Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_191.16.8ON1391396536e-89
Kpol_1045.796.8ON5081361871e-16
TPHA0M001806.8ON5031411597e-13
TDEL0G046306.8ON5031301571e-12
KNAG0E027706.8ON5081371562e-12
TPHA0J002606.8ON5151381501e-11
KAFR0B065106.8ON5081361421e-10
NCAS0D021806.8ON5151381253e-08
TBLA0A072206.8ON5091381235e-08
NDAI0G00860singletonON5231401174e-07
CAGL0A01089g6.8ON5351531156e-07
YPL272C6.8ON5171451103e-06
Smik_6.4806.8ON5161451103e-06
Skud_16.56.8ON5151451086e-06
KLTH0C11572g6.8ON5181361076e-06
SAKL0E00792g6.8ON5111391014e-05
Ecym_30116.8ON5091381014e-05
Suva_16.336.8ON5181451007e-05
Kwal_56.223416.8ON519137780.050
TBLA0E013104.128ON117959730.24
Smik_11.170na 1ON10653641.6
KLLA0E14323g8.89ON23252634.2
NOTE: 1 genes in the same pillar as Kpol_191.1 were not hit in these BLAST results
LIST: ACR018C

BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_191.1
         (139 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON} compl...   256   6e-89
Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa] ...    77   1e-16
TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8 ...    66   7e-13
TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {O...    65   1e-12
KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8...    65   2e-12
TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8 ...    62   1e-11
KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa] ...    59   1e-10
NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8       53   3e-08
TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6...    52   5e-08
NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON}               50   4e-07
CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {...    49   6e-07
YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON} Pu...    47   3e-06
Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C ...    47   3e-06
Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON} YP...    46   6e-06
KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {...    46   6e-06
SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar ...    44   4e-05
Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to ...    44   4e-05
Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}...    43   7e-05
Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C ...    35   0.050
TBLA0E01310 Chr5 complement(290546..294036,294188..294236) [3540...    33   0.24 
Smik_11.170 Chr11 (291020..291340) [321 bp, 106 aa] {ON} YKL071W...    29   1.6  
KLLA0E14323g Chr5 (1266372..1267070) [699 bp, 232 aa] {ON} highl...    29   4.2  

>Kpol_191.1 s191 complement(429..848) [420 bp, 139 aa] {ON}
           complement(429..848) [420 nt, 140 aa]
          Length = 139

 Score =  256 bits (653), Expect = 6e-89,   Method: Compositional matrix adjust.
 Identities = 127/139 (91%), Positives = 127/139 (91%)

Query: 1   MLRILNESEKSALKQTSEGSMNGIIFSVKISKKCEDNLSDDATLHTTGESGNXXXXXXXX 60
           MLRILNESEKSALKQTSEGSMNGIIFSVKISKKCEDNLSDDATLHTTGESGN        
Sbjct: 1   MLRILNESEKSALKQTSEGSMNGIIFSVKISKKCEDNLSDDATLHTTGESGNLQLLLLKS 60

Query: 61  XXXXIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLINSI 120
               IPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLINSI
Sbjct: 61  LKLLIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLINSI 120

Query: 121 YYHSNFQPGSGKPYGKLPC 139
           YYHSNFQPGSGKPYGKLPC
Sbjct: 121 YYHSNFQPGSGKPYGKLPC 139

>Kpol_1045.79 s1045 complement(184348..185874) [1527 bp, 508 aa]
           {ON} complement(184350..185876) [1527 nt, 509 aa]
          Length = 508

 Score = 76.6 bits (187), Expect = 1e-16,   Method: Compositional matrix adjust.
 Identities = 47/136 (34%), Positives = 65/136 (47%)

Query: 2   LRILNESEKSALKQTSEGSMNGIIFSVKISKKCEDNLSDDATLHTTGESGNXXXXXXXXX 61
            R L   EK  + Q   G  NGIIFS K     +D L+DDATL T  E            
Sbjct: 4   FRQLGTYEKKLVGQALAGQSNGIIFSAKYISNAQDGLTDDATLLTNSEPLLLDSRLVNAL 63

Query: 62  XXXIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLINSIY 121
              + K+ EL TTV+E L F  + E+KT+D++  + +   K +      G    L+  I+
Sbjct: 64  QKMVLKHPELRTTVNEKLEFEEVKEIKTSDIITSVKFDSLKDEFVNCHLGAPPYLLRHIF 123

Query: 122 YHSNFQPGSGKPYGKL 137
             + F PGSGKP  +L
Sbjct: 124 NRNKFTPGSGKPLWEL 139

>TPHA0M00180 Chr13 (36974..38485) [1512 bp, 503 aa] {ON} Anc_6.8
           YPL272C
          Length = 503

 Score = 65.9 bits (159), Expect = 7e-13,   Method: Compositional matrix adjust.
 Identities = 47/141 (33%), Positives = 73/141 (51%), Gaps = 7/141 (4%)

Query: 2   LRILNESEKSALKQTSEGSMNGIIFSVKIS--KKCEDNLSDDATLHTTGESGNXXXXXX- 58
            R L   EK  L QT EG  NG++FS +I+  KK ++   D+ATL+T G S N       
Sbjct: 3   FRALGGYEKKVLAQTIEGRRNGVVFSSQITFNKKSDEFADDNATLYT-GRSVNEVSLKSV 61

Query: 59  --XXXXXXIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSL 116
                   I  + EL TT+++ L+F  + +++T DV+K I+Y + K D        S  L
Sbjct: 62  LCAALQNIICNHVELYTTINDRLYFTPVLQIETNDVIKTISYDKSK-DKALMKDQISDKL 120

Query: 117 INSIYYHSNFQPGSGKPYGKL 137
           +  I+   +F+P +GKP  + 
Sbjct: 121 LRHIFNKCDFKPNNGKPLWQF 141

>TDEL0G04630 Chr7 complement(843474..844985) [1512 bp, 503 aa] {ON}
           Anc_6.8 YPL272C
          Length = 503

 Score = 65.1 bits (157), Expect = 1e-12,   Method: Compositional matrix adjust.
 Identities = 42/130 (32%), Positives = 60/130 (46%), Gaps = 1/130 (0%)

Query: 2   LRILNESEKSALKQTSEGSMNGIIFSVKISKKCEDNLSDDATLHTTGESGNXXXXXXXXX 61
            R L   EK  L Q+ EG  NG++F    S   E+  SDDATL T  +S           
Sbjct: 3   FRSLGGFEKKILSQSLEGHRNGVVFGAMYSTTPEE-WSDDATLLTYKDSRLNLSLLSRTL 61

Query: 62  XXXIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLINSIY 121
              I  + EL TT++E L F  + E+K  +V+  + +   K +      G    L+  I+
Sbjct: 62  AKMISDHVELFTTINEKLEFAPVKEIKAEEVINAVTFGSYKDEFVNCRFGAPPYLLRHIF 121

Query: 122 YHSNFQPGSG 131
             + FQPGSG
Sbjct: 122 NQTTFQPGSG 131

>KNAG0E02770 Chr5 (557579..559105) [1527 bp, 508 aa] {ON} Anc_6.8
           YPL272C
          Length = 508

 Score = 64.7 bits (156), Expect = 2e-12,   Method: Compositional matrix adjust.
 Identities = 47/137 (34%), Positives = 66/137 (48%), Gaps = 2/137 (1%)

Query: 2   LRILNESEKSALKQTSEGSMNGIIFSVKISKKCEDNLSDDATLHTTGESGNXXXXXXXXX 61
           +R L+  EK  L Q+ +G  NG  F  + S   E    ++ATL T  +S           
Sbjct: 4   VRALSSFEKKLLLQSVDGLKNGTTFGAEYSTFKEGWSDEEATLLTVKDSRLCLGLLTKAL 63

Query: 62  XXXIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFD-INEGLSGPSSSLINSI 120
              I K+ EL  T++E   F  L ++KT+DV+  I +   K + IN  L  P   L+  I
Sbjct: 64  ENLIKKHIELFLTINEQFEFEVLKKIKTSDVISTIQFDSFKDEKINCQLGAPPY-LLRHI 122

Query: 121 YYHSNFQPGSGKPYGKL 137
           + H  F PGSGKP  KL
Sbjct: 123 FNHDRFVPGSGKPLWKL 139

>TPHA0J00260 Chr10 (59857..61404) [1548 bp, 515 aa] {ON} Anc_6.8
           YPL272C
          Length = 515

 Score = 62.4 bits (150), Expect = 1e-11,   Method: Compositional matrix adjust.
 Identities = 44/138 (31%), Positives = 64/138 (46%), Gaps = 2/138 (1%)

Query: 2   LRILNESEKSALKQTSEGSMNGIIFSVKISK-KCEDNLSDDA-TLHTTGESGNXXXXXXX 59
            R L   E++ L ++ E   NG IFS K +  +    ++DDA TL T  E  N       
Sbjct: 3   FRPLASYERNVLIESYENQTNGTIFSAKYTDMQTNSTINDDAATLLTQNEENNMFSRFIN 62

Query: 60  XXXXXIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLINS 119
                I +  EL TT++  L F  + E+KT DV+  I ++  K +     +G    L+  
Sbjct: 63  ALATVITENPELYTTINTKLEFEPITEIKTDDVISSIKFNSTKDEFVNCKNGAPPYLLRH 122

Query: 120 IYYHSNFQPGSGKPYGKL 137
           I+    F PGSGKP   L
Sbjct: 123 IFNKDKFVPGSGKPLWNL 140

>KAFR0B06510 Chr2 complement(1349540..1351066) [1527 bp, 508 aa]
           {ON} Anc_6.8 YPL272C
          Length = 508

 Score = 59.3 bits (142), Expect = 1e-10,   Method: Compositional matrix adjust.
 Identities = 41/136 (30%), Positives = 63/136 (46%), Gaps = 1/136 (0%)

Query: 2   LRILNESEKSALKQTSEGSMNGIIFSVKISKKCEDNLSDDATLHTTGESGNXXXXXXXXX 61
           LR L+  E+  L +T     NG+IF+   S   E+   DD TL T  +S           
Sbjct: 3   LRTLSSYERKILDETIRRERNGVIFTASYSASSEE-WGDDTTLLTLKDSRPTIAILTKAI 61

Query: 62  XXXIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLINSIY 121
              I ++ EL TT++EN  F  L  +K  D++ I+ +   K +     +G    L+  I+
Sbjct: 62  QRLISRHVELFTTINENYEFEILKSIKKDDILNILEFDSYKDEKINCHNGCPPYLLRHIF 121

Query: 122 YHSNFQPGSGKPYGKL 137
            ++ F PGS KP   L
Sbjct: 122 DNNRFVPGSKKPLWSL 137

>NCAS0D02180 Chr4 (406396..407943) [1548 bp, 515 aa] {ON} Anc_6.8
          Length = 515

 Score = 52.8 bits (125), Expect = 3e-08,   Method: Compositional matrix adjust.
 Identities = 40/138 (28%), Positives = 65/138 (47%), Gaps = 3/138 (2%)

Query: 3   RILNESEKSALKQTSEGSMNGIIFSVKISK---KCEDNLSDDATLHTTGESGNXXXXXXX 59
           R L+E E   L+QT +G  NG+ F+ K  +       + SD++TL +  +          
Sbjct: 4   RQLSEYEVKLLEQTLQGKRNGVAFAAKYGRNYDDSSLSSSDESTLVSLKDRRLTLSVITR 63

Query: 60  XXXXXIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLINS 119
                IPK+ EL T + E+  +  + E++  DV+ II +   K +      GP   L+  
Sbjct: 64  VLQILIPKHIELYTAISEDHRYSLVTEIRAKDVIDIITFDSEKDERINCHLGPPPYLLRH 123

Query: 120 IYYHSNFQPGSGKPYGKL 137
           I+  S+F+ G  KP  KL
Sbjct: 124 IFNKSDFKLGQQKPLWKL 141

>TBLA0A07220 Chr1 (1800531..1802060) [1530 bp, 509 aa] {ON} Anc_6.8
           YPL272C
          Length = 509

 Score = 52.0 bits (123), Expect = 5e-08,   Method: Compositional matrix adjust.
 Identities = 43/138 (31%), Positives = 68/138 (49%), Gaps = 2/138 (1%)

Query: 1   MLRILNESEKSALKQTSEG-SMNGIIFSVKISKKCEDNLSDDATLHTTGESGNXXXXXXX 59
           +LR L+  EK  L  + E  + +G + S K      D +SDDATL ++ +          
Sbjct: 11  VLRPLSSVEKRFLGNSLESETRHGSVCSGKWVSNSLD-ISDDATLLSSKDKPLTISLVSR 69

Query: 60  XXXXXIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLINS 119
                I  + E+ TT+++N  F  LD++ T+DV+  I +  +K ++    SG    LIN 
Sbjct: 70  ALKILISNHIEMFTTINKNSEFQLLDKINTSDVLHSICFENKKDELVNCHSGAPPYLINY 129

Query: 120 IYYHSNFQPGSGKPYGKL 137
           I+    FQP S KP  +L
Sbjct: 130 IFSLPYFQPDSKKPLWQL 147

>NDAI0G00860 Chr7 (181464..183035) [1572 bp, 523 aa] {ON} 
          Length = 523

 Score = 49.7 bits (117), Expect = 4e-07,   Method: Compositional matrix adjust.
 Identities = 41/140 (29%), Positives = 62/140 (44%), Gaps = 6/140 (4%)

Query: 2   LRILNESEKSALKQTSEGSMNGIIFSV----KISKKCEDNLSDDATLHTTGESGNXXXXX 57
           +R L+  EK  L QT +   NGI ++     K+    +  LSD ATL  T +        
Sbjct: 3   IRALSSFEKKVLSQTLDSKRNGISYTARYVSKVGSSSDSTLSDAATLLATKDIRLNIGIV 62

Query: 58  XXXXXXXIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLI 117
                  I K+ EL +T++EN  F  L ++K  DV+ +I +   K +     SG    L+
Sbjct: 63  TRVLERLIKKHIELYSTINENYEFQILTKIKPEDVISVITFDTYKDEQINCHSGAPPYLL 122

Query: 118 NSIYYHSNFQPGSGKPYGKL 137
             I+    F+    KP  KL
Sbjct: 123 RHIFNKEKFE--LNKPLWKL 140

>CAGL0A01089g Chr1 complement(109009..110616) [1608 bp, 535 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272c
          Length = 535

 Score = 48.9 bits (115), Expect = 6e-07,   Method: Compositional matrix adjust.
 Identities = 43/153 (28%), Positives = 64/153 (41%), Gaps = 16/153 (10%)

Query: 1   MLRILNESEKSALKQTSEGSMNGIIFSVKI----SKKCEDNLSDDA--TLHTTGESGNXX 54
           M R L+  E+  L +  E + NG +F        S   ++++ DD   TL  T       
Sbjct: 1   MSRSLSSYERKLLSEILENNKNGTVFGASYIFDDSVTADEHIWDDDNDTLAATRVESRST 60

Query: 55  XX---------XXXXXXXXIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFD- 104
                              I K  E+ TTV++ L F  L E++T DV+ ++ +   K + 
Sbjct: 61  KKPALSLTLPLVTRALKSLIEKNPEMYTTVNDLLEFAPLKEIRTPDVISVVTFDNEKDEK 120

Query: 105 INEGLSGPSSSLINSIYYHSNFQPGSGKPYGKL 137
           +N    GP   LI  I  +  FQPGS KP   L
Sbjct: 121 VNCHSGGPPPYLIRHILKNDVFQPGSNKPLWNL 153

>YPL272C Chr16 complement(26611..28164) [1554 bp, 517 aa] {ON}
           Putative protein of unknown function; gene expression
           induced in response to ketoconazole; YPL272C is not an
           essential gene
          Length = 517

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 59/145 (40%), Gaps = 9/145 (6%)

Query: 2   LRILNESEKSALKQTSEGSMNGIIFSVKISKKC-----EDNLSDDATLHTTG---ESGNX 53
            R L+  EK  L Q+     NG IFS   SK        D  SD+ TL T     +S   
Sbjct: 4   FRPLSSFEKKILTQSLNDQRNGTIFSSTYSKSLSRENDADWHSDEVTLGTNSSKDDSRLT 63

Query: 54  XXXXXXXXXXXIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRK-FDINEGLSGP 112
                      I     L  TV+E   F  L ++KT+D+V +I +   K  ++N     P
Sbjct: 64  LPLIATTLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGVP 123

Query: 113 SSSLINSIYYHSNFQPGSGKPYGKL 137
              L+   +  + F PGS KP   L
Sbjct: 124 PPYLLRHAFNKTRFVPGSNKPLWTL 148

>Smik_6.480 Chr6 (793043..794593) [1551 bp, 516 aa] {ON} YPL272C
           (REAL)
          Length = 516

 Score = 47.0 bits (110), Expect = 3e-06,   Method: Compositional matrix adjust.
 Identities = 41/145 (28%), Positives = 60/145 (41%), Gaps = 9/145 (6%)

Query: 2   LRILNESEKSALKQTSEGSMNGIIFSVKISKKC-----EDNLSDDATLHTTG---ESGNX 53
            R L+  EK  L Q+     NG IFS   SK        D  SD+ TL T     +S   
Sbjct: 4   FRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSLGKENDADWHSDEVTLGTNSSKDDSRLT 63

Query: 54  XXXXXXXXXXXIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRK-FDINEGLSGP 112
                      I     L  T++E   F  L+++KT+D+V +I +   K  ++N     P
Sbjct: 64  LPLIATTLKRLIKSQPALFATINEEWEFEPLEQLKTSDIVNVIEFETLKDKEVNCHWGVP 123

Query: 113 SSSLINSIYYHSNFQPGSGKPYGKL 137
              L+   +  + F PGS +P   L
Sbjct: 124 PPYLLRHAFNKTRFIPGSNRPLWTL 148

>Skud_16.5 Chr16 complement(5816..7363) [1548 bp, 515 aa] {ON}
           YPL272C (REAL)
          Length = 515

 Score = 46.2 bits (108), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 43/145 (29%), Positives = 59/145 (40%), Gaps = 9/145 (6%)

Query: 2   LRILNESEKSALKQTSEGSMNGIIFSVKISKKC-----EDNLSDDATLHTTG---ESGNX 53
            R L+  EK  L Q+     NG IFS   SK        D  SD+ TL T     +S   
Sbjct: 4   FRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSPNRGNDADWNSDEVTLGTNSSKDDSRLT 63

Query: 54  XXXXXXXXXXXIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRK-FDINEGLSGP 112
                      I     L  TV+E   F  L ++KT+D+V +I +   K  ++N     P
Sbjct: 64  LPSIAATLKRLIKSQPALFATVNEEWEFEPLKQLKTSDIVNVIEFETIKDKEVNCHWGVP 123

Query: 113 SSSLINSIYYHSNFQPGSGKPYGKL 137
              L+   +  + F PGS KP   L
Sbjct: 124 PPYLLRHAFNKTRFVPGSNKPLWTL 148

>KLTH0C11572g Chr3 complement(950297..951853) [1557 bp, 518 aa] {ON}
           similar to uniprot|Q08984 Saccharomyces cerevisiae
           YPL272C Hypothetical ORF
          Length = 518

 Score = 45.8 bits (107), Expect = 6e-06,   Method: Compositional matrix adjust.
 Identities = 36/136 (26%), Positives = 60/136 (44%), Gaps = 1/136 (0%)

Query: 3   RILNESEKSALKQTSEGSMNGIIFSVKISKKCED-NLSDDATLHTTGESGNXXXXXXXXX 61
           R L  +EK+ L +T+ G  NG++FS    K   + +LSD+ TL +               
Sbjct: 9   RNLTPTEKTILCETATGVKNGVLFSATYYKNFPNKDLSDNETLRSDMNQRLSDSMIWKAL 68

Query: 62  XXXIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLINSIY 121
              I ++ EL   V  NL F  +D++   DVV+ I +     +     +G    L+  I+
Sbjct: 69  LKVIKEHAELRCAVSRNLEFEPVDKIDFEDVVRKIEFDCYADEQVNCYNGVPPYLLRHIF 128

Query: 122 YHSNFQPGSGKPYGKL 137
              +F  G  +P  +L
Sbjct: 129 DKCHFTLGQKQPLWQL 144

>SAKL0E00792g Chr5 (58155..59690) [1536 bp, 511 aa] {ON} similar to
           uniprot|Q08984 Saccharomyces cerevisiae YPL272C
           Hypothetical ORF
          Length = 511

 Score = 43.5 bits (101), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 34/139 (24%), Positives = 58/139 (41%), Gaps = 4/139 (2%)

Query: 2   LRILNESEKSALKQTSEGSMNGIIFSVKISKKC---EDNLSDDATLHTTGESGNXXXXXX 58
            R L+  EK    Q      NG++F+  +   C   E+  SD+ATL T  +         
Sbjct: 7   FRSLSSVEKKLFSQNLNNKRNGLMFAA-VYSTCFDKEETWSDNATLLTVKDQRLSNSLVS 65

Query: 59  XXXXXXIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLIN 118
                 I    EL TT+++NL F  +  +   DVV+ + +   K ++     G    L+ 
Sbjct: 66  RALKKVINNNVELYTTINDNLEFQPVKTIMFDDVVQKVEFDSYKDELVNCHDGVPPYLLR 125

Query: 119 SIYYHSNFQPGSGKPYGKL 137
            I+  + F+    KP  ++
Sbjct: 126 HIFDKNKFETAKHKPLWQI 144

>Ecym_3011 Chr3 (22943..24472) [1530 bp, 509 aa] {ON} similar to
           Ashbya gossypii ACR018C
          Length = 509

 Score = 43.5 bits (101), Expect = 4e-05,   Method: Compositional matrix adjust.
 Identities = 38/138 (27%), Positives = 64/138 (46%), Gaps = 4/138 (2%)

Query: 2   LRILNESEKSALKQTSEGSMNGIIFSVKISK-KCE-DNLSDDATLHTTGESGNXXXXXXX 59
           +R L+  EK   K+      NGI+F+V  S  KCE +  SDD TL    +S         
Sbjct: 8   IRDLSSVEKIFHKEVYTSRRNGIVFAVNYSSNKCESERWSDDITLSNLRDSRLFDGQISN 67

Query: 60  XXXXXIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLINS 119
                I +  ELC T+ ++  F   + ++  DVV  I +   K ++ E  +G    ++ +
Sbjct: 68  ALEAMIKENVELCVTITDDRKFAPTEIIRYDDVVIHIEFKTYKDELIECQNGIPPYILRN 127

Query: 120 IYYHSNFQPGSGKPYGKL 137
           I  ++ F+   G+P  +L
Sbjct: 128 ILENNKFE--FGRPLWEL 143

>Suva_16.33 Chr16 complement(42245..43801) [1557 bp, 518 aa] {ON}
           YPL272C (REAL)
          Length = 518

 Score = 43.1 bits (100), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 42/145 (28%), Positives = 60/145 (41%), Gaps = 9/145 (6%)

Query: 2   LRILNESEKSALKQTSEGSMNGIIFSVKISKKC-----EDNLSDDATLHTTG---ESGNX 53
            R L+  EK  L Q+     NG IFS   SK        D  SD+ TL T     +S   
Sbjct: 4   FRPLSSFEKKLLTQSLNDQRNGTIFSSTYSKSSSKEADADWHSDEVTLGTNSSKDDSRLT 63

Query: 54  XXXXXXXXXXXIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRK-FDINEGLSGP 112
                      I     L  TV+E+  +  L ++KT+D+V +I +   K  ++N     P
Sbjct: 64  LPLIATTLKKLIKSQPALFATVNEDWEYAPLKQLKTSDIVNVIEFETTKDKEVNCHWGVP 123

Query: 113 SSSLINSIYYHSNFQPGSGKPYGKL 137
              L+   +  + F PGS KP   L
Sbjct: 124 PPYLLRHAFNKTRFVPGSNKPLWTL 148

>Kwal_56.22341 s56 (56939..58498) [1560 bp, 519 aa] {ON} YPL272C -
           Hypothetical ORF [contig 186] FULL
          Length = 519

 Score = 34.7 bits (78), Expect = 0.050,   Method: Compositional matrix adjust.
 Identities = 31/137 (22%), Positives = 60/137 (43%), Gaps = 3/137 (2%)

Query: 3   RILNESEKSALKQTSEGSMNGIIFSVKISKKCE--DNLSDDATLHTTGESGNXXXXXXXX 60
           R L  +EK+ + +T+ G  NG++FS    +  +  DN S   +    G+ G         
Sbjct: 9   RNLTATEKTIICETAAGIKNGVLFSSTYFEGPDNVDNTSPSVSCMKMGK-GLPDAIMWQA 67

Query: 61  XXXXIPKYKELCTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSSLINSI 120
               I +  EL +++++ + F  +D +   DVV+ I +     +     +G    L+  I
Sbjct: 68  LSQIIKENAELRSSINKFMQFEAIDTIAFDDVVRKIEFDNLTDEKVSCYNGVPPYLLRHI 127

Query: 121 YYHSNFQPGSGKPYGKL 137
           +   +F  G  KP  ++
Sbjct: 128 FDKCHFSIGQQKPLWQV 144

>TBLA0E01310 Chr5 complement(290546..294036,294188..294236) [3540 bp,
            1179 aa] {ON} Anc_4.128 YAL001C
          Length = 1179

 Score = 32.7 bits (73), Expect = 0.24,   Method: Compositional matrix adjust.
 Identities = 16/59 (27%), Positives = 31/59 (52%), Gaps = 3/59 (5%)

Query: 82   VHLDEVKTTDVVKIINYSRRKFDINE---GLSGPSSSLINSIYYHSNFQPGSGKPYGKL 137
            VH+D +     + + NY+ RKFD+ +    +   +  L ++I+   N    SG+PY ++
Sbjct: 1041 VHMDAIPIPRKIPLFNYTTRKFDVKQLTPAIIVSAKHLGSNIWNIKNITIPSGQPYSRI 1099

>Smik_11.170 Chr11 (291020..291340) [321 bp, 106 aa] {ON} YKL071W
           (REAL)
          Length = 106

 Score = 29.3 bits (64), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 17/53 (32%), Positives = 28/53 (52%), Gaps = 2/53 (3%)

Query: 65  IPKYKEL--CTTVDENLHFVHLDEVKTTDVVKIINYSRRKFDINEGLSGPSSS 115
           +PK K+L     + EN+H VHLD  K   +  I N  ++K  + + L+  S +
Sbjct: 44  LPKNKQLEDLGNIRENIHIVHLDVTKNESIENIANEIKKKLHLFKELTFLSQT 96

>KLLA0E14323g Chr5 (1266372..1267070) [699 bp, 232 aa] {ON} highly
           similar to uniprot|Q12483 Saccharomyces cerevisiae
           YPL002C SNF8 Component of the ESCRT-II complex which is
           involved in ubiquitin-dependent sorting of proteins into
           the endosome appears to be functionally related to SNF7
           involved in glucose derepression
          Length = 232

 Score = 28.9 bits (63), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 15/52 (28%), Positives = 24/52 (46%), Gaps = 8/52 (15%)

Query: 66  PKYKELCTTV--------DENLHFVHLDEVKTTDVVKIINYSRRKFDINEGL 109
            K+  +C+ +        D+N H  H+D+      VKII   R   D+N G+
Sbjct: 59  AKFMRMCSAIGIDPLSIFDKNSHLFHIDDFYYQICVKIIEICRNTKDVNGGV 110

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.312    0.131    0.374 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 14,741,751
Number of extensions: 576327
Number of successful extensions: 1146
Number of sequences better than 10.0: 28
Number of HSP's gapped: 1132
Number of HSP's successfully gapped: 28
Length of query: 139
Length of database: 53,481,399
Length adjustment: 98
Effective length of query: 41
Effective length of database: 42,244,131
Effective search space: 1732009371
Effective search space used: 1732009371
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (21.8 bits)
S2: 60 (27.7 bits)