjct: 189 AAMTIQFWNVGVNLDVFVLASFVVVVLINLGGARGYVEAEFFCNLCKIVMLTGFVILGII 248

Query: 253 MVCGAGVTGPVGF---RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVG 309
           +  G    GP G+   +YWRNPG +  G          F G  S    AAF+Y G E + 
Sbjct: 249 ITAGGIPNGPDGYIGGKYWRNPGLFANG----------FKGVCSVFCYAAFSYGGVETLV 298

Query: 310 ITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXX-PFI 368
           ++A E  NP K++P A KKV                  VP+  P L           PF+
Sbjct: 299 LSAAEQKNPLKSIPSATKKVMYRILFIYLLSLIIVCFLVPYTSPDLMGSSGSGSHSSPFV 358

Query: 369 IAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVP 428
           IAI + G  V+PH+ NAVIL +++S  NS +YV  R++  LA+   AP++     K G P
Sbjct: 359 IAIASHGVSVVPHLINAVILISVLSVANSALYVAPRLLLSLAQGGSAPKFLNYIDKRGRP 418

Query: 429 YIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGI 488
               L    FG + F+  S      F WLL+I G+   F W+ I ++H+RF   +  +G 
Sbjct: 419 TTCTLVVVLFGMIGFVAASDKREVVFTWLLSISGLGQIFIWISICVSHIRFRDAMRVQGH 478

Query: 489 SRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPT-----FNGSDFVAAYIXXXXXX 543
              ++ +KA    W +Y A          Q + A AP       + ++F   Y+      
Sbjct: 479 PLTEIAYKAQTGYWGSYVAIALALFVLVCQFWVAIAPVGAHGKLDATNFFQNYLAFPVVL 538

Query: 544 XXXXXXQLYFR 554
                 ++Y++
Sbjct: 539 CAYLGFKVYYK 549

>Suva_15.148 Chr15 (258987..260765) [1779 bp, 592 aa] {ON} YOL020W
           (REAL)
          Length = 592

 Score =  201 bits (512), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 136/492 (27%), Positives = 218/492 (44%), Gaps = 22/492 (4%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           D  +P +D G    + +KR LK RH                     +   GP+G ++ + 
Sbjct: 63  DSFKPPLD-GSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWT 121

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
              + +      LGE+                   PSI      +Y   W     LE+  
Sbjct: 122 IAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIA 181

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
               +Q+W  ++    W+ I++ I+  +N+F V+ +GE EF  ++IK I + GF+I C+ 
Sbjct: 182 AAMTVQYWNSSIDPVVWVAIFYVIIVSINLFGVRGFGEAEFAFSTIKAITVCGFIILCIV 241

Query: 253 MVCGAGVTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
           ++ G G     VG +YW +PG    G          F G +S L+ A+++  G E+  + 
Sbjct: 242 LIFGGGPDHEYVGAKYWYDPGCLANG----------FPGILSVLVVASYSLGGIEMTCLA 291

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAI 371
           +GE  +P K +P AIK+V                  VP+ +  L          PF+IAI
Sbjct: 292 SGET-DP-KGLPSAIKQVFWRILFFFLVSLTLVGFLVPYTNQNLLGGSSVDNS-PFVIAI 348

Query: 372 QNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIA 431
           +    KVLP I N VIL +++S GNS I+  SR +  +A   L P WFG   + G P + 
Sbjct: 349 KLHHIKVLPSIVNVVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVG 408

Query: 432 VLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRD 491
           ++  S FG LAFL  S      FNWL+ I G+A    WL I+++H+RF   ++ +G   D
Sbjct: 409 IMANSLFGLLAFLVKSGSMGDVFNWLMAIAGLATCIVWLSINVSHIRFRMAMKAQGKKLD 468

Query: 492 DLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPT---FNGSD----FVAAYIXXXXXXX 544
           +L F +A+  W + Y+          Q + +  P     N SD    F   Y+       
Sbjct: 469 ELEFVSAVGIWGSAYSALINCLILLAQFYCSLWPIGGWKNSSDRAKIFFQNYLCALIVLF 528

Query: 545 XXXXXQLYFRCK 556
                ++Y++C+
Sbjct: 529 IFIAHKIYYKCQ 540

>CAGL0D02178g Chr4 (222597..224330) [1734 bp, 577 aa] {ON} highly
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020w SCM2 high affinity tryptophan transport protein
          Length = 577

 Score =  201 bits (511), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 137/490 (27%), Positives = 219/490 (44%), Gaps = 22/490 (4%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           D  +P VD G    + +KR LK RH                     L   GP+  +I + 
Sbjct: 48  DSFKPPVD-GSFDTSNLKRTLKSRHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWT 106

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
              + +      LGE+                   PSI      +Y   W     LE+  
Sbjct: 107 IAGSQIVGTIHGLGEITVRFPVVGAFADYSTRFLDPSISFVVSTIYVIQWFFVLPLEIIA 166

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
               IQ+W  ++    W+ I++ ++  +N+F  + +GE EF  ++IK I I GF+I C+ 
Sbjct: 167 SAITIQYWNSSIDPVVWVAIFYGVIVSINLFGARGFGEAEFVFSTIKAITICGFIILCIV 226

Query: 253 MVCGAGVTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
           ++CG G     +G +YW +PG    G          F G +S L+ A+++  GTE+  + 
Sbjct: 227 LICGGGPDHEFIGAKYWHDPGALAHG----------FPGVLSVLVVASYSLGGTEMTCLA 276

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAI 371
           +GE  +P K +P AIK+V                  VP+ +  L          PF+IAI
Sbjct: 277 SGET-DP-KELPSAIKQVFWRILFFFLASLTLVGFLVPYTNENLLGGSSVDNS-PFVIAI 333

Query: 372 QNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIA 431
           +    K LP I NAVIL +I+S GNS I+  SR +  +A   L PR+FG   + G P   
Sbjct: 334 KLHHIKALPSIVNAVILISILSVGNSCIFASSRTLCSMAHQGLIPRFFGYIDRAGRPLAG 393

Query: 432 VLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRD 491
           ++  S FG LAFL  SS  ++ F+WL+ I G+A    WL I+++H+RF   ++ +  + D
Sbjct: 394 IVTNSLFGLLAFLVKSSSVSEVFDWLMAIAGLATCIVWLSINLSHIRFRLAMKAQNKTLD 453

Query: 492 DLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSD-------FVAAYIXXXXXXX 544
           +L F +A+  W + Y+          Q + +  P    +D       F  +Y+       
Sbjct: 454 ELEFVSAVGIWGSAYSALINVLILIAQFYISLWPIGGWTDSSQRAKKFFQSYLCALIMLL 513

Query: 545 XXXXXQLYFR 554
                ++Y+R
Sbjct: 514 IFCIHKVYYR 523

>Kwal_8.590 s8 complement(17220..19109) [1890 bp, 629 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 311] FULL
          Length = 629

 Score =  202 bits (514), Expect = 2e-56,   Method: Compositional matrix adjust.
 Identities = 125/470 (26%), Positives = 220/470 (46%), Gaps = 8/470 (1%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           + D P      +++   +R+L  R                    T +   GP   LIA+ 
Sbjct: 101 NRDSPKSQSLSLEERIARRKLLPRQVSMIGIGGAIGTALFVSIGTKIIQGGPGSLLIAFC 160

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
             + +   +++ +  M                    S G A G+ Y+   A     E++ 
Sbjct: 161 LWSVVFIGLSKCMCVMVTYLPVTGSFVHFTERFVDQSCGFAVGWTYFVCQAANVCFEITA 220

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
           V  ++++WTD +P +A I +   +   +N++ V F+GE EF+++  KV+  +G +I+ + 
Sbjct: 221 VCLVVEYWTDKIPKAALISMLIILFGSLNLYSVFFFGEGEFYLSIGKVVLAIGLIIFTVV 280

Query: 253 MVCGAGVTGPV-GFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
           ++ G      V GF+ W NPG +   I    V  GRF G++S L+ A + + G + +G  
Sbjct: 281 VMAGGNPQHTVLGFKNWSNPGAFAEYISDGSV--GRFHGFMSCLVFALYVFWGVDYLGNA 338

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXX----XXPF 367
           A EA NPRK +P + +KV                  +P++DP +              P+
Sbjct: 339 ASEAMNPRKVIPSSFRKVFGRLIIFYIGGAICVGILIPYNDPNMIRAIKEGAVGAGASPY 398

Query: 368 IIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGV 427
           + A++  G +VLPHI N +IL++IISAGNS++Y  SRV+  LA    APR F +TTK GV
Sbjct: 399 VSAMKTLGIRVLPHIVNILILTSIISAGNSSLYSASRVLHRLALDNQAPRIFKVTTKKGV 458

Query: 428 PYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRG 487
           P    +       LA+L VS+       W LN+   A    ++ I +++++F +    + 
Sbjct: 459 PVYCCIAVLVICGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICVSYLQFRKGCLAQN 518

Query: 488 ISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP-TFNGSDFVAAY 536
           +    LP+ ++ +P+LA+++           G+T F   +++   FV +Y
Sbjct: 519 VDLKSLPYYSSSLPYLAWHSLFWLVLMLLVNGYTVFLKGSWDTQSFVFSY 568

>Kwal_23.2817 s23 complement(26637..28379) [1743 bp, 580 aa] {ON}
           YOR348C (PUT4) - putative proline-specific permease
           [contig 246] FULL
          Length = 580

 Score =  200 bits (509), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 146/541 (26%), Positives = 239/541 (44%), Gaps = 27/541 (4%)

Query: 76  EPYVDQGVVQD-------AEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSL 128
           E  +++G + D        EV R LK RH                   T L + GP   L
Sbjct: 44  EQDIERGSLSDIDTIKPSTEVSRGLKSRHVQFIALGGAIGTGLFIGSGTALSSCGPAPLL 103

Query: 129 IAYLFMATIVFSVTQSLGEMAXX---XXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAIT 185
           I+Y  M+  V+++   + EM                      PS     G+  +++ ++ 
Sbjct: 104 ISYSVMSFFVWAIMNQMTEMVVLIPLSGESSMASLAGTYLNRPS-SFMCGWNCFYAMSMV 162

Query: 186 FALELSVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMG 245
              E++    +I++WTDA   + ++ I+  + T++++ PVK +GE EF V+ IK++ I+G
Sbjct: 163 VPTEITACALLIEYWTDA-NAAIFVTIFMILATLLSLLPVKIFGESEFCVSIIKILTILG 221

Query: 246 FLIYCLCMVCGAGVTGP--VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY- 302
            ++  + +  G G      +GF YW  PG +   ++    + G FL    ++I + F + 
Sbjct: 222 LILVGVVIFFGGGPAQHKVLGFHYWNTPGAFNSYLVKG--STGAFLAVWKAIIKSGFAFV 279

Query: 303 QGTELVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXX- 361
              E+    + EAA PRK +PRA ++                   V +D+  L       
Sbjct: 280 MIPEITSSCSAEAAFPRKNMPRACQRFVYRLAVFYVLGCLVIGVIVGYDNKTLNEAISSG 339

Query: 362 ---XXXXPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRW 418
                  PF+I IQ +G ++LPHI NA IL++  S   S +Y  SRV+  LA    AP++
Sbjct: 340 KANAAASPFVIGIQEAGIRILPHIINACILTSAYSCSTSELYGASRVLHSLALRGDAPKF 399

Query: 419 FGITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVR 478
           F    K+GVPY +V  TS FG LA+L  S      FNWL NI  ++GF  W+ +SI ++R
Sbjct: 400 FSKVNKYGVPYYSVAATSLFGVLAYLNCSKSSLVVFNWLSNIATISGFVNWVFVSITYLR 459

Query: 479 FIQTLEHRGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAF-APTFNGSDFVAAYI 537
           F +  ++  I+ D +P++      LAY +           GF  F A  +N SDF   Y+
Sbjct: 460 FRKITDYLKIN-DRVPYRRRGQRALAYASAIFFALLAITNGFYVFIAGNWNVSDFFTCYV 518

Query: 538 XXXXXXXXXXXXQLYFRCKLYWSLDEVXXXXXXXXXXXXXWEDSA----PKTFWDRFWDV 593
                        +Y++   +  +D V              E       PK + +R W +
Sbjct: 519 TIGFVGVLFIGSSIYYKEWTFRDMDVVGREIMPKIDQADQEEKEEYLPPPKNWVERVWRI 578

Query: 594 V 594
           V
Sbjct: 579 V 579

>ZYRO0A00308g Chr1 complement(16982..18676) [1695 bp, 564 aa] {ON}
           similar to uniprot|P43548 Saccharomyces cerevisiae
           YFL055W AGP3 Low-affinity amino acid permease may act to
           supply the cell with amino acids as nitrogen source in
           nitrogen-poor conditions transcription is induced under
           conditions of sulfur limitation
          Length = 564

 Score =  200 bits (508), Expect = 5e-56,   Method: Compositional matrix adjust.
 Identities = 131/450 (29%), Positives = 200/450 (44%), Gaps = 13/450 (2%)

Query: 89  VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGEM 148
           VKR LK RH                     L   GP+  L+ +  +  I F++ +S+GEM
Sbjct: 51  VKRALKDRHISLLALGGIIGPGCLVGAGNALAKGGPLALLLGFSIIGIIAFTIMESIGEM 110

Query: 149 AXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPLSA 208
                               S+ A  GY Y   +    A E + +  I QFW   VPL  
Sbjct: 111 ITLYPSGGGFTTLARRFHSDSLSAVCGYAYIVVFFAVMANEYNTLSSIFQFWGPQVPLYG 170

Query: 209 WIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPV-GFRY 267
           +I+I+W       M  V  +GE E+W++  K++ ++ F I+    + G     P  GF Y
Sbjct: 171 YILIFWAAFQAFQMAGVGAFGEIEYWLSWFKILGLVAFYIFSTIYISGGIKDRPAFGFHY 230

Query: 268 WRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRAIK 327
           W NPG    G          F G     +  +  Y GTE V  +A E+ NP + +P AI+
Sbjct: 231 WNNPGALSHG----------FKGIAEVFVFCSTFYSGTESVAYSASESKNPNRAIPLAIR 280

Query: 328 KVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKVLPHIFNAVI 387
           +                   VP++D  L          P  IAI  +G +   H+ NA I
Sbjct: 281 QTFWRILVVYIGIGFFYGVTVPYNDHNLNAGTKALKS-PISIAITRAGWEGGTHLVNAFI 339

Query: 388 LSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFLEVS 447
           L T ISA N ++++GSR +  LA   LAP++   T + GVP  A+   +A G ++ + VS
Sbjct: 340 LVTCISAINGSLFIGSRTITNLAHEGLAPKFLAWTDRRGVPIPAITLFNALGLVSLMNVS 399

Query: 448 SGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLAYYA 507
            G + A+++++N+ GV  F  W  I + H+RF +    +G +  +LP+KA   P+     
Sbjct: 400 VGASTAYSYIVNLSGVGVFIVWGTIGLTHLRFRKAWIKQGRTVKELPYKALFYPYTQIIG 459

Query: 508 XXXXXXXXXXQGFTAFAPTFNGSDFVAAYI 537
                     QG+T+F P F   DFV AY+
Sbjct: 460 IAANIFLALIQGWTSFVP-FKAGDFVDAYV 488

>TBLA0C01210 Chr3 complement(260786..262588) [1803 bp, 600 aa] {ON} 
          Length = 600

 Score =  200 bits (509), Expect = 6e-56,   Method: Compositional matrix adjust.
 Identities = 129/447 (28%), Positives = 206/447 (46%), Gaps = 14/447 (3%)

Query: 80  DQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVF 139
           + G    + +K+ LK RH                     L   GP+  +I +    + + 
Sbjct: 77  EDGSFDTSNLKKTLKARHLIMIAIGGSIGTGLFIGSGQALATGGPLAVIIGWAIAGSQII 136

Query: 140 SVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQF 199
                LGE+                   PSI      +Y   W     LE+      +Q+
Sbjct: 137 GTIHGLGEITVRFPVVGAFANYSTRFLDPSISFVVSTIYVIQWFFVLPLEIISSAMTVQY 196

Query: 200 WTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGV 259
           W +++    W+ I++  +  +N+F V+ +GE EF  ++IKVI I GF++ C+ ++ G G 
Sbjct: 197 WNESIDPVVWVAIFYVTIVSINLFGVRGFGEAEFIFSTIKVITISGFILLCIILIAGGGP 256

Query: 260 TGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 318
               VG RYW NPG    G          F G +S ++ A+++  GTE+  + +GE  +P
Sbjct: 257 DHVYVGSRYWHNPGCLANG----------FPGVLSVMVVASYSLGGTEMTCLASGET-DP 305

Query: 319 RKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKV 378
            K +P AIK+V                  VP+ +  L          PF+IAI+    KV
Sbjct: 306 -KELPSAIKQVFWRILFFFLVSLTLVGFLVPYTNENLLGGSSVDNS-PFVIAIKIHHIKV 363

Query: 379 LPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAF 438
           LP I NAVIL +I+S GNS I+  SR +  +A   L P WFG   + G P + ++  S F
Sbjct: 364 LPSIVNAVILISILSVGNSCIFASSRTLCSMAHQHLLPWWFGYIDRAGRPLVGIITNSLF 423

Query: 439 GALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAA 498
           G LAFL  S   ++ F+WL+ I G+A    WL I+++H+RF   ++ +G S ++L F +A
Sbjct: 424 GLLAFLVKSGSMSEVFDWLMAIAGLATCIVWLSINVSHIRFRLAMKAQGRSLNELEFVSA 483

Query: 499 LMPWLAYYAXXXXXXXXXXQGFTAFAP 525
           +  W + Y+          Q + +  P
Sbjct: 484 VGIWGSVYSAIINCLILVAQFYISLWP 510

>AGR038C Chr7 complement(777529..779271) [1743 bp, 580 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YDR046C
           (BAP3) and YBR068C (BAP2); Tandem gene duplication in
           this genome
          Length = 580

 Score =  199 bits (507), Expect = 9e-56,   Method: Compositional matrix adjust.
 Identities = 127/441 (28%), Positives = 201/441 (45%), Gaps = 8/441 (1%)

Query: 88  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGE 147
           ++++ ++ RH                  +  L   GP G LI YL ++ + + +  + GE
Sbjct: 62  KLQQRMRTRHVVMMSLGTGIGTGLLVANAASLHYGGPAGLLIGYLLVSIVSYIMMHAAGE 121

Query: 148 MAXXXXXX-XXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVPL 206
           MA                      G A  +++   W   F LEL     +I++W  +V  
Sbjct: 122 MAVAYPTLPGNFNAYSSIFISKPFGFATVWLFCLQWLTVFPLELITATIVIKYWKVSVNA 181

Query: 207 SAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGA-GVTGPVGF 265
           + ++VI++  +  ++ F  + YGE EF     KV+ I+GF+I  + +  GA G TG +G 
Sbjct: 182 NVFVVIFYLFIICIHFFGARGYGETEFIFNMCKVLMIVGFVIVGILINVGAIGDTGYIGD 241

Query: 266 RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVPRA 325
           RYWRNPG +  G         +  G    L+ A F++ G EL  ++  E  NP+  +P A
Sbjct: 242 RYWRNPGSFVSG-----TPLDKLKGTAYVLVTAYFSFGGMELYALSVNELPNPKTAIPSA 296

Query: 326 IKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXX-XPFIIAIQNSGTKVLPHIFN 384
            KK                   VP D  +L           P+++AI+  G KVLPHI N
Sbjct: 297 CKKGVYRILLVYLLTMIMIGFLVPHDSDRLMGSGSNDVHPSPYVLAIEMHGVKVLPHIVN 356

Query: 385 AVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALAFL 444
           AVIL ++IS GNS +Y   R++  LA+   AP+      + G P I+++  + FG +AF 
Sbjct: 357 AVILISVISVGNSAMYSAPRLLCALAQQGYAPKQLDYIDREGRPLISLILCAIFGLIAFS 416

Query: 445 EVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPWLA 504
             S    K F WL  I G++  F W  I ++H RF Q ++ +G S + L ++A    W +
Sbjct: 417 AASDNQEKIFIWLAAIAGLSELFTWTSICLSHFRFRQAMKLQGRSLETLGYRAITGQWGS 476

Query: 505 YYAXXXXXXXXXXQGFTAFAP 525
            YA          Q + A  P
Sbjct: 477 LYAVFFNLLVFIAQFWVALVP 497

>CAGL0H08393g Chr8 (821998..823836) [1839 bp, 612 aa] {ON} highly
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046c PAP1
          Length = 612

 Score =  200 bits (508), Expect = 1e-55,   Method: Compositional matrix adjust.
 Identities = 129/472 (27%), Positives = 211/472 (44%), Gaps = 14/472 (2%)

Query: 75  DEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFM 134
           D   +++      E K+ +K RH                     L  AGP   +IAY  +
Sbjct: 79  DHNDLEKTTTAHQEQKKTMKSRHVIMMSLGTGIGTGLLVSNGKGLSLAGPASLVIAYGLV 138

Query: 135 ATIVFSVTQSLGEMAXXXXXX-XXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVV 193
           + + + + Q+ GEMA                      G A  +++   W     LEL   
Sbjct: 139 SFVTYFMIQAAGEMAVTYPTLPGSFNAYTSFFISKPFGFATTWLFCIQWLTVLPLELITA 198

Query: 194 GQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCM 253
              I++W  ++    +++I++  L  ++ F V+ YGE EF   + K++ I GF+I+ + +
Sbjct: 199 AMTIKYWNTSIDPDVFVIIFYVFLMFIHFFGVQAYGETEFIFNACKILMIGGFIIFAIVV 258

Query: 254 VCG-AGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITA 312
            CG AG  G +G +YW +PG +     +S     RF G   +L+NA F+Y G EL  ++ 
Sbjct: 259 NCGGAGKDGYIGGKYWHDPGAF-----ASSNGASRFKGICYNLVNAYFSYGGNELFVLSV 313

Query: 313 GEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX--XXXXXXPFIIA 370
            +  NPRK+ P A K                    VP +  +L            P+++A
Sbjct: 314 NDQKNPRKSTPAAAKSNVYRIVVIYLLTMILIGFVVPHNSSELLGASGGNGLHASPYVLA 373

Query: 371 IQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYI 430
               G KV+PHI NAVIL  +IS  NS++Y G R++  LA+   APR+     + G P  
Sbjct: 374 ASIHGIKVVPHIINAVILIALISVANSSLYAGPRLLSSLAQQGYAPRFLSYVDRRGRPLT 433

Query: 431 AVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISR 490
           A+L ++  G + F   S    + F WL  I G++  F W  I  +H+RF + ++ +  S 
Sbjct: 434 ALLLSALVGVIGFAATSPREEEVFTWLAAISGLSELFTWTSIMFSHIRFRRAMKLQNKSL 493

Query: 491 DDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNG-----SDFVAAYI 537
           D L +KA    W +Y+           Q + A +P  +G     + F A+Y+
Sbjct: 494 DTLGYKANTGLWGSYFGVGFNILVFAAQFWVALSPPNSGGKCDANSFFASYL 545

>KNAG0J02200 Chr10 complement(407267..409090) [1824 bp, 607 aa] {ON}
           
          Length = 607

 Score =  199 bits (507), Expect = 2e-55,   Method: Compositional matrix adjust.
 Identities = 129/446 (28%), Positives = 203/446 (45%), Gaps = 8/446 (1%)

Query: 83  VVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVT 142
           V  D  +K+ +K RH                  +  L   GP   +I Y  ++ + + + 
Sbjct: 85  VNTDTHLKKAMKTRHVIMMTLGTGIGTGLLVANAKGLHFGGPAALVIGYGLVSMVTYIMI 144

Query: 143 QSLGEMAXXXXXX-XXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWT 201
           Q+ GEMA                      G A  +++   W     LEL     II++WT
Sbjct: 145 QAAGEMAVAYPTLPGNFNTYASIFVSKPFGFATVWLFCIQWLTVLPLELITASLIIKYWT 204

Query: 202 DAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVT 260
           + V    ++VI++  L  ++   VK YGE EF     K++ I GF+I+ + + CG AG  
Sbjct: 205 EKVNADVFVVIFYVFLLFIHFIGVKAYGETEFVFNLCKILMIAGFIIFSIVVNCGGAGHD 264

Query: 261 GPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRK 320
           G +G +YW +PG +      +  AE RF G    L++  F+Y GTEL  ++  E  NPRK
Sbjct: 265 GYIGGKYWHSPGAFA----GTNAAE-RFKGVCYVLVSGYFSYGGTELYVLSVNEQENPRK 319

Query: 321 TVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX-XXXXXXPFIIAIQNSGTKVL 379
           + P A K+                   VPF+D +L           P+++A    G +V+
Sbjct: 320 STPIAAKQSIYRILVIYLLTMILIGFTVPFNDDQLMGAGGSATHASPYVLAASIHGVRVV 379

Query: 380 PHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFG 439
           PHI NAVIL  +IS  NS++Y   R++  LA+   AP++     + G P  A+L  + FG
Sbjct: 380 PHIINAVILIAVISVANSSLYAAPRLLCSLAEQGYAPKFMTYVDREGRPLYALLACAVFG 439

Query: 440 ALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAAL 499
            +AF   S    + F WL  I G++  F W  I ++HVRF Q ++ +G   +++ + A  
Sbjct: 440 VIAFSACSDQEEQVFTWLAAIAGLSELFTWSSIMLSHVRFRQAMKLQGRDLNEVGYIANT 499

Query: 500 MPWLAYYAXXXXXXXXXXQGFTAFAP 525
             W + Y           Q + A AP
Sbjct: 500 GYWGSVYGVVFNILVFIAQFWVALAP 525

>KLLA0B14685g Chr2 complement(1289025..1290740) [1716 bp, 571 aa]
           {ON} weakly similar to uniprot|P15380 Saccharomyces
           cerevisiae YOR348C PUT4 proline-specific permease (also
           capable of transporting alanine and glycine) putative
           proline-specific permease
          Length = 571

 Score =  198 bits (503), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 139/533 (26%), Positives = 231/533 (43%), Gaps = 25/533 (4%)

Query: 80  DQGVVQDAE-------VKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           DQG   D E       + R LK RH                     L   GP   LIAY+
Sbjct: 39  DQGSYSDIENFKPPQKIVRGLKTRHIQLIALGSAIGTGLFIGSGGALSVCGPAPLLIAYI 98

Query: 133 FMATIVFSVTQSLGEMAXXXXX--XXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALEL 190
            ++  V+S+   + EM                       I    G+  +++ A+    E+
Sbjct: 99  IISFFVWSIMNQMTEMVCLIPLPGEASLYSLAKTYLNSPISFMCGWNLFYAMAMIVPAEI 158

Query: 191 SVVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYC 250
           +    ++Q+WTDA   + +I I+  +  ++ M PVK +GE EFWV+SIK++ I+G +I  
Sbjct: 159 TACALLVQYWTDANS-AIFISIFIVVSILLTMLPVKVFGESEFWVSSIKILTIVGLIIVG 217

Query: 251 LCMVCGAGVTGP--VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGT-EL 307
           + +  G G      +GF YW+NPG + P +  ++   GRFL   +++I + F++    E 
Sbjct: 218 IVIFFGGGPAQDHVLGFHYWKNPGAFNPHL--AEGNTGRFLAVWTAIIKSGFSFVLVPET 275

Query: 308 VGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXX----XX 363
           V   + E   PR+ +P+A ++                   V F++ +L            
Sbjct: 276 VTSCSAECIAPRRNMPKACQRFIYRLAIFYIVGTLVVGVIVGFNNDRLINAIQSGKSDAA 335

Query: 364 XXPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITT 423
             PF+I IQ +G K+LPHI NA IL++  S G   +Y  SR ++ +A    AP+ F    
Sbjct: 336 ASPFVIGIQEAGIKILPHIINACILTSAYSCGTGLLYGSSRTLYSMALRGDAPKIFAKVN 395

Query: 424 KHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTL 483
           + G PY +    S F  LA+L  S   +  FNWL NI  ++GF +W+ +S+ ++RF + +
Sbjct: 396 RFGTPYYSTGLASLFSFLAYLNCSKSASVVFNWLSNIATISGFVSWIFVSMTYIRFRKVI 455

Query: 484 EHRGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP-TFNGSDFVAAYIXXXXX 542
               ++ D +PF+      LAY             G+  F    +N SDF A+Y+     
Sbjct: 456 NALDLN-DRVPFRRPFQVPLAYLTCGFFFILSLTNGYAVFVKGNWNVSDFFASYVTIGFV 514

Query: 543 XXXXXXXQLYFRCKLYWSLDEVXXXXXXXXXXXXXWEDS----APKTFWDRFW 591
                    Y++   +    E+              E +     P+ F ++ W
Sbjct: 515 IFLYLVGSFYYKQWTFRDFKEIEVEILPKIDIADEEERNDVIPVPRNFMEKVW 567

>Smik_2.202 Chr2 complement(358478..360331) [1854 bp, 617 aa] {ON}
           YBR069C (REAL)
          Length = 617

 Score =  199 bits (505), Expect = 3e-55,   Method: Compositional matrix adjust.
 Identities = 126/484 (26%), Positives = 214/484 (44%), Gaps = 20/484 (4%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           +   + + +K RH                     L  AGP G ++ Y   + +++ + Q+
Sbjct: 86  EKNNLTKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGVASIMLYCIIQA 145

Query: 145 LGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
            GE+                    PS+G A   +Y   W     L+L      +++WT +
Sbjct: 146 AGELGLCYAGLTGNYTRYPSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWT-S 204

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGP 262
           V    ++ + +  + I+N+F  + Y E EF     K++ ++GF+I  + + CG AG    
Sbjct: 205 VNSDIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVIGFVILAIIINCGGAGDRKY 264

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
           +G  YW NPGP+  G          F G  +    AAF+Y G E++ ++A E  NP K++
Sbjct: 265 IGTEYWHNPGPFAHG----------FKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSI 314

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKL--XXXXXXXXXXPFIIAIQNSGTKVLP 380
           P A KKV                  VP++  +L            PF+IA+ + G KV+P
Sbjct: 315 PNACKKVVYRILLIYMLTTILVCFLVPYNSDELLGSDDSSGSHASPFVIAVASHGVKVVP 374

Query: 381 HIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGA 440
           H  NAVIL ++IS  NS++Y G R++  LA+  + P+      + G P +  L + AFG 
Sbjct: 375 HFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRRGRPLLCFLVSLAFGC 434

Query: 441 LAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALM 500
           + F+  S    + F WLL I  ++  F W+ +S++H+RF   +  +G S +++ +KA   
Sbjct: 435 IGFVATSDAEEEVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMNEVGYKAQTG 494

Query: 501 PWLAYYAXXXXXXXXXXQGFTAFAPT-----FNGSDFVAAYIXXXXXXXXXXXXQLYFRC 555
            W ++ A          Q + A AP       N   F   Y+            ++YF+ 
Sbjct: 495 YWGSWLAVLIAVFFLVCQFWVAIAPVNDHGKLNVKVFFQNYLAMPIVLVAYFGHKIYFKS 554

Query: 556 KLYW 559
             +W
Sbjct: 555 WSFW 558

>Smik_15.146 Chr15 (252586..254367) [1782 bp, 593 aa] {ON} YOL020W
           (REAL)
          Length = 593

 Score =  197 bits (502), Expect = 5e-55,   Method: Compositional matrix adjust.
 Identities = 131/492 (26%), Positives = 218/492 (44%), Gaps = 22/492 (4%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           D  +P +D G    + +KR LK RH                     +   GP+G ++ + 
Sbjct: 64  DSFKPPLD-GSFDTSNLKRTLKPRHLIMIAIGGSIGTGLFVGSGKAIAEGGPLGVVLGWT 122

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
              + +      LGE+                   PSI      +Y   W     LE+  
Sbjct: 123 IAGSQIIGTIHGLGEITVRFPVVGAFANYGTRFLDPSISFVVSTIYVLQWFFVLPLEIIA 182

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
               +Q+W  ++    W+ I++ ++  +N+F  + +GE EF  +++K I + GF+I  + 
Sbjct: 183 AAMTVQYWNSSIDPVIWVAIFYAVIVCINLFGARGFGEAEFAFSTVKAITVCGFIILSIV 242

Query: 253 MVCGAGVTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
           ++CG G     +G +YW +PG    G          F G ++ L+ A+++  G E+  + 
Sbjct: 243 LICGGGPDHEFIGAKYWHDPGCLANG----------FPGVLAVLVVASYSLGGIEMTCLA 292

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAI 371
           +GE  +P K +P AIK+V                  VP+ +  L          PF+IA+
Sbjct: 293 SGET-DP-KGLPGAIKQVFWRILFFFLASLTLVGFLVPYTNQNLLGGSSVDNS-PFVIAM 349

Query: 372 QNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIA 431
           +    KVLP I NAVIL +++S GNS I+  SR +  +A   L P WFG   + G P + 
Sbjct: 350 KLHHIKVLPTIVNAVILISVLSVGNSCIFASSRTLCSMAHQGLIPWWFGYIDRAGRPLVG 409

Query: 432 VLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRD 491
           ++  S FG LAFL  S   A  FNWL+ I G+A    WL I+++H+RF   ++ +G S D
Sbjct: 410 IMANSLFGLLAFLVKSGSMADVFNWLMAIAGLATCIVWLSINLSHIRFRLAMKAQGKSLD 469

Query: 492 DLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSD-------FVAAYIXXXXXXX 544
           +L F +A+  W + Y+          Q + +  P    S        F   Y+       
Sbjct: 470 ELEFVSAVGIWGSAYSALINCLILIAQFYCSLWPIGGWSSGKERAKLFFQNYLCALIMLF 529

Query: 545 XXXXXQLYFRCK 556
                ++Y++C+
Sbjct: 530 IFVVHKIYYKCQ 541

>Suva_4.308 Chr4 complement(543427..545283) [1857 bp, 618 aa] {ON}
           YBR069C (REAL)
          Length = 618

 Score =  197 bits (502), Expect = 7e-55,   Method: Compositional matrix adjust.
 Identities = 122/445 (27%), Positives = 201/445 (45%), Gaps = 15/445 (3%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           +   + R +K RH                     L  AGP G ++ Y   + +++ + Q+
Sbjct: 86  ERNNLTRSIKSRHLIMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQA 145

Query: 145 LGEMAXXXXXXX-XXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
            GE+                    PS+G A   +Y   W     L+L      I++WT+ 
Sbjct: 146 AGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTIKYWTN- 204

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGP 262
           V    ++   +  + I+N+F  K Y E EF     K++ ++GF+I  + + CG AG    
Sbjct: 205 VNADIFVAAVFIFVIIINLFGSKGYAEAEFMFNICKILMVIGFVILAIVINCGGAGDRKF 264

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
           +G +YW NPGP+  G          F G  +    AAF+Y G E++ ++A E  NP K++
Sbjct: 265 IGTKYWHNPGPFAHG----------FKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTKSI 314

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXX--XXXPFIIAIQNSGTKVLP 380
           P A KKV                  VP++  +L            PF+IA+ + G KV+P
Sbjct: 315 PNACKKVVYRILFIYMLTTILICFLVPYNSDELLGSGSSSGSHASPFVIAVASHGVKVVP 374

Query: 381 HIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGA 440
           H  NAVIL ++IS  NS++Y   R++  LA+    P+      ++G P +  L +  FG 
Sbjct: 375 HFINAVILISVISVANSSLYSAPRLLLSLAEQGFLPKCLAYVDRNGRPLLCFLVSIIFGC 434

Query: 441 LAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALM 500
           + F+  S    + F WLL I  ++  F W+ +S++H+RF   +  +G S D++ +KA   
Sbjct: 435 IGFVATSDAEEQVFTWLLAISSLSQLFIWMSMSLSHIRFRDAMAKQGRSMDEVGYKAQTG 494

Query: 501 PWLAYYAXXXXXXXXXXQGFTAFAP 525
            W ++ A          Q + A AP
Sbjct: 495 YWGSWLAVLIALFFLVCQFWVAIAP 519

>Skud_2.192 Chr2 complement(344951..346810) [1860 bp, 619 aa] {ON}
           YBR069C (REAL)
          Length = 619

 Score =  197 bits (502), Expect = 8e-55,   Method: Compositional matrix adjust.
 Identities = 119/445 (26%), Positives = 204/445 (45%), Gaps = 15/445 (3%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           +   +++ +K RH                     L  AGP G ++ Y   + +++ + Q+
Sbjct: 86  EKNNLRKSIKSRHLVMISLGTGIGTGLLVGNGQVLGTAGPAGLVLGYGIASIMLYCIIQA 145

Query: 145 LGEMAXXXXXXX-XXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
            GE+                    PS+G A   +Y   W     L+L      +++WT+ 
Sbjct: 146 AGELGLCYAGLTGNYTRYSSILVDPSLGFAVSVVYTIQWLTVLPLQLVTAAMTVKYWTN- 204

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGP 262
           V    ++ + +  + I+N+F  + Y E EF     K++ + GF+I  + + CG AG    
Sbjct: 205 VNADIFVAVVFIFVIIINLFGSRGYAEAEFIFNICKILMVAGFVILAIVINCGGAGDRRY 264

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
           +G  YW NPGP+  G          F G  +    AAF+Y G E++ ++A E  NP +++
Sbjct: 265 IGTEYWHNPGPFAHG----------FKGVCTVFCYAAFSYGGIEVLLLSAAEQENPTESI 314

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXX--XXXPFIIAIQNSGTKVLP 380
           P A KKV                  VP++  +L            PF+IA+ + G KV+P
Sbjct: 315 PNACKKVVYRILLIYMLTTILIGFLVPYNSDELLGSGSSSGSHASPFVIAVSSHGVKVVP 374

Query: 381 HIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGA 440
           H  NAVIL ++IS  NS++Y G R++  LA+  + P+      ++G P +  L + AFG 
Sbjct: 375 HFINAVILISVISVANSSLYSGPRLLLSLAEQGVLPKCLAYVDRNGRPLLCFLVSLAFGC 434

Query: 441 LAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALM 500
           + F+  S+   + F WLL I  ++  F W+ + ++H+RF   +  +G S D++ +KA   
Sbjct: 435 IGFVATSNAEEQVFTWLLAISSLSQLFIWMSMCLSHIRFRDAMAKQGRSMDEVGYKAQTG 494

Query: 501 PWLAYYAXXXXXXXXXXQGFTAFAP 525
            W ++ A          Q + A AP
Sbjct: 495 YWGSWIAVLIAVFFLVCQFWVAIAP 519

>Kwal_34.16254 s34 (264235..265677) [1443 bp, 481 aa] {OFF} YOL020W
           (TAT2) - Tryptophan permease, high affinity [contig 265]
           PARTIAL
          Length = 481

 Score =  194 bits (493), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 125/429 (29%), Positives = 194/429 (45%), Gaps = 14/429 (3%)

Query: 80  DQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVF 139
           + G      +K+ LK RH                     L   GP+  +I +    T + 
Sbjct: 64  EDGSFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMV 123

Query: 140 SVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQF 199
                LGE+                   PSI      +Y   W     LE+      +++
Sbjct: 124 GTIHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEY 183

Query: 200 WTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGV 259
           W  +V    W+ I++ I+ ++N+  V+ +GE EF  + IKVI I+GF+I C+ ++CG G 
Sbjct: 184 WDTSVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGP 243

Query: 260 TGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 318
               VG +YW +PGP   G          F G    L+ A+++  GTE+  + +GE  +P
Sbjct: 244 KKEFVGAKYWHDPGPLANG----------FKGVAGVLVIASYSLGGTEMACLASGET-DP 292

Query: 319 RKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKV 378
            K +P AIK+V                  VP+ +  L          PF+IAI+  G   
Sbjct: 293 -KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGGSSVDNS-PFVIAIRLHGINA 350

Query: 379 LPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAF 438
           LP I NAVIL +++S GNS I+  SR +  +A   L PR FG   + G P   +L    F
Sbjct: 351 LPSIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLF 410

Query: 439 GALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAA 498
           G LAFL  S      F WL+ I G+A    WL I+I+H+RF   ++ +G+  ++L F + 
Sbjct: 411 GLLAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEFVSG 470

Query: 499 LMPWLAYYA 507
           +  + + Y+
Sbjct: 471 VGIYGSVYS 479

>Kwal_YGOB_34.16254 s34 (264235..265707) [1473 bp, 491 aa] {ON}
           ANNOTATED BY YGOB - YOL020W (TAT2) - Tryptophan
           permease, high affinity [contig 265] PARTIAL
          Length = 491

 Score =  194 bits (493), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 125/429 (29%), Positives = 194/429 (45%), Gaps = 14/429 (3%)

Query: 80  DQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVF 139
           + G      +K+ LK RH                     L   GP+  +I +    T + 
Sbjct: 64  EDGSFHSDNLKKSLKARHLVMIAIGGSIGTGLFIGSGKALALGGPLALIIGWTIAGTQMV 123

Query: 140 SVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQF 199
                LGE+                   PSI      +Y   W     LE+      +++
Sbjct: 124 GTIHGLGEITVRFPVVGAFADYGTRFLEPSISFVVVLIYVLQWCFVLPLEIIAAAMTVEY 183

Query: 200 WTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGV 259
           W  +V    W+ I++ I+ ++N+  V+ +GE EF  + IKVI I+GF+I C+ ++CG G 
Sbjct: 184 WDTSVSPVVWVAIFYGIIALINLVGVRGFGEAEFVFSLIKVITIVGFIILCIVLICGGGP 243

Query: 260 TGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANP 318
               VG +YW +PGP   G          F G    L+ A+++  GTE+  + +GE  +P
Sbjct: 244 KKEFVGAKYWHDPGPLANG----------FKGVAGVLVIASYSLGGTEMACLASGET-DP 292

Query: 319 RKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNSGTKV 378
            K +P AIK+V                  VP+ +  L          PF+IAI+  G   
Sbjct: 293 -KELPSAIKQVFWRIVFFFLVSLTLVGFLVPYTNQNLMGGSSVDNS-PFVIAIRLHGINA 350

Query: 379 LPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAF 438
           LP I NAVIL +++S GNS I+  SR +  +A   L PR FG   + G P   +L    F
Sbjct: 351 LPSIVNAVILVSLLSVGNSCIFASSRTLCSMAHQGLIPRVFGYIDRAGRPLTGILTNLLF 410

Query: 439 GALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAA 498
           G LAFL  S      F WL+ I G+A    WL I+I+H+RF   ++ +G+  ++L F + 
Sbjct: 411 GLLAFLVKSGSAGDVFTWLMAIAGLATCVVWLSINISHIRFRLAMKAQGVDLEELEFVSG 470

Query: 499 LMPWLAYYA 507
           +  + + Y+
Sbjct: 471 VGIYGSVYS 479

>KLLA0A06930g Chr1 complement(625498..627261) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  196 bits (499), Expect = 1e-54,   Method: Compositional matrix adjust.
 Identities = 133/425 (31%), Positives = 201/425 (47%), Gaps = 13/425 (3%)

Query: 86  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSL 145
           +A +KR LK RH                     L  AGP G LI +    T+++ +  ++
Sbjct: 73  NAPLKRTLKSRHLQMIGIGGAIGTGLFVGSGKSLATAGPAGILIGWALTGTMIYCMVMAM 132

Query: 146 GEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW-TDAV 204
           GE+A                   S G A   +Y   W IT  LE+      + +W T A 
Sbjct: 133 GELAVTFPVAGGYTTYASRFVDESFGFAFNTVYAMGWLITLPLEIVAASITVNYWGTPAK 192

Query: 205 PLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVG 264
              A++ +++ ++  +N+F VK YGE EF  + IKVIA++GF+I  + +VCG G  G   
Sbjct: 193 YRDAFVALFYVVIVGINLFGVKGYGEAEFIFSFIKVIAVIGFIILGVILVCGGGPQGGYI 252

Query: 265 F-RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 323
             R W NPG +  G          F G  S  + AAF++ G+ELVG+ A E ANPRK++P
Sbjct: 253 GGRLWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSIP 302

Query: 324 RAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX-XXXXXXXXXPFIIAIQNSGTKVLPHI 382
            A K+V                  VP+   +L           PF+I+IQN+G K LP +
Sbjct: 303 SAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSV 362

Query: 383 FNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALA 442
            N VIL  ++S GN  ++  SR M  LA     P+ FG   + G P + ++ T  FG L+
Sbjct: 363 INVVILIAVLSVGNCAVFGCSRSMAALANQGSLPKIFGYIDRTGRPLVGIVVTCVFGLLS 422

Query: 443 FLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPW 502
           F+  S    + F+WLL + G++  F W  I + H+R  + L  +  +  +L F A    W
Sbjct: 423 FIAASPKEGEVFDWLLALSGLSSLFTWGGILLCHIRVRRALAAQNRTTAELSFTAPTDVW 482

Query: 503 LAYYA 507
            + Y+
Sbjct: 483 GSVYS 487

>TBLA0I02010 Chr9 complement(455681..457567) [1887 bp, 628 aa] {ON}
           Anc_3.285 YBR069C
          Length = 628

 Score =  197 bits (500), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 116/399 (29%), Positives = 185/399 (46%), Gaps = 15/399 (3%)

Query: 86  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSL 145
           + ++ + +K RH                     L  +GP G +I Y   + +++ V Q+ 
Sbjct: 103 ETQLNKTMKPRHIVMISLGTGIGTGLLVGNGQVLSKSGPAGLVIGYGVASIMIYCVVQAA 162

Query: 146 GEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAV 204
           GE+                    P++G A   +Y   W     L+L      I++WT  V
Sbjct: 163 GELGLVYSRLTGNYTTYPTYLIDPAVGFAVSMLYTLQWLTVLPLQLVTAAMTIRYWTTNV 222

Query: 205 PLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGPV 263
               ++     ++  +NMF  K Y E EF+    K++ + GF+I  + + CG AG    +
Sbjct: 223 NPDIFVAAILVLVIAINMFGAKGYAEAEFFCNCCKLLMMAGFVILGIVINCGGAGDKEYI 282

Query: 264 GFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 323
           G +YW+ PG +  G          F G  +    AAF+Y G E++ +TA E ANPRK +P
Sbjct: 283 GVKYWQTPGAFANG----------FKGVAAVFCYAAFSYGGIEVLVLTANEQANPRKAIP 332

Query: 324 RAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX---XXXXXXPFIIAIQNSGTKVLP 380
            A +KV                  VP++ P L             PF+IA+ + G +V+P
Sbjct: 333 DACRKVVYRVLFLYMLTTIIVCFLVPYNSPALLGSNNDGSGSDASPFVIAVASHGVQVVP 392

Query: 381 HIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGA 440
           HI NA IL ++IS  NS++Y G R++  L++   AP+ F    + G P I VL + A G 
Sbjct: 393 HIINAAILISVISVANSSLYSGPRLLLSLSQQGYAPKCFNYIDRRGRPIICVLVSVAMGL 452

Query: 441 LAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRF 479
           +AFL       + F WLL + G++  F W+ I+I+H+RF
Sbjct: 453 IAFLAAIPAREEVFTWLLAVSGLSQIFIWMSITISHLRF 491

>NDAI0F04390 Chr6 (1073373..1075376) [2004 bp, 667 aa] {ON} Anc_1.50
          Length = 667

 Score =  197 bits (501), Expect = 2e-54,   Method: Compositional matrix adjust.
 Identities = 131/450 (29%), Positives = 212/450 (47%), Gaps = 9/450 (2%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           +  E+K+ +K RH                   + L  AGP G L+ +  M T ++ + Q+
Sbjct: 145 KSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVAAGPAGLLLGFGIMGTCLYCIIQA 204

Query: 145 LGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
           +GEMA                   P+ G +  ++Y   W     LEL      I++WT  
Sbjct: 205 VGEMAVAYSDLVGGFNAYPSFLVDPAFGFSVAWVYALQWLCVCPLELVTASMTIKYWTTK 264

Query: 204 VPLSAWIVIWWFILTIMNMFP-VKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVT-G 261
           V    +++I++ ++  +N+      Y E EF   S K++ ++GF I  + ++CG     G
Sbjct: 265 VDPDVFVIIFYVLILAINIVGGAAGYAEAEFIFNSCKILMMIGFFILGIIIICGGAGNDG 324

Query: 262 PVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 321
            +G +YW  PG +       + A  RF G +++L+NAAF +  +E +G+TA E +NPRK 
Sbjct: 325 YIGGKYWHEPGAF-----RGEHAIDRFKGVMATLVNAAFAFGMSEFIGVTASEQSNPRKA 379

Query: 322 VPRAIKKVSXXXXXXXXXXXXXXXXXVPFD-DPKLXXXXXXXXXXPFIIAIQNSGTKVLP 380
           +P A KK+                  VP+D D  L          P+++A+   G KV+P
Sbjct: 380 IPSAAKKMLYRIVCMFLASITIVGFLVPYDSDQLLGSSGGGVKASPYVLAVSTHGVKVVP 439

Query: 381 HIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGA 440
           H  NAVIL +++S  NS  Y  SR++  LA+   AP+ F    + G P + +   S FG 
Sbjct: 440 HFINAVILISVLSVANSAFYSSSRMLLSLAEQGYAPKIFCYIDREGRPLVGMAMASLFGV 499

Query: 441 LAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALM 500
           +AF   S    + F WLL I G++  F W+ I ++HVRF + +  +G S  +L F++ + 
Sbjct: 500 IAFCATSPKEDEVFVWLLAISGLSQLFTWIAICVSHVRFRRAMHVQGKSIGELGFRSQVG 559

Query: 501 PWLAYYAXXXXXXXXXXQGFTAFAPTFNGS 530
            W + YA          Q + A AP   G 
Sbjct: 560 AWGSSYAAIMMVCILIAQFWVAIAPIGEGK 589

>Kwal_27.10538 s27 (380769..382577) [1809 bp, 602 aa] {ON} YBR068C
           (BAP2) - probable amino acid permease for leucine,
           valine, and isoleucine [contig 35] FULL
          Length = 602

 Score =  195 bits (495), Expect = 7e-54,   Method: Compositional matrix adjust.
 Identities = 121/426 (28%), Positives = 188/426 (44%), Gaps = 9/426 (2%)

Query: 76  EPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMA 135
           E      V   + +KR +K RH                     L+  GP G +I Y  ++
Sbjct: 70  EHATTHSVASSSPLKRSIKPRHVAMMSICTGIGTGLLVANGKSLRFGGPAGLIIGYAAVS 129

Query: 136 TIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPS-IGAANGYMYWFSWAITFALELSVVG 194
            + + + Q+ GEMA                      G A  ++Y   W     LEL    
Sbjct: 130 VVAYIMMQAAGEMAVAYPSLPGNFNAYSSQLISRPFGFATVWLYCIQWLTVLPLELITAS 189

Query: 195 QIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMV 254
             I++W D++    +I I++  +  ++ F  + YGE EF     KV+ I+GF+I  + + 
Sbjct: 190 LTIKYWNDSINADVFIAIFYVFILFIHFFGSRGYGESEFIFGICKVLMIIGFVILSIVIN 249

Query: 255 CG-AGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAG 313
           CG AG    +G +YW +PG +  G         +F G    L+   F+Y GTEL  +T  
Sbjct: 250 CGGAGDRKYIGAKYWYDPGAFAVG-----SGATKFKGVAYVLVTGYFSYGGTELYAMTVN 304

Query: 314 EAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXX--XXXXXXPFIIAI 371
           E +NPR+ +    K+                   VP    +L            P+++A+
Sbjct: 305 EQSNPRRAIQSITKQCIYRILLIYMLTMILIGFLVPHTSSELMGSSGKSATHASPYVLAV 364

Query: 372 QNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIA 431
              G K++PHI NAVIL  +IS GNS +Y G R++  LA+   APR+     + G P +A
Sbjct: 365 SLHGVKIVPHIINAVILIAVISVGNSAMYSGPRILNTLAEQGYAPRFLAYVDRAGRPLVA 424

Query: 432 VLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRD 491
           ++  S FG LAF+  S      F WL  I G++  F W  I ++HVRF Q + +      
Sbjct: 425 LIACSVFGLLAFVAASDCEEDVFTWLAAIAGLSELFTWSAIMLSHVRFRQAMRYNNRPLS 484

Query: 492 DLPFKA 497
           +L +KA
Sbjct: 485 ELGYKA 490

>NCAS0A00420 Chr1 complement(62649..64688) [2040 bp, 679 aa] {ON}
           Anc_1.50
          Length = 679

 Score =  195 bits (496), Expect = 1e-53,   Method: Compositional matrix adjust.
 Identities = 123/445 (27%), Positives = 210/445 (47%), Gaps = 9/445 (2%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           +  E+K+ +K RH                   + L  AGP G +I +  M + ++ + Q+
Sbjct: 154 KSDELKKTIKPRHVLMISLGTGIGTGLLVGLGSSLVQAGPAGLIIGFGIMGSCLYCIIQA 213

Query: 145 LGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
           +GE+A                    +   A  ++Y   W     LEL      I++WT  
Sbjct: 214 VGELAVAYSDLVGGFNAYPSFLVDEAFCFAVAWLYAIQWLCVCPLELVTASMTIKYWTTK 273

Query: 204 VPLSAWIVIWWFILTIMNMFP-VKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTG 261
           V    +++I++ ++  +N+      Y E EF   S K++ ++GF I  + ++CG AG  G
Sbjct: 274 VDPDIFVIIFYILIIGINLLGGAAGYAEAEFIFNSCKIMMMIGFFILGITVICGGAGTDG 333

Query: 262 PVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKT 321
            +G +YW +PG      +    +  RF G +++L+NAAF +  +E +G+TA E +NPRK 
Sbjct: 334 YIGAKYWHDPGA-----LRGDTSIQRFKGCMATLVNAAFAFGMSEFIGVTASEQSNPRKA 388

Query: 322 VPRAIKKVSXXXXXXXXXXXXXXXXXVPFD-DPKLXXXXXXXXXXPFIIAIQNSGTKVLP 380
           +P A KK+                  VP++ D  L          P+++AI   G +V+P
Sbjct: 389 IPSAAKKMIYRILCMFLSSITIVGFLVPYNSDQLLGSTGSGVKASPYVLAISTHGVRVVP 448

Query: 381 HIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGA 440
           H  NAVIL +++S  NS  Y  SR++  LA+   AP+ +    + G P + +   + FG 
Sbjct: 449 HFINAVILISVLSVANSAYYSSSRMLLSLAEQGYAPKIYSYIDREGRPLVGMATAAIFGV 508

Query: 441 LAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALM 500
           +AF   S    + F WLL I G++  F W+ I I+H+RF + +  +G S  +L F++ + 
Sbjct: 509 IAFCATSPKEDEVFVWLLAISGLSQLFTWMAICISHIRFRRAMHVQGRSIGELGFRSQVG 568

Query: 501 PWLAYYAXXXXXXXXXXQGFTAFAP 525
            + + YA          Q + A  P
Sbjct: 569 WYGSAYAAIMMFMILIAQFWVALVP 593

>TDEL0F02830 Chr6 complement(513358..515043) [1686 bp, 561 aa] {ON} 
          Length = 561

 Score =  192 bits (487), Expect = 4e-53,   Method: Compositional matrix adjust.
 Identities = 137/464 (29%), Positives = 215/464 (46%), Gaps = 21/464 (4%)

Query: 80  DQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVF 139
           D   ++++ + R L  RH                  +  L   GP    I Y  M  +V+
Sbjct: 49  DHDKIRES-LNRSLSPRHINMISVAGVIGTGLYLSTAKSLHVGGPGSLFINYTIMGGVVY 107

Query: 140 SVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQF 199
                LGEM+                   S   A    YWF+ A++ A +L+ +  ++ +
Sbjct: 108 LTMLCLGEMSTFMPISGSFCSYAKKFGCESFAFALMCNYWFNDAVSVASDLTALQLVLDY 167

Query: 200 WTDA---VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG 256
           W  +    P  A  +++W  L  +N+  V+ YGE E+W+A +KVIAI+ F I  + +  G
Sbjct: 168 WKSSQHNFPYWAASLLFWVFLLGLNVIHVRVYGEAEYWLALLKVIAIVIFFILAIVVNVG 227

Query: 257 AGVTGP-VGFRYWR-NPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGE 314
                  +GF+YW     P+  G          F G+V+  +++AF+Y GTE + +TAGE
Sbjct: 228 HNPDHEYIGFKYWSYKEAPFVNG----------FKGFVTIFVSSAFSYGGTESITLTAGE 277

Query: 315 AANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNS 374
           A NP +  PR +K V                  +P+D P L          PF I  Q +
Sbjct: 278 ARNPIRNTPRIVKTVFWRILIFYVATMFFISMNIPYDYPNLSTKSVMTS--PFTIIFQMA 335

Query: 375 GTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLA-PRWFGITTKHGVPYIAVL 433
           GTK      NAVIL++I+SAGN  ++ GSRV++ +       P+    T ++  PY+AV+
Sbjct: 336 GTKAAGSFMNAVILTSIVSAGNHALFAGSRVLYNMGLEGFVFPKLITKTNRYRAPYVAVI 395

Query: 434 FTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDL 493
            T A G L F     G    + WL NIVGV+   AWL I++  +RF + L  +G ++ +L
Sbjct: 396 LTWAVGGLCFGASFIGAGTLWTWLQNIVGVSNQVAWLSIAVTSIRFRKGLAQQGKTQ-EL 454

Query: 494 PFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYI 537
            FK    P+  Y+           QG++AF P ++ SDF + Y+
Sbjct: 455 QFKNWTYPYGPYFLVIFVTLIILVQGWSAFDP-WSTSDFFSYYL 497

>TDEL0C05340 Chr3 complement(951770..953497) [1728 bp, 575 aa] {ON}
           Anc_3.397 YBR132C
          Length = 575

 Score =  192 bits (487), Expect = 5e-53,   Method: Compositional matrix adjust.
 Identities = 139/481 (28%), Positives = 210/481 (43%), Gaps = 26/481 (5%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           DED       ++   +  R LK RH                     L   GP   LIA+ 
Sbjct: 49  DEDS---SSDLLYSTQTFRRLKNRHVQLIAISGVIGTALFVAIGKALYKGGPAFLLIAFA 105

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
                +  +T S  EM                    S+     + +WF   +    E+  
Sbjct: 106 LWCVPILCITVSTAEMVCFLPVSSPFLRLAARCADDSLAVMASWNFWFLQCVQIPFEIVS 165

Query: 193 VGQIIQFWTD----AVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMG-FL 247
           V  II +W D    A+PL   IV+++ I    ++  VK+YGE EFW+AS K+I  +G FL
Sbjct: 166 VNTIIHYWRDDYSAAIPLVVQIVLYFLI----SICAVKYYGETEFWLASFKIILALGLFL 221

Query: 248 IYCLCMVCGAGVTGPVGFRYW-----RNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY 302
              + M+ G       GFRY+     +   P G     + V  G F G+++ LI A+FT 
Sbjct: 222 FTFITMLGGNPKHDRYGFRYYGETPFKKYYPNGDKDAGASV--GYFQGFLACLIQASFTI 279

Query: 303 QGTELVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXX 362
            G E + + AGE   PRK +PRA K+V                     +DP L       
Sbjct: 280 AGGEYISMLAGEVKLPRKVLPRAFKQVFYRLTFLFLGSCLCVGIICSANDPALTAAIDES 339

Query: 363 X----XXPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRW 418
                  P++IA+ N G KVLP I NA +++   SAGN+  Y  SR ++G+A    APR 
Sbjct: 340 RPGAGSSPYVIAMNNLGIKVLPDIVNAALITAAFSAGNAYTYCSSRTLYGMALDGYAPRI 399

Query: 419 FGITTKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVR 478
           F    KHGVP  +VL +  +G ++ L+++   A   NWL+N++  +    + ++ I ++ 
Sbjct: 400 FTRCNKHGVPIYSVLISLLWGLISLLQLNDNSAVVLNWLINLITASQLINFTVLCIIYLF 459

Query: 479 FIQT-LEHRGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTF-NGSDFVAAY 536
           F +  L H+ I    LPFK+   P+ A             QG+T F P+     DF+  Y
Sbjct: 460 FRRAYLLHKDI-LPKLPFKSWGQPYTAIVGLVSATAMILIQGYTVFFPSLWTVRDFLFCY 518

Query: 537 I 537
           +
Sbjct: 519 L 519

>KLLA0A10813g Chr1 complement(936126..937880) [1755 bp, 584 aa] {ON}
           similar to uniprot|P38967 Saccharomyces cerevisiae
           YOL020W TAT2 Tryptophan permease high affinity
          Length = 584

 Score =  191 bits (486), Expect = 7e-53,   Method: Compositional matrix adjust.
 Identities = 140/491 (28%), Positives = 217/491 (44%), Gaps = 22/491 (4%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           D  +P +D G      +KR+LK RH                     L   GP+  +I + 
Sbjct: 55  DSFKPPLD-GSYHSDNLKRKLKSRHLIMIAIGGSIGTGLFVGSGKALATGGPLAMIIGWS 113

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSV 192
              + +      LGE+                   PSI      +Y   W     +EL  
Sbjct: 114 IAGSQMVGTIHGLGEITMRFPVVGAFANYSTRLLDPSISFMVSSIYICQWYFVLPIELIA 173

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
               +QFWT  V    W+ I++ I+  +N+F VK +GE EF  + +KVI I+GF+I  + 
Sbjct: 174 SAMTVQFWTTKVDPVVWVAIFYVIVVSVNLFGVKVFGEAEFAFSLVKVITIIGFIILSII 233

Query: 253 MVCGAGVTGP-VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
           ++CG G     +G  YW +PG    G          F G  S  + A+++  G+E+V + 
Sbjct: 234 LICGGGPDHRFIGTEYWHHPGALANG----------FKGVASVFVTASYSLGGSEMVCLC 283

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAI 371
           + E  +P K +P AIK+V                  VP+ +  L          PF+IAI
Sbjct: 284 SAET-DP-KELPHAIKQVFWRIVFFFLVSLTLVGFLVPYTNENLLGGSSVNNS-PFVIAI 340

Query: 372 QNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIA 431
           + SG +VLP I NAVIL +I+S GNS I+  SR +  +A   L PR FG   + G P + 
Sbjct: 341 KLSGIRVLPSIINAVILISILSVGNSCIFASSRTLCSMAHQGLIPRVFGYVDRAGRPLVG 400

Query: 432 VLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRD 491
           ++  S FG LAFL  S+     F+WL+ I G+A    WL I+I+H+RF   ++ +  S D
Sbjct: 401 IIVNSLFGLLAFLVKSASMGVVFDWLMAIAGLATCVVWLSINISHIRFRLAMKAQNRSLD 460

Query: 492 DLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPT-------FNGSDFVAAYIXXXXXXX 544
           +L FK+++  + + Y+          Q + +  P             F   Y+       
Sbjct: 461 ELEFKSSVGVYGSIYSATVNILILIAQFYISLWPVGGWTSSQQRTESFFKNYLCALVLVF 520

Query: 545 XXXXXQLYFRC 555
                ++YF+C
Sbjct: 521 VFVTHKIYFKC 531

>ADL272W Chr4 (227414..229108) [1695 bp, 564 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YDR508C (GNP1)
          Length = 564

 Score =  191 bits (485), Expect = 9e-53,   Method: Compositional matrix adjust.
 Identities = 115/418 (27%), Positives = 193/418 (46%), Gaps = 12/418 (2%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           + A +++ +K RH                     +  AG  G+LI YL +  +V    QS
Sbjct: 21  EPASLRQSIKPRHVFMISMATGIGTGLLVGNGKSIATAGVGGTLIGYLIIGVMVVCCMQS 80

Query: 145 LGEMAXXXXXXXXXXXXXXXX-XXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
           +GE+                    PS+G    +++   W +   LEL      I++W   
Sbjct: 81  VGELVVAFPSLAGGFNSYGKKFIDPSLGFCVSWLFCLQWMVVLPLELVTASMTIKYWNSN 140

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGA-GVTGP 262
           +  S ++  ++ ++ I+N F    Y E EF    +KV+ +  F++  + ++ G  G +GP
Sbjct: 141 LSPSLFVSAFYILICIVNFFGSGGYAEAEFIFNCVKVMVLASFIVLGIVIITGGLGNSGP 200

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAA--NPRK 320
           +GF+Y + PG +             F     +L+NAAF+  G E + ++A E    N  K
Sbjct: 201 IGFQYLKTPGAF-------NTNYNVFKATAGTLVNAAFSCGGVEFLALSAAEQNRDNMPK 253

Query: 321 TVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXX-XXXXXXXPFIIAIQNSGTKVL 379
           ++ RA ++VS                 VP+D P L           P++ AI   G +++
Sbjct: 254 SIRRACRQVSIRMFVFYLLSISVVGLLVPYDSPMLMGSGSDTTHTSPYVAAIALHGVRIV 313

Query: 380 PHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFG 439
           PHI NAVIL  ++S  NS +Y  SR +  LA+   APR+F +  KHG P   ++ ++  G
Sbjct: 314 PHIINAVILIAVVSVANSAMYSSSRTLHSLAEQNFAPRYFALLNKHGQPMRCLVVSAIVG 373

Query: 440 ALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKA 497
            ++F+         F WLL+I G++  F W  I IAH+RF   L+ +G S D L +++
Sbjct: 374 LISFIAEYRDQEAVFVWLLSISGLSTIFTWTTICIAHIRFRNALKLQGQSLDTLGYRS 431

>KLLA0A06886g Chr1 complement(621646..623409) [1764 bp, 587 aa] {ON}
           similar to uniprot|P19145 Saccharomyces cerevisiae
           YKR039W GAP1 General amino acid permease localization to
           the plasma membrane is regulated by nitrogen source
          Length = 587

 Score =  191 bits (485), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 135/458 (29%), Positives = 206/458 (44%), Gaps = 16/458 (3%)

Query: 86  DAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSL 145
           +A +KR LK RH                     L  AGP G LI +    T+++ +  ++
Sbjct: 73  NAPLKRTLKSRHLQMIAIGGAIGTGLFVGSGKALATAGPAGILIGWALTGTMIYCMVMAM 132

Query: 146 GEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFW-TDAV 204
           GE+A                   S G A   +Y   W +   LE+      + +W T   
Sbjct: 133 GELAVTFPIAGGFTTYASRFVDESFGFAFNTIYMLQWLVVLPLEIVAASITVNYWGTPDK 192

Query: 205 PLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPVG 264
               ++ +++ ++  +N F VK YGE EF  + IKVI ++G++I  + +VCG G  G   
Sbjct: 193 YRDGFVALFYVVIVAINFFGVKGYGEAEFIFSFIKVITVIGYIILGVILVCGGGPQGGYI 252

Query: 265 F-RYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTVP 323
             R W NPG +  G          F G  S  + AAF++ G+ELVG+ A E ANPRK++P
Sbjct: 253 GGRLWHNPGAFANG----------FKGVCSVFVTAAFSFAGSELVGLAAAETANPRKSLP 302

Query: 324 RAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX-XXXXXXXXXPFIIAIQNSGTKVLPHI 382
            A K+V                  VP+   +L           PF+I+IQN+G K LP +
Sbjct: 303 SAAKQVFWRITLFYILALLMVGLLVPYTSDRLIGQSSVDAAASPFVISIQNAGIKGLPSV 362

Query: 383 FNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGALA 442
            N VIL  ++S GNS ++  SR M  LA     P+ FG   + G P + ++ T  FG L+
Sbjct: 363 INVVILIAVLSVGNSAVFACSRSMAALANQGSLPKIFGYIDRTGRPLVGIIVTCVFGLLS 422

Query: 443 FLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMPW 502
           F+  S    + F+WLL + G++  F W  I + H+R  + L  +  +  +L F A    W
Sbjct: 423 FIAASPKEGEVFDWLLALSGLSSLFTWGGIMLCHIRVRRALAAQNRTTAELSFTAPTGVW 482

Query: 503 LAYYAXXXXXXXXXXQGFTAFAPTFN---GSDFVAAYI 537
            + Y           Q + A  P  +    S F  AY+
Sbjct: 483 GSVYGFVLIILILMAQFWIALFPIGDKPSASAFFEAYL 520

>TPHA0B04750 Chr2 (1119282..1121201) [1920 bp, 639 aa] {ON} Anc_1.50
           YDR508C
          Length = 639

 Score =  192 bits (487), Expect = 1e-52,   Method: Compositional matrix adjust.
 Identities = 138/488 (28%), Positives = 227/488 (46%), Gaps = 13/488 (2%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           +  ++++ +K RH                  S+ L  AGP   +I Y  M + ++ + Q+
Sbjct: 118 ESDDLQKTIKPRHVIMISLGTGIGTGLLVGNSSVLSAAGPAPLVIGYSIMGSCLYCIIQA 177

Query: 145 LGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
            GEMA                   P++G +  ++Y   W     LEL      I++WT  
Sbjct: 178 AGEMAVVYSDLNGGFNNYPSFLLDPALGFSVAWVYCLQWLCVCPLELVTASLTIKYWTTK 237

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGP 262
           V    +++I++ ++  +N+F  + Y E EF+    KV+ ++GF I  + +  G AG  G 
Sbjct: 238 VDPDVFVIIFYVLIISINVFGARGYAEAEFFFNVCKVLMMIGFFILGIIITAGGAGNDGY 297

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
           +G +YW  PG +       + A  RF G + + + AAF +  TE + +TA E +NPRK +
Sbjct: 298 LGAKYWHEPGAF-----RGEHAVDRFKGVMDTFVAAAFAFGATEFIALTAAEQSNPRKAI 352

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFD-DPKLXXXXXXXXXXPFIIAIQNSGTKVLPH 381
           P A KKV                  VP+D D  L          P+++A+   G +V+PH
Sbjct: 353 PSAAKKVLYRIVLIFLVSIIMLGFLVPYDSDQLLGSSGSGVKASPYVLAVSLHGVRVVPH 412

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
             NAVIL +++S GNS  Y  SR++  L++   AP+WF    + G P  A+L ++ FG +
Sbjct: 413 FINAVILLSVLSVGNSAFYSSSRLLLSLSQQGYAPKWFDYVDRQGRPARAMLMSALFGVI 472

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
           AF   S      FNWLL I G++  F W  I ++HVRF   ++ +G S  ++ F +    
Sbjct: 473 AFCATSPKETDVFNWLLAISGLSQLFTWFAICMSHVRFRYAMKVQGRSIGEVGFHSQTGV 532

Query: 502 WLAYYAXXXXXXXXXXQGFTAFAP----TFNGSDFVAAYIXXXXXXXXXXXXQLYFRC-K 556
           + + YA          Q + A AP      +  +F  +Y+            +LY+R  K
Sbjct: 533 YGSLYAATMMILALMAQFWVAIAPLNEGKLDAQNFFQSYLAMPILIALYFGYKLYYRDWK 592

Query: 557 LYWSLDEV 564
           LY   D++
Sbjct: 593 LYIKADKI 600

>ZYRO0C18502g Chr3 complement(1448075..1449802) [1728 bp, 575 aa]
           {ON} similar to uniprot|P15380 Saccharomyces cerevisiae
           YOR348C PUT4 proline-specific permease (also capable of
           transporting alanine and glycine) putative proline-
           specific permease
          Length = 575

 Score =  190 bits (483), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 133/488 (27%), Positives = 223/488 (45%), Gaps = 16/488 (3%)

Query: 88  EVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQSLGE 147
           +++R LK RH                     L   GP   LI+Y+ M+  V+++   L E
Sbjct: 58  QMQRGLKSRHMQLIALGCAIGTGLFIGTGGALSTCGPAPLLISYIIMSFFVWTIMHQLTE 117

Query: 148 MAXXXXX--XXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDAVP 205
           M                       +    G+  +++ A+    E++    +IQ+WTDA  
Sbjct: 118 MVVLTPIPGEASMYALARAYLNRPLSFMCGWNLFYAQAMIAPSEITASTLLIQYWTDAN- 176

Query: 206 LSAWIVIWWFILTI-MNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGP-- 262
            SA  V  + ++TI +   PVK +GE EFWV+ IK+I I G +I  + +  G G      
Sbjct: 177 -SAIFVSIFIVITIAVTALPVKVFGESEFWVSMIKLITITGLIILGVVIFFGGGPNQHHV 235

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTY-QGTELVGITAGEAANPRKT 321
           +GF YW++PG + P I +     G+FL   +++I + F +    E +   + EA  PR+ 
Sbjct: 236 LGFHYWKHPGAFKPHISTGNT--GKFLAVWTAIIKSGFAFILSPETLTSCSAEADRPRRN 293

Query: 322 VPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXX----XXXXPFIIAIQNSGTK 377
           +PRA  +                   V +D+  L              PF+I I+  G K
Sbjct: 294 MPRAANRFVWRLMLFYIGGALVVGVTVGYDNQNLLSAIASGQSNAAASPFVIGIKEVGIK 353

Query: 378 VLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSA 437
           VLPHI NA IL+   SAG + +Y  SR++  +A    AP+ F    ++GVPY +++  S 
Sbjct: 354 VLPHIINAAILTGAYSAGTAEMYGASRMLHSMALKGNAPKIFARVNRYGVPYYSIIVPSC 413

Query: 438 FGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKA 497
           F  LA+L  S+  ++ F WL NI  ++GF +W+ +SI +VRF + +++  ++ D + F+ 
Sbjct: 414 FCFLAYLNCSNSASQVFTWLTNISTISGFISWVFVSITYVRFRRVIDYLDLN-DRIKFRK 472

Query: 498 ALMPWLAYYAXXXXXXXXXXQGFTAFAP-TFNGSDFVAAYIXXXXXXXXXXXXQLYFRCK 556
                 AY++           G+  F    ++ SDF A YI              Y++  
Sbjct: 473 PFQRIFAYFSGCFFVILSLTNGYAVFTKGNWSVSDFFANYITIGFVVVLFIMGTAYYKEW 532

Query: 557 LYWSLDEV 564
            +  ++E+
Sbjct: 533 RFRDMEEI 540

>ZYRO0G12342g Chr7 complement(976302..978164) [1863 bp, 620 aa] {ON}
           similar to uniprot|P41815 Saccharomyces cerevisiae
           YDR046C BAP3 Amino acid permease involved in the uptake
           of cysteine leucine isoleucine and valine
          Length = 620

 Score =  191 bits (485), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 135/475 (28%), Positives = 219/475 (46%), Gaps = 18/475 (3%)

Query: 74  EDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           +D+P  D  +V +A +K+ LK RH                     L NAGP   LI Y  
Sbjct: 86  QDDPEGD--MVSNAGLKQALKTRHVAMMSLGTGIGTGLLIANGKGLSNAGPAPLLIGYGL 143

Query: 134 MATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPS-IGAANGYMYWFSWAITFALELSV 192
           ++   + + Q+ GE+A                      G A  ++++  W   F +EL  
Sbjct: 144 VSVNTYFMVQAAGELAVAFPTIPGSFNAYTSQLVSRPFGFATTWLFFVQWLTMFPMELIA 203

Query: 193 VGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLC 252
           +   ++FWT  V    +++I++  L I++   V+ YGE EF++   KV+ ++GF+I+ +C
Sbjct: 204 MTFAVRFWTTRVDADVFVLIFFVFLFIVHFIGVEAYGETEFFLNLFKVLMVIGFVIFAIC 263

Query: 253 MVCG-AGVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGIT 311
           +  G AG +G +G +YW +PG +      S  AEGRF G    L++A F+Y GTEL  ++
Sbjct: 264 VAAGGAGDSGYIGAKYWHDPGAF-----VSHTAEGRFKGVCYVLVSAYFSYGGTELFVLS 318

Query: 312 AGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLX----XXXXXXXXXPF 367
             E  NPRKT+P A K                    VP + P+L              P+
Sbjct: 319 VNEQENPRKTIPTATKTTIYRIIFIYLLTMVLVGFTVPNNHPRLMGSPYAKEGVQSVSPY 378

Query: 368 IIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGV 427
           ++A      +VLPH  NAV++  ++S  NS +Y   R++  LA+    P++F    + G 
Sbjct: 379 VLAASYHHVRVLPHFINAVVMLALVSMSNSAMYAAPRLICSLAQQGYCPKYFDYIDRRGR 438

Query: 428 PYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRG 487
           P  A++     G +AF   S      F+WL  I G++  F W  I ++HVRF   ++ +G
Sbjct: 439 PTRALVLCFIIGVIAFASSSEKRETIFSWLSAIAGLSELFTWSSIMLSHVRFRAAIKVQG 498

Query: 488 ISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAF-APTFNG----SDFVAAYI 537
              ++L +K+    W + Y           Q + A  AP   G    SDF  +Y+
Sbjct: 499 KDINELGYKSNTGVWGSAYGVFFSLLVFAAQFWVALSAPNSGGKCSASDFFQSYL 553

>TDEL0D00200 Chr4 (32432..34135) [1704 bp, 567 aa] {ON} 
          Length = 567

 Score =  190 bits (482), Expect = 2e-52,   Method: Compositional matrix adjust.
 Identities = 133/503 (26%), Positives = 225/503 (44%), Gaps = 24/503 (4%)

Query: 80  DQGVVQDAEVK------RELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLF 133
           +QG + + EVK      R LK RH                     L   GP   LI+Y+ 
Sbjct: 36  EQGSISELEVKPQNEMVRGLKSRHIQLIALGDAIGTGLFIGSGGALSTCGPAPILISYIV 95

Query: 134 MATIVFSVTQSLGEMAXXXXX--XXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELS 191
           M+  V+++   L EM                       +    G+  +++ A+    E++
Sbjct: 96  MSFFVWTIVNQLTEMVALIPLPGEASMYSLARMYVGRPLAFMCGWNLFYAMAMIAPSEIT 155

Query: 192 VVGQIIQFWTDAVPLSAWIVIWWFIL--TIMNMFPVKFYGEFEFWVASIKVIAIMGFLIY 249
               +IQ+WTDA   ++ I I  FI+    + M PV+ +GE EF V+SIK++ I+G +I 
Sbjct: 156 ACAMLIQYWTDA---NSAIFISIFIVFSVAITMLPVRVFGESEFCVSSIKLLTIVGLIIV 212

Query: 250 CLCMVCGAGVTGP--VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGT-E 306
            + +  G G +    +GF YW+ PG +   ++    + G+FL   +++I + F++    E
Sbjct: 213 GIVIFFGGGPSQDHILGFHYWKKPGAFKEHLVPG--STGKFLAVWTAIIKSGFSFVLVPE 270

Query: 307 LVGITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXX----XXXX 362
            V   + E+A+PR+ +PRA ++                   V  DD  L           
Sbjct: 271 TVASCSAESASPRRNMPRACQRFVYRLALFYVAGVLVVTVVVGSDDANLLNAIHSGASNA 330

Query: 363 XXXPFIIAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGIT 422
              P++I I+ +G KVLPHI NA IL++  S G + +Y  SR++  +A    AP+ F   
Sbjct: 331 AASPYVIGIKEAGIKVLPHIINACILTSAYSCGTAELYGCSRILHSMAMKGDAPQIFAKV 390

Query: 423 TKHGVPYIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQT 482
            + GVPY +      F  LA+L  S   +  FNWL NI  ++GF +W+ +S+ + RF   
Sbjct: 391 NRFGVPYYSTAVACLFTLLAYLNCSKSSSLVFNWLSNIATISGFISWVFVSVTYTRFRTV 450

Query: 483 LEHRGISRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP-TFNGSDFVAAYIXXXX 541
           ++   ++ D +PF+       AY             G+  F    +N SDF A+Y+    
Sbjct: 451 IDKLDLN-DRIPFRRRFQKGFAYACIAFFVLLSLTNGYAVFIKGNWNTSDFFASYVTIGF 509

Query: 542 XXXXXXXXQLYFRCKLYWSLDEV 564
                    +Y++   +  + E+
Sbjct: 510 VAVLFIGSTIYYKELRFRDVSEI 532

>CAGL0M00154g Chr13 (22039..23691) [1653 bp, 550 aa] {ON} similar to
           uniprot|P32487 Saccharomyces cerevisiae YNL268w LYP1 or
           uniprot|P04817 Saccharomyces cerevisiae YEL063c CAN1
          Length = 550

 Score =  189 bits (480), Expect = 3e-52,   Method: Compositional matrix adjust.
 Identities = 136/464 (29%), Positives = 211/464 (45%), Gaps = 22/464 (4%)

Query: 80  DQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVF 139
           +Q + +D  + R L  RH                  +  L N GP    + Y  +  +V+
Sbjct: 39  EQNIRED--LTRALSPRHINMISIAGIIGTGLYLSTAKSLHNGGPASLFMNYTIIGGVVY 96

Query: 140 SVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQF 199
                LGEM+                   S   A  + YWF+ A++ A +L+ +  ++ +
Sbjct: 97  LTMLCLGEMSTFMPISGSFCSYARKFGSESFACALMWNYWFNDAVSVASDLTALQLVLDY 156

Query: 200 WTDA---VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG 256
           W  A    P     +I+WF +  +N+  V+ YGE E+W+A +KVIAI+ F I  + +  G
Sbjct: 157 WHTADHHFPYWGASLIFWFFVLFLNVIHVRIYGEAEYWLAMLKVIAIVIFFIMSIIVNVG 216

Query: 257 AGVTGP-VGFRYWRN-PGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGE 314
                  +GF+ W +   P+  G          F G+ S  ++A F Y GTE + +T GE
Sbjct: 217 KNPQHEYIGFKNWTHGEAPFVNG----------FKGFASLFVSACFAYGGTESITLTGGE 266

Query: 315 AANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFIIAIQNS 374
           A+NP +  P+ +K V                  +P+D P L          PF +  Q +
Sbjct: 267 ASNPVRNTPKIVKTVFWRILIFYVLSTFFIGMNIPYDYPGLSTKSVMTS--PFTLVFQMA 324

Query: 375 GTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWF-GITTKHGVPYIAVL 433
           GT+      NAVIL+++ISA N  ++ GSR+M+ +A     P+   G T ++  PY+AVL
Sbjct: 325 GTRGAGSFMNAVILTSVISACNHALFAGSRIMYNMALDGYLPKKIVGRTNRYKAPYVAVL 384

Query: 434 FTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDL 493
            T A G L       G    + WL NIVGV+   AWL I I  +RF + LE +G   D L
Sbjct: 385 ITWAVGGLCLGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEVQG-KTDLL 443

Query: 494 PFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYI 537
            FK    P+  Y+           QG+ AF P ++ +DF + Y+
Sbjct: 444 QFKNWTYPFGPYFLVIFTVFIILIQGWQAFDP-WSVTDFFSVYL 486

>NDAI0A01340 Chr1 (296616..298280) [1665 bp, 554 aa] {ON} 
          Length = 554

 Score =  189 bits (480), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 140/469 (29%), Positives = 222/469 (47%), Gaps = 21/469 (4%)

Query: 75  DEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFM 134
           DE Y  +  +++ ++ R LK R                   S  L   GP    + Y  M
Sbjct: 37  DENYDPEANIRE-DLTRALKPRVVNMISIAGIIGTGLYLSTSKSLHTGGPASLFMNYTIM 95

Query: 135 ATIVFSVTQSLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVG 194
             +V+    +LGEM+                   S   A  + YWF+ A++ A +L+ + 
Sbjct: 96  GGVVYLTLLALGEMSTYMPISGSFCVYARKFGSESFACALMWNYWFNDAVSVASDLTALQ 155

Query: 195 QIIQFWTDA---VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCL 251
            ++ +W  +    P  A  +I+WF++  +N+  V+FYGE E+W+A +K+IAI+ F I  +
Sbjct: 156 LVMDYWKTSEHGFPYWAASLIFWFVVVCLNVIHVRFYGEAEYWLAMLKIIAIIIFFILSI 215

Query: 252 CMVCGAGVTGP-VGFRYW-RNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVG 309
            +  G       +GF+ W R   P+  GI           G+ S  ++A+F Y GTE + 
Sbjct: 216 VVNVGKNPQHEYIGFKNWTRGEAPFVDGI----------KGFASLFVSASFAYGGTESIT 265

Query: 310 ITAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXXPFII 369
           +T GEA NP +  P+ +K V                  +P+D P L          PF +
Sbjct: 266 LTNGEAENPIRNTPKIVKTVFWRILIFYVGSTFFIAMNIPYDYPGLDSKSIVTS--PFTL 323

Query: 370 AIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAP-RWFGITTKHGVP 428
             Q +GTK      NAVI++++ISA N  ++ GSR+M+ +      P R    T ++ VP
Sbjct: 324 VFQMAGTKGAGSFMNAVIMTSVISACNHALFAGSRIMYNMGLEGFLPARIVSRTNRNKVP 383

Query: 429 YIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGI 488
           Y++VL T+A GAL F     G    + WL NIVGV+   AWL I I  +RF + LE +G 
Sbjct: 384 YVSVLITAAVGALCFGASFIGAGTLWTWLQNIVGVSNQIAWLCIGITSIRFRKGLEKQGK 443

Query: 489 SRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAPTFNGSDFVAAYI 537
           +  +L +K    P+  Y+           QG++AFAP +N S+F + Y+
Sbjct: 444 TH-ELIYKNWTYPYGPYFVIIFVSFIILIQGWSAFAP-WNVSNFFSYYL 490

>NCAS0I01520 Chr9 (284348..286192) [1845 bp, 614 aa] {ON} 
          Length = 614

 Score =  190 bits (483), Expect = 4e-52,   Method: Compositional matrix adjust.
 Identities = 126/444 (28%), Positives = 202/444 (45%), Gaps = 14/444 (3%)

Query: 85  QDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQS 144
           QD ++ + +K RH                     L  AGP G +I Y   + +++ +  +
Sbjct: 97  QDTQLSKTIKSRHLLMISLGTGIATGLLVGNGQVLAKAGPAGLIIGYTVSSIMIYCIIHA 156

Query: 145 LGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
            GE+                    PS+G A   +Y   W     L+L      I FWTD 
Sbjct: 157 AGELGICYRGLVGNFTRYPSILIDPSLGFAISLLYTLQWLTVLPLQLVTAAITISFWTDV 216

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCG-AGVTGP 262
            P   +++  + ++ I+N+F  + Y E EF+    K++ I GF+I  + ++ G AG  G 
Sbjct: 217 NP-DIFVLCVFIVVIIVNLFGARGYAETEFFCNCCKILMITGFIILSIVIITGGAGKDGY 275

Query: 263 VGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
           +G +YW +PGP+  G          F G  +    AAF+Y G E+V ++  E  +P   V
Sbjct: 276 IGAKYWIHPGPFAHG----------FKGVCTVFTYAAFSYGGIEVVVLSIDEQEDPVSAV 325

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXX-PFIIAIQNSGTKVLPH 381
           P A KKV                  VP+D P L           PF+IAI++ G KV+PH
Sbjct: 326 PNACKKVVYRILLIYLLTTILVCFLVPYDSPNLLGSSHSGSHASPFVIAIESHGVKVVPH 385

Query: 382 IFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAFGAL 441
             NAVIL ++IS  NS++Y  SR++  L++    P+W      +G P    + +  FG +
Sbjct: 386 FINAVILISVISVANSSLYSSSRLLLSLSEQGSLPQWLNFIDMNGRPIRCFIISILFGMI 445

Query: 442 AFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAALMP 501
            F+  S      F WLL I G++  F W+ +S++H+R    ++ +G S D++ +KA    
Sbjct: 446 GFVAASDKREDVFTWLLAISGLSQLFIWMSMSLSHIRLRDAMKSQGKSLDEIGYKAQTGY 505

Query: 502 WLAYYAXXXXXXXXXXQGFTAFAP 525
           W ++ A          Q + A AP
Sbjct: 506 WGSWLAVFIGFFSLVTQFWVAIAP 529

>KLTH0B00154g Chr2 complement(7385..9055) [1671 bp, 556 aa] {ON}
           weakly similar to uniprot|P38090 Saccharomyces
           cerevisiae YBR132C High affinity polyamine permease,
           preferentially uses spermidine over putrescine;
           expression is down-regulated by osmotic stress; plasma
           membrane carnitine transporter, also functions as a
           low-affinity amino acid permease
          Length = 556

 Score =  188 bits (477), Expect = 9e-52,   Method: Compositional matrix adjust.
 Identities = 130/508 (25%), Positives = 229/508 (45%), Gaps = 10/508 (1%)

Query: 84  VQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYLFMATIVFSVTQ 143
           +++   +R+L  R                    T + + GP   LIA+   + +   ++Q
Sbjct: 40  LEERIARRKLFPRQVSMIGIGGAIGTALFVSIGTQIIHGGPGSLLIAFCLWSVVFIGLSQ 99

Query: 144 SLGEMAXXXXXXXXXXXXXXXXXXPSIGAANGYMYWFSWAITFALELSVVGQIIQFWTDA 203
            +  M                    S G + G+ Y+   A     E++ V  +++FWTD 
Sbjct: 100 CMCVMVTYLPVTGSFVHFTERFVDSSCGFSVGWTYFVCQAANVCFEITAVCLVVEFWTDK 159

Query: 204 VPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCLCMVCGAGVTGPV 263
           +P +A I I   +   +N+F V  +GE EF+++  KVI  +G + + + ++ G      V
Sbjct: 160 IPKAALISILIALFGSLNLFSVFIFGEGEFYLSIGKVILAIGLIFFTIVVMAGGNPQHKV 219

Query: 264 -GFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGITAGEAANPRKTV 322
            GF+ W NPG +   I  S+ + G+F G++S LI A + + G + +G  A EA NPRK +
Sbjct: 220 LGFKNWSNPGAFAEYI--SKGSAGKFHGFMSCLIFALYVFWGVDYLGNAASEAMNPRKVI 277

Query: 323 PRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXX----XXPFIIAIQNSGTKV 378
           P + +KV                  VPF+D  +              P++ A++  G  V
Sbjct: 278 PSSFRKVFGRLIIFYIGGAICVGILVPFNDHNMIKAISEGAVGAGASPYVSAMKTLGIGV 337

Query: 379 LPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVPYIAVLFTSAF 438
           LPHI N +IL++IISAGNS++Y  SRV+  LA    AP+ F I TK GVP    +     
Sbjct: 338 LPHIVNVLILTSIISAGNSSLYSASRVLHRLALEGQAPKLFKI-TKRGVPIYCCVAVLLV 396

Query: 439 GALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGISRDDLPFKAA 498
             LA+L VS+       W LN+   A    ++ I I++++F +  + + I    LP+ ++
Sbjct: 397 CGLAYLSVSNSTNNVLTWFLNVETAAMAIVYIFICISYLQFAKGCKAQNIDLKTLPYSSS 456

Query: 499 LMPWLAYYAXXXXXXXXXXQGFTAF-APTFNGSDFVAAYIXXXXXXXXXXXXQLYFRCKL 557
            +P+L +++           G+  F   +++   F+ +Y             +LY + + 
Sbjct: 457 FLPYLGWHSLFWLVLMLFMNGYAVFLKDSWDLQSFIFSYFMIPFFIVLFAGHKLYKKTRF 516

Query: 558 YWSLD-EVXXXXXXXXXXXXXWEDSAPK 584
              ++ ++             WE++ PK
Sbjct: 517 VKPVEMDLFSGIAELAEEDAYWEENPPK 544

>Kpol_1052.14 s1052 (39793..41601) [1809 bp, 602 aa] {ON}
           (39793..41601) [1809 nt, 603 aa]
          Length = 602

 Score =  189 bits (479), Expect = 1e-51,   Method: Compositional matrix adjust.
 Identities = 132/457 (28%), Positives = 210/457 (45%), Gaps = 16/457 (3%)

Query: 73  DEDEPYVDQGVVQDAEVKRELKQRHXXXXXXXXXXXXXXXXXXSTPLKNAGPVGSLIAYL 132
           D+ +P  ++   ++ ++ R +K RH                     L  +GP G +I Y 
Sbjct: 77  DDSKPLENEEKTEN-QLNRSIKSRHLLMISLGTGIGTGLLVGNGQVLAKSGPAGLVIGYG 135

Query: 133 FMATIVFSVTQSLGEMAXXXXXXXXXXXXX-XXXXXPSIGAANGYMYWFSWAITFALELS 191
             + +V+ + Q+ GE+                    P++G A   +Y   W     L+L 
Sbjct: 136 VASIMVYFIVQAAGELGICYSGLTGNYIRYPSILVDPALGFAISIIYTLQWLTVMPLQLV 195

Query: 192 VVGQIIQFWTDAVPLSAWIVIWWFILTIMNMFPVKFYGEFEFWVASIKVIAIMGFLIYCL 251
                I +WT+  P + ++ I   I+ + N F  K Y E EF     KV+ ++GF++  +
Sbjct: 196 TAAMTIGYWTNINP-NIFVAIVLVIVVLTNCFGAKGYVEAEFLCNIFKVLMMVGFVLLAI 254

Query: 252 CMVCGA-GVTGPVGFRYWRNPGPWGPGIISSQVAEGRFLGWVSSLINAAFTYQGTELVGI 310
            +  GA G  G +G  YW+NPG +  G          F G  S    AAF+Y G E++ +
Sbjct: 255 LINTGAIGTDGYIGTIYWKNPGAFANG----------FKGVCSVFCYAAFSYGGIEVLAL 304

Query: 311 TAGEAANPRKTVPRAIKKVSXXXXXXXXXXXXXXXXXVPFDDPKLXXXXXXXXXX--PFI 368
           TA E  NP K +P A KK                   VP+D P+L            PF+
Sbjct: 305 TAAEQENPIKAIPSACKKTVYRILFLYMLTTILIGFLVPYDSPQLMGSTSGGGSHSSPFV 364

Query: 369 IAIQNSGTKVLPHIFNAVILSTIISAGNSNIYVGSRVMFGLAKTKLAPRWFGITTKHGVP 428
           IAI + G KV+PH+ NAVIL +I+S  NS  Y  +R++  L++    P+ F    K G P
Sbjct: 365 IAIASHGVKVVPHLINAVILISIVSVANSAFYSSTRLLLSLSEQGKIPKIFNYVDKEGRP 424

Query: 429 YIAVLFTSAFGALAFLEVSSGGAKAFNWLLNIVGVAGFFAWLLISIAHVRFIQTLEHRGI 488
           +  +LF S FG++ F+  S    + F WLL I G++  F W+ I ++H+RF + +  +G 
Sbjct: 425 WYCILFASLFGSIGFVASSPYKEEVFTWLLAISGLSQIFLWMSICLSHIRFRRAMIKQGK 484

Query: 489 SRDDLPFKAALMPWLAYYAXXXXXXXXXXQGFTAFAP 525
           S D++ +KA    W ++ A          Q + A AP
Sbjct: 485 SLDEIGYKAPTGCWGSWIALSIALFSLISQFWVAIAP 521

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.324    0.138    0.442 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 46,178,411
Number of extensions: 1520782
Number of successful extensions: 5655
Number of sequences better than 10.0: 349
Number of HSP's gapped: 4305
Number of HSP's successfully gapped: 374
Length of query: 595
Length of database: 53,481,399
Length adjustment: 115
Effective length of query: 480
Effective length of database: 40,294,809
Effective search space: 19341508320
Effective search space used: 19341508320
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.0 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.6 bits)
S2: 69 (31.2 bits)