Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1069.48.829ON27727713950.0
Kpol_541.98.829ON3742409161e-123
Ecym_27128.829ON3812479111e-122
SAKL0D01760g8.829ON3812369021e-121
NCAS0C004708.829ON4262479061e-121
NDAI0K004708.829ON3862479011e-120
CAGL0F03399g8.829ON3802478991e-120
AAL183W8.829ON3772478981e-120
YMR272C (SCS7)8.829ON3842478961e-120
Skud_13.4448.829ON3842478951e-119
Smik_13.4858.829ON3842478941e-119
KLLA0D01639g8.829ON3812368911e-119
TDEL0B006808.829ON3832478901e-119
KLTH0C04114g8.829ON3782368871e-118
KNAG0J003208.829ON3732368661e-115
Kwal_27.103328.829ON3782478541e-113
TBLA0D031808.829ON4002408541e-113
ZYRO0G13948g8.829ON3842478471e-112
Suva_13.4608.829ON3842478401e-111
TPHA0C047108.829ON3772408331e-110
KAFR0B038508.829ON3772378251e-109
KNAG0D005406.308ON839107693.0
Kpol_1035.76.66ON60467675.7
Kpol_462.9singletonON19632656.5
KNAG0D012407.490ON34175659.6
TPHA0F008604.140ON56838659.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1069.4
         (277 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996...   541   0.0  
Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON} ...   357   e-123
Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar...   355   e-122
SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} simila...   352   e-121
NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829      353   e-121
NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8....   351   e-120
CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {...   350   e-120
AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homo...   350   e-120
YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON} ...   349   e-120
Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {...   349   e-119
Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {...   348   e-119
KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {...   347   e-119
TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.8...   347   e-119
KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly...   346   e-118
KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.82...   338   e-115
Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272...   333   e-113
TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {O...   333   e-113
ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]...   330   e-112
Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {...   328   e-111
TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa] ...   325   e-110
KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {O...   322   e-109
KNAG0D00540 Chr4 (74025..76544) [2520 bp, 839 aa] {ON} Anc_6.308...    31   3.0  
Kpol_1035.7 s1035 complement(14838..16652) [1815 bp, 604 aa] {ON...    30   5.7  
Kpol_462.9 s462 complement(24921..25511) [591 bp, 196 aa] {ON} c...    30   6.5  
KNAG0D01240 Chr4 complement(209447..210472) [1026 bp, 341 aa] {O...    30   9.6  
TPHA0F00860 Chr6 (199814..201520) [1707 bp, 568 aa] {ON} Anc_8.5...    30   9.9  

>Kpol_1069.4 s1069 (6163..6996) [834 bp, 277 aa] {ON} (6163..6996)
           [834 nt, 278 aa]
          Length = 277

 Score =  541 bits (1395), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 264/277 (95%), Positives = 264/277 (95%)

Query: 1   MKIEESIETYIHIRXXXXXXXXXXXXXDYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYI 60
           MKIEESIETYIHIR             DYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYI
Sbjct: 1   MKIEESIETYIHIRKTTLTEEKLKVTTDYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYI 60

Query: 61  DQVHKPRHYGIESAPIFGNFLEPFTKTHWFMVPLIWGPVVLYNFIVSLREISIILAITLF 120
           DQVHKPRHYGIESAPIFGNFLEPFTKTHWFMVPLIWGPVVLYNFIVSLREISIILAITLF
Sbjct: 61  DQVHKPRHYGIESAPIFGNFLEPFTKTHWFMVPLIWGPVVLYNFIVSLREISIILAITLF 120

Query: 121 SIGVFVWTLIEYCMHRYLFHLDDSVPETRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFS 180
           SIGVFVWTLIEYCMHRYLFHLDDSVPETRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFS
Sbjct: 121 SIGVFVWTLIEYCMHRYLFHLDDSVPETRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFS 180

Query: 181 ILCYPFYLLTFAIFPRYWAHAGFAGGLFGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHH 240
           ILCYPFYLLTFAIFPRYWAHAGFAGGLFGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHH
Sbjct: 181 ILCYPFYLLTFAIFPRYWAHAGFAGGLFGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHH 240

Query: 241 YKNFQLGFGVTSSFWDRVFGTYLDPKTIPYARSKRTT 277
           YKNFQLGFGVTSSFWDRVFGTYLDPKTIPYARSKRTT
Sbjct: 241 YKNFQLGFGVTSSFWDRVFGTYLDPKTIPYARSKRTT 277

>Kpol_541.9 s541 complement(23399..24523) [1125 bp, 374 aa] {ON}
           complement(23399..24523) [1125 nt, 375 aa]
          Length = 374

 Score =  357 bits (916), Expect = e-123,   Method: Compositional matrix adjust.
 Identities = 159/240 (66%), Positives = 200/240 (83%)

Query: 28  DYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFGNFLEPFTKT 87
           D  KDF ++ FL L++P+ WQ+L  NFTRDFYIDQVH+PRHYG  SAP+FGNFLEP + T
Sbjct: 127 DLGKDFQDHHFLDLNKPMLWQVLFGNFTRDFYIDQVHRPRHYGKGSAPLFGNFLEPISLT 186

Query: 88  HWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYLFHLDDSVPE 147
            W+++P+IWGPVV+Y+  V+L  ++ I A  LF +G+FVWTLIEYC+HR+LFHLDD VP+
Sbjct: 187 PWWLIPIIWGPVVVYHLSVALNNMNNIFAGFLFCLGIFVWTLIEYCLHRFLFHLDDWVPQ 246

Query: 148 TRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYWAHAGFAGGL 207
             +F+ LHFLLHG+HHYLPMD+YRLV+PPALF +LC P Y L F + P YWA+AGFAGGL
Sbjct: 247 HNIFYTLHFLLHGVHHYLPMDQYRLVVPPALFLVLCTPIYKLVFGLLPLYWAYAGFAGGL 306

Query: 208 FGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRVFGTYLDPKT 267
            GY+CYD+THYF+HH K+P FMRKVKK+HLEHHYKN+QLGFGV++ FWD+VFGTYL P +
Sbjct: 307 LGYICYDLTHYFIHHVKLPKFMRKVKKHHLEHHYKNYQLGFGVSNYFWDKVFGTYLGPDS 366

>Ecym_2712 Chr2 (1378070..1379215) [1146 bp, 381 aa] {ON} similar to
           Ashbya gossypii AAL183W
          Length = 381

 Score =  355 bits (911), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 167/247 (67%), Positives = 202/247 (81%), Gaps = 1/247 (0%)

Query: 28  DYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFGNFLEPFTKT 87
           D+  D+ ++ FL LD+PLF Q+L  NFT++FYIDQVH+PRHYG ESAP+FGNFLEP +KT
Sbjct: 134 DFKTDYEKHHFLDLDKPLFMQVLFGNFTKEFYIDQVHRPRHYGKESAPLFGNFLEPLSKT 193

Query: 88  HWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYLFHLDDSVPE 147
            W+++P++W P V+Y    +L  IS  LA+ LF +GVFVWTLIEY +HR+LFH DD +PE
Sbjct: 194 SWWVIPIVWYPCVIYYIRTALLNISTPLALFLFGVGVFVWTLIEYGLHRFLFHFDDRMPE 253

Query: 148 TRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYWAHAGFAGGL 207
           + + F LHFLLHGIHHYLPMDKYRLVMPPALF  LCYPFY L F+I P Y A AGFAGGL
Sbjct: 254 SNIVFTLHFLLHGIHHYLPMDKYRLVMPPALFLALCYPFYKLVFSILPYYCACAGFAGGL 313

Query: 208 FGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRVFGTYLDPKT 267
           FGYV YDVTHYFLHH+K+P FMRK+KKYHLEHHYKN++LGFGVTS +WD+VF TYL P T
Sbjct: 314 FGYVGYDVTHYFLHHRKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYWDKVFNTYLSP-T 372

Query: 268 IPYARSK 274
            P +R+K
Sbjct: 373 APLSRAK 379

>SAKL0D01760g Chr4 (140050..141195) [1146 bp, 381 aa] {ON} similar
           to uniprot|Q03529 Saccharomyces cerevisiae YMR272C SCS7
           Required for the hydroxylation of the very long chain
           fatty acid (VLCFA) located in the endoplasmic reticulum
           desaturase/hydroxylase enzyme
          Length = 381

 Score =  352 bits (902), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 157/236 (66%), Positives = 195/236 (82%)

Query: 28  DYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFGNFLEPFTKT 87
           DY+ D+ ++ FL LD+PL WQ++  NFT+DFY+DQVH+PRHYG  SAP+FGNFLEP +KT
Sbjct: 134 DYSSDYKKHKFLDLDKPLLWQVVFGNFTKDFYLDQVHRPRHYGKGSAPLFGNFLEPLSKT 193

Query: 88  HWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYLFHLDDSVPE 147
            W+ +P+ W PVV Y+  V+L  ++   A+ LFS+GVFVWTLIEYC+HR+LFHLD  +PE
Sbjct: 194 PWYAIPIAWLPVVFYHLYVALTNMNKPFALFLFSLGVFVWTLIEYCLHRFLFHLDQYLPE 253

Query: 148 TRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYWAHAGFAGGL 207
            +L F LHFLLHG+HHYLPMD+YRLVMPP LF +LC PFY L F++ P YWA AGFAGG+
Sbjct: 254 RQLAFALHFLLHGVHHYLPMDRYRLVMPPTLFVLLCTPFYKLVFSLLPYYWACAGFAGGM 313

Query: 208 FGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRVFGTYL 263
            GY CYD+THYFLHH K+P +MRK+KKYHLEHHYKN++LGFGVTS FWD+VFGTYL
Sbjct: 314 LGYTCYDLTHYFLHHAKLPPYMRKLKKYHLEHHYKNYELGFGVTSWFWDKVFGTYL 369

>NCAS0C00470 Chr3 (78059..79339) [1281 bp, 426 aa] {ON} Anc_8.829
          Length = 426

 Score =  353 bits (906), Expect = e-121,   Method: Compositional matrix adjust.
 Identities = 158/247 (63%), Positives = 198/247 (80%), Gaps = 1/247 (0%)

Query: 28  DYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFGNFLEPFTKT 87
           DY KD  ++ FL L++PL  Q+L  NFT+DFY+DQ+H+PRHYG ESAP+FGNFLEPFTKT
Sbjct: 179 DYEKDLKKHNFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGQESAPLFGNFLEPFTKT 238

Query: 88  HWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYLFHLDDSVPE 147
            W++VP+ W PVV Y+  ++ + I+ + AI LF IGV+VWT IEYCMHR+LFH D+ +PE
Sbjct: 239 AWYLVPIAWLPVVFYHIALAFKNINALFAIMLFCIGVYVWTFIEYCMHRFLFHFDERLPE 298

Query: 148 TRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYWAHAGFAGGL 207
               +++HFLLHG HHYLPMDKYRLV+PP LF  LC PFY L FA+ P YWA AGFAGG+
Sbjct: 299 HNFAYMIHFLLHGCHHYLPMDKYRLVVPPVLFIFLCAPFYKLVFALLPYYWACAGFAGGM 358

Query: 208 FGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRVFGTYLDPKT 267
           FGY+CYD+ HYFLHH K+P FMRK+KKYHLEHHYKN+QLG+GVTS +WD+ FGTYL P +
Sbjct: 359 FGYICYDLCHYFLHHSKLPPFMRKLKKYHLEHHYKNYQLGYGVTSWYWDKKFGTYLSPDS 418

Query: 268 IPYARSK 274
            P ++ K
Sbjct: 419 -PLSKMK 424

>NDAI0K00470 Chr11 (107509..108669) [1161 bp, 386 aa] {ON} Anc_8.829
          Length = 386

 Score =  351 bits (901), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 158/247 (63%), Positives = 200/247 (80%), Gaps = 1/247 (0%)

Query: 28  DYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFGNFLEPFTKT 87
           D  KD  ++ FL LD+PL  Q+L  NFT+DFY+DQ+H+PRHYG +SAP+FGN LEP TKT
Sbjct: 139 DTKKDLEKHKFLDLDKPLLKQILFGNFTKDFYLDQIHRPRHYGDKSAPLFGNILEPLTKT 198

Query: 88  HWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYLFHLDDSVPE 147
            W++VP+ W PVV Y+  V+L  ++ I AI LF+IG++VWTLIEYCMHR+LFH D+ +PE
Sbjct: 199 SWYLVPIFWLPVVFYHIAVALTNMNPIFAIVLFAIGIYVWTLIEYCMHRFLFHFDERLPE 258

Query: 148 TRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYWAHAGFAGGL 207
             +F+V+HFLLHG HHYLPMDKYRLV+PP LF  LC+PFY + F + P YWA+AGFAGGL
Sbjct: 259 HNIFYVIHFLLHGCHHYLPMDKYRLVVPPTLFIFLCFPFYKVVFKLLPLYWAYAGFAGGL 318

Query: 208 FGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRVFGTYLDPKT 267
           FGYVCYD+ HYFLHH KMP  +RK+KKYHLEHHYKN+QLG+GVTS +WD++FGTYL P +
Sbjct: 319 FGYVCYDLCHYFLHHSKMPPPLRKLKKYHLEHHYKNYQLGYGVTSWYWDKIFGTYLSPDS 378

Query: 268 IPYARSK 274
            P ++ K
Sbjct: 379 -PMSKMK 384

>CAGL0F03399g Chr6 complement(333955..335097) [1143 bp, 380 aa] {ON}
           highly similar to uniprot|Q03529 Saccharomyces
           cerevisiae YMR272c SCS7 required for hydroxylation of
           ceramide
          Length = 380

 Score =  350 bits (899), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 160/247 (64%), Positives = 198/247 (80%), Gaps = 1/247 (0%)

Query: 28  DYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFGNFLEPFTKT 87
           DY +D+ ++ FL L++PL  Q+L  NFT+DFY+DQ+H+PRHYG  SAP+FGNFLE FTKT
Sbjct: 133 DYERDYKKHKFLDLNKPLLKQILFGNFTKDFYLDQIHRPRHYGKGSAPLFGNFLEAFTKT 192

Query: 88  HWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYLFHLDDSVPE 147
            W++VP +WGPVVLY    +L  ++  LA+ LF +G+FVWTLIEYC+HR+LFH D+ +PE
Sbjct: 193 AWWVVPTVWGPVVLYFITTALMNMNNPLALFLFGLGIFVWTLIEYCLHRFLFHFDEWLPE 252

Query: 148 TRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYWAHAGFAGGL 207
             +FF++HFLLHG HHYLPMD YRLV+PPALF +LC P Y L FA  P YWA AGFAGG+
Sbjct: 253 HSMFFMIHFLLHGCHHYLPMDAYRLVVPPALFVVLCAPIYKLVFAALPYYWACAGFAGGM 312

Query: 208 FGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRVFGTYLDPKT 267
            GY+CYD+ HYFLHH KMP FMRK+KKYHLEHHYKN+QLGFGVTS FWD+VFGTYL P  
Sbjct: 313 LGYICYDLCHYFLHHSKMPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWDKVFGTYLGPDA 372

Query: 268 IPYARSK 274
            P ++ K
Sbjct: 373 -PLSKMK 378

>AAL183W Chr1 (13713..14846) [1134 bp, 377 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YMR272C (SCS7)
          Length = 377

 Score =  350 bits (898), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 162/247 (65%), Positives = 200/247 (80%), Gaps = 1/247 (0%)

Query: 28  DYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFGNFLEPFTKT 87
           D+  D+ ++ FL L++PL  Q+L  NFTRDFYIDQ+H+PRHYG  SAP+FGNFLEP +KT
Sbjct: 130 DFGTDYTKHHFLDLNKPLLMQVLRGNFTRDFYIDQIHRPRHYGKGSAPLFGNFLEPLSKT 189

Query: 88  HWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYLFHLDDSVPE 147
            W++VP++W PVVLY    +L+ +   LA+T F+ GVFVWTLIEY +HR+LFH DD++PE
Sbjct: 190 VWWVVPMVWYPVVLYYLTRALQNMPAHLALTCFAAGVFVWTLIEYSLHRFLFHFDDNMPE 249

Query: 148 TRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYWAHAGFAGGL 207
           + + F +HFLLHG+HHYLPMDKYRLVMPPALF +LC PFY L F+IFP Y A   FAGGL
Sbjct: 250 SNIAFTVHFLLHGVHHYLPMDKYRLVMPPALFVVLCAPFYRLVFSIFPEYCACGCFAGGL 309

Query: 208 FGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRVFGTYLDPKT 267
           FGYVCYDVTHYFLHH K+P FMRK+KKYHLEHHYKN++LGFGVTS +WD+VFGTYL   +
Sbjct: 310 FGYVCYDVTHYFLHHHKLPPFMRKLKKYHLEHHYKNYELGFGVTSWYWDKVFGTYLASNS 369

Query: 268 IPYARSK 274
            P +R K
Sbjct: 370 -PVSRPK 375

>YMR272C Chr13 complement(809623..810777) [1155 bp, 384 aa] {ON}
           SCS7Sphingolipid alpha-hydroxylase, functions in the
           alpha-hydroxylation of sphingolipid-associated very long
           chain fatty acids, has both cytochrome b5-like and
           hydroxylase/desaturase domains, not essential for growth
          Length = 384

 Score =  349 bits (896), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 161/247 (65%), Positives = 197/247 (79%), Gaps = 1/247 (0%)

Query: 28  DYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFGNFLEPFTKT 87
           DY+ D+ ++ FL L+ PL  Q+L S+F +DFY+DQ+H+PRHYG  SAP+FGNFLEP TKT
Sbjct: 137 DYSNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSAPLFGNFLEPLTKT 196

Query: 88  HWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYLFHLDDSVPE 147
            W++VP+ W PVV+Y+  V+L+ ++ + A  LF +GVFVWTLIEY +HR+LFH DD +PE
Sbjct: 197 AWWVVPVAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGLHRFLFHFDDWLPE 256

Query: 148 TRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYWAHAGFAGGL 207
           + + F  HFLLHG HHYLPMDKYRLVMPP LF ILC PFY L FA+ P YWA+AGFAGGL
Sbjct: 257 SNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLPLYWAYAGFAGGL 316

Query: 208 FGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRVFGTYLDPKT 267
           FGYVCYD  H+FLHH K+P FMRK+KKYHLEHHYKN+QLGFGVTS FWD VFGTYL P  
Sbjct: 317 FGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWDEVFGTYLGPDA 376

Query: 268 IPYARSK 274
            P ++ K
Sbjct: 377 -PLSKMK 382

>Skud_13.444 Chr13 complement(783092..784246) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  349 bits (895), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 162/247 (65%), Positives = 196/247 (79%), Gaps = 1/247 (0%)

Query: 28  DYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFGNFLEPFTKT 87
           DY  D+ ++ FL L+ PL  Q+L S+F +DFY+DQ+H+PRHYG  SAP+FGNFLEP TKT
Sbjct: 137 DYGNDYKKHKFLDLNRPLLMQILRSDFKKDFYVDQIHRPRHYGKGSAPLFGNFLEPLTKT 196

Query: 88  HWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYLFHLDDSVPE 147
            W++VPL W PVV+Y+  V+L+ ++ + A  LF +GVFVWTLIEY +HR+LFH DD +PE
Sbjct: 197 AWWVVPLPWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGLHRFLFHFDDWLPE 256

Query: 148 TRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYWAHAGFAGGL 207
           + + F  HFLLHG HHYLPMDKYRLVMPP LF ILC PFY L FA+ P YWA+AGFAGGL
Sbjct: 257 SNVAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLPLYWAYAGFAGGL 316

Query: 208 FGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRVFGTYLDPKT 267
           FGYVCYD  H+FLHH K+P FMRK+KKYHLEHHYKN+QLGFGVTS FWD VFGTYL P  
Sbjct: 317 FGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWDEVFGTYLGPDA 376

Query: 268 IPYARSK 274
            P ++ K
Sbjct: 377 -PLSKMK 382

>Smik_13.485 Chr13 complement(792640..793794) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  348 bits (894), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 161/247 (65%), Positives = 195/247 (78%), Gaps = 1/247 (0%)

Query: 28  DYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFGNFLEPFTKT 87
           DY  D+ ++ FL L+ PL  Q+L S+F +DFY+DQ+H+PRHYG  SAP+FGNFLEP TKT
Sbjct: 137 DYGNDYKKHKFLDLNRPLLMQILCSDFKKDFYVDQIHRPRHYGKGSAPLFGNFLEPLTKT 196

Query: 88  HWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYLFHLDDSVPE 147
            W++VP  W PVV+Y+  V+L+ ++ + A  LF +GVFVWTLIEY +HR+LFH DD +PE
Sbjct: 197 AWWVVPTAWLPVVVYHMGVALKNMNQLFACFLFCVGVFVWTLIEYGLHRFLFHFDDWLPE 256

Query: 148 TRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYWAHAGFAGGL 207
           + + F  HFLLHG HHYLPMDKYRLVMPP LF ILC PFY L FA+ P YWA+AGFAGGL
Sbjct: 257 SNIAFATHFLLHGCHHYLPMDKYRLVMPPTLFVILCAPFYKLVFALLPLYWAYAGFAGGL 316

Query: 208 FGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRVFGTYLDPKT 267
           FGYVCYD  H+FLHH K+P FMRK+KKYHLEHHYKN+QLGFGVTS FWD VFGTYL P  
Sbjct: 317 FGYVCYDECHFFLHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWDEVFGTYLGPDA 376

Query: 268 IPYARSK 274
            P ++ K
Sbjct: 377 -PLSKMK 382

>KLLA0D01639g Chr4 complement(146344..147489) [1146 bp, 381 aa] {ON}
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 381

 Score =  347 bits (891), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 156/236 (66%), Positives = 194/236 (82%)

Query: 28  DYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFGNFLEPFTKT 87
           DY  D+ ++ FL L++PL WQ+L   FT+DFY+DQVH+PRHYG  SAP+FGNFLEP +KT
Sbjct: 134 DYQNDYKKHKFLDLNKPLLWQVLFGKFTKDFYLDQVHRPRHYGKGSAPLFGNFLEPLSKT 193

Query: 88  HWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYLFHLDDSVPE 147
            W+MVP++W PVV Y+   +L  ++   AI LF++GVFVWTLIEY +HR+LFHLDD +PE
Sbjct: 194 PWWMVPVVWLPVVTYHIYTALMNMNQAFAIFLFAVGVFVWTLIEYGLHRFLFHLDDRLPE 253

Query: 148 TRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYWAHAGFAGGL 207
            +  F LHFLLHG+HHYLPMD++RLVMPP LF +LC PFY L FA+ P YWA AGFAGG+
Sbjct: 254 KQWAFTLHFLLHGVHHYLPMDRFRLVMPPTLFVVLCTPFYKLVFALLPYYWACAGFAGGM 313

Query: 208 FGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRVFGTYL 263
            GYVCYD+THYFLHH ++P +MRK+KKYHLEHHYKN++LGFGVTS FWD+VFGTYL
Sbjct: 314 LGYVCYDLTHYFLHHSQLPPYMRKLKKYHLEHHYKNYELGFGVTSWFWDKVFGTYL 369

>TDEL0B00680 Chr2 (128650..129801) [1152 bp, 383 aa] {ON} Anc_8.829
           YMR272C
          Length = 383

 Score =  347 bits (890), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 160/247 (64%), Positives = 199/247 (80%), Gaps = 1/247 (0%)

Query: 28  DYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFGNFLEPFTKT 87
           DY++D+  + FL L +PL  Q++   FT+DFY+DQ+H+PRHYG  SAP+FGNFLEP +KT
Sbjct: 136 DYSRDYKRHHFLDLQKPLLPQVMFGKFTKDFYVDQIHRPRHYGKGSAPLFGNFLEPLSKT 195

Query: 88  HWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYLFHLDDSVPE 147
            W+++P++W PVVLY+  V+ + ++ I  I  F +G FVWTLIEY +HR+LFH DD +PE
Sbjct: 196 SWYVIPMVWLPVVLYHVGVAFKNMNPIFTIFFFCLGTFVWTLIEYGLHRFLFHFDDWLPE 255

Query: 148 TRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYWAHAGFAGGL 207
           + + F LHFLLHG+HHYLPMDKYRLVMPP LF ILC PFY L F + P Y A+AGFAGGL
Sbjct: 256 SNVCFTLHFLLHGVHHYLPMDKYRLVMPPTLFVILCTPFYKLVFGLLPLYVAYAGFAGGL 315

Query: 208 FGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRVFGTYLDPKT 267
           FGYVCYD+THYFLHH K+PSFMRK+KKYHLEHHYKN+QLGFGVTS FWD+VFGTYL P T
Sbjct: 316 FGYVCYDLTHYFLHHSKLPSFMRKLKKYHLEHHYKNYQLGFGVTSWFWDKVFGTYLSP-T 374

Query: 268 IPYARSK 274
            P ++ K
Sbjct: 375 SPISQMK 381

>KLTH0C04114g Chr3 (357195..358331) [1137 bp, 378 aa] {ON} highly
           similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 378

 Score =  346 bits (887), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 152/236 (64%), Positives = 200/236 (84%)

Query: 28  DYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFGNFLEPFTKT 87
           DY KD+  + FL L+ PL  Q+L+S+F+++FY+DQVH+PRHYG  SAP+FGNFLEP +KT
Sbjct: 131 DYTKDYGRHKFLDLNRPLLMQMLTSDFSKEFYLDQVHRPRHYGRGSAPLFGNFLEPLSKT 190

Query: 88  HWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYLFHLDDSVPE 147
            W+++PL+W PVV+Y+   +L+ ++ +LA+ LF +GVFVWTLIEY +HR+LFHLD  +P 
Sbjct: 191 AWYVIPLVWFPVVVYHMYTALQNMNNVLAVFLFCLGVFVWTLIEYGLHRFLFHLDFYLPR 250

Query: 148 TRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYWAHAGFAGGL 207
            ++ + +HFLLHG+HHYLPMD+YRLVMPP LF +LC PFY L FA+ P+YWA AGFAGG+
Sbjct: 251 NQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFVVLCTPFYKLVFALLPKYWACAGFAGGM 310

Query: 208 FGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRVFGTYL 263
           FGY+CYD+THYFLHH K+PS+MRK+KKYH+EHHYKN++LGFGVTS FWD+VFGTYL
Sbjct: 311 FGYMCYDLTHYFLHHAKLPSYMRKLKKYHMEHHYKNYELGFGVTSWFWDKVFGTYL 366

>KNAG0J00320 Chr10 (50267..51388) [1122 bp, 373 aa] {ON} Anc_8.829
           YMR272C
          Length = 373

 Score =  338 bits (866), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 153/236 (64%), Positives = 192/236 (81%)

Query: 28  DYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFGNFLEPFTKT 87
           D  +D+ ++ FL L++PL  Q+L  +FT+DFY+DQ+H+PRHYG  SAP+FGNFLEP +KT
Sbjct: 126 DTKRDYQKHHFLDLEKPLIPQVLFGSFTKDFYVDQIHRPRHYGKGSAPLFGNFLEPISKT 185

Query: 88  HWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYLFHLDDSVPE 147
            W++VP++WGPVVLY    SL+ I  I A+ LF++G FVWTLIEYCMHR+LFH DD +PE
Sbjct: 186 AWYVVPIVWGPVVLYFLGRSLKGIHPIFALMLFALGGFVWTLIEYCMHRFLFHFDDWLPE 245

Query: 148 TRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYWAHAGFAGGL 207
             + F +HFLLHG+HHYLPMD YRLV+PPALF +LC PFY L F + P Y A AGFAGG+
Sbjct: 246 NNVAFTIHFLLHGVHHYLPMDGYRLVVPPALFVVLCTPFYKLVFKLLPHYVACAGFAGGM 305

Query: 208 FGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRVFGTYL 263
           FGY+CYD+ HYFLHH KMP FMRK+K+YHLEHHYKN+QLGFGV++ FWD+VF TYL
Sbjct: 306 FGYICYDLIHYFLHHSKMPKFMRKLKQYHLEHHYKNYQLGFGVSNWFWDKVFDTYL 361

>Kwal_27.10332 s27 (289484..290620) [1137 bp, 378 aa] {ON} YMR272C
           (SCS7) - desaturase/hydroxylase enzyme [contig 36] FULL
          Length = 378

 Score =  333 bits (854), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 146/247 (59%), Positives = 198/247 (80%), Gaps = 1/247 (0%)

Query: 28  DYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFGNFLEPFTKT 87
           DY +D+  + FL L+ PL  Q+L+++FT++FY+DQVH+PRHYG  SAP+FGNFLEP +KT
Sbjct: 131 DYTRDYGRHKFLDLNRPLLMQMLTADFTKEFYLDQVHRPRHYGRGSAPLFGNFLEPLSKT 190

Query: 88  HWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYLFHLDDSVPE 147
            W+++P++W PVV Y+   +++ ++ + A+ LF +G+FVWTLIEY MHR+LFHLD  +P 
Sbjct: 191 SWYVIPIVWLPVVAYHIFTAMQNMNKLFAVFLFFVGIFVWTLIEYGMHRFLFHLDFYLPR 250

Query: 148 TRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYWAHAGFAGGL 207
            ++ + +HFLLHG+HHYLPMD+YRLVMPP LF +LC PFY L FA+ P YWA AGFAGG+
Sbjct: 251 NQVAYTVHFLLHGVHHYLPMDRYRLVMPPTLFLLLCTPFYKLVFALLPYYWACAGFAGGM 310

Query: 208 FGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRVFGTYLDPKT 267
            GYVCYD+THYFLHH K+P  ++K+KKYH+EHHYKN++LGFGVTS  WD+VFGTYL  + 
Sbjct: 311 LGYVCYDLTHYFLHHAKLPGILKKLKKYHMEHHYKNYELGFGVTSWVWDKVFGTYL-AEN 369

Query: 268 IPYARSK 274
            P ++ K
Sbjct: 370 APLSQMK 376

>TBLA0D03180 Chr4 complement(774883..776085) [1203 bp, 400 aa] {ON}
           Anc_8.829 YMR272C
          Length = 400

 Score =  333 bits (854), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 151/240 (62%), Positives = 191/240 (79%)

Query: 28  DYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFGNFLEPFTKT 87
           DY KDFNE+ FL L++PL  QL  + F R FYIDQ+H+PRH+G +SAP+FGNFLEP TKT
Sbjct: 153 DYKKDFNEHHFLDLEKPLIPQLWRAKFNRAFYIDQIHRPRHFGNKSAPLFGNFLEPLTKT 212

Query: 88  HWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYLFHLDDSVPE 147
            W+++P++W PVV Y+  V+   ++ I A  LF +GVFVWTLIEY +HR+LFH+D+ +P+
Sbjct: 213 AWWVIPVVWLPVVFYHLKVAFHNMNNIFATFLFCVGVFVWTLIEYSLHRFLFHMDNRIPD 272

Query: 148 TRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYWAHAGFAGGL 207
             +F+VLHF +HG HHYLPMD YRLVMPP LF ILC PFY L F++ P YWA+AGFAGGL
Sbjct: 273 HPMFYVLHFTIHGCHHYLPMDPYRLVMPPTLFLILCTPFYKLVFSVLPLYWAYAGFAGGL 332

Query: 208 FGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRVFGTYLDPKT 267
           FGYVCYD  HY+LHH ++P FMR +KK HLEHHYKN+QL FGV++ FWD+VFGTYL P +
Sbjct: 333 FGYVCYDEVHYWLHHSRVPKFMRLLKKLHLEHHYKNYQLAFGVSNYFWDKVFGTYLYPDS 392

>ZYRO0G13948g Chr7 complement(1109941..1111095) [1155 bp, 384 aa]
           {ON} similar to uniprot|Q03529 Saccharomyces cerevisiae
           YMR272C SCS7 Required for the hydroxylation of the very
           long chain fatty acid (VLCFA) located in the endoplasmic
           reticulum desaturase/hydroxylase enzyme
          Length = 384

 Score =  330 bits (847), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 151/247 (61%), Positives = 191/247 (77%), Gaps = 1/247 (0%)

Query: 28  DYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFGNFLEPFTKT 87
           DY +D+ ++ FL L+  L  Q++  NF++DFY+DQVH+PRHYG  SAP+FGNFLEP +KT
Sbjct: 137 DYGRDYKKHKFLDLNRALLPQVMFGNFSKDFYLDQVHRPRHYGKGSAPLFGNFLEPISKT 196

Query: 88  HWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYLFHLDDSVPE 147
            W+ +P+IW PVV ++F V    ++ + +  LF +G+FVWTLIEYC+HR+LFHLD+ +P+
Sbjct: 197 PWWAIPIIWIPVVSFHFYVGFTNMNKLFSTFLFCLGIFVWTLIEYCLHRFLFHLDEWLPD 256

Query: 148 TRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYWAHAGFAGGL 207
                 LHFLLHG+HHYLPMD+YRLVMPP L  +L  P Y   F + P YWA++GFAGGL
Sbjct: 257 NNAALTLHFLLHGVHHYLPMDRYRLVMPPTLGIVLMAPIYKTVFGLLPTYWAYSGFAGGL 316

Query: 208 FGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRVFGTYLDPKT 267
           FGYVCYD+THYFLHH K+PS+MRK+KKYHLEHHYKN+QLGFGVTS FWD VFGTYL P  
Sbjct: 317 FGYVCYDLTHYFLHHAKLPSYMRKLKKYHLEHHYKNYQLGFGVTSWFWDNVFGTYLGPDA 376

Query: 268 IPYARSK 274
            P A  K
Sbjct: 377 -PLAHMK 382

>Suva_13.460 Chr13 complement(792221..793375) [1155 bp, 384 aa] {ON}
           YMR272C (REAL)
          Length = 384

 Score =  328 bits (840), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 161/247 (65%), Positives = 198/247 (80%), Gaps = 1/247 (0%)

Query: 28  DYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFGNFLEPFTKT 87
           DY  D+ ++ FL L++PL  Q+L S+FTRDFY+DQ+H+PRHYG  SAP+FGNFLEP TKT
Sbjct: 137 DYGSDYKKHKFLDLNKPLLMQILRSDFTRDFYVDQIHRPRHYGKGSAPLFGNFLEPLTKT 196

Query: 88  HWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYLFHLDDSVPE 147
            W++VP+ W PVV+Y+  V+L+ ++ + A  LF +G+FVWTLIEY +HR+LFH DD +PE
Sbjct: 197 AWWVVPVAWVPVVVYHMGVALKNMNPLFACFLFGVGMFVWTLIEYSLHRFLFHFDDWLPE 256

Query: 148 TRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYWAHAGFAGGL 207
           + + F  HFLLHG HHYLPMD YRLVMPP+LF ILC PFY L FA+ P YWA+AGFAGGL
Sbjct: 257 SNIAFATHFLLHGCHHYLPMDGYRLVMPPSLFVILCAPFYKLVFALLPLYWAYAGFAGGL 316

Query: 208 FGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRVFGTYLDPKT 267
           FGYVCYD  HYF+HH K+P FMRK+KKYHLEHHYKN+QLGFGVTS FWD VFGTYL P  
Sbjct: 317 FGYVCYDECHYFIHHSKLPPFMRKLKKYHLEHHYKNYQLGFGVTSWFWDDVFGTYLGPDA 376

Query: 268 IPYARSK 274
            P ++ K
Sbjct: 377 -PLSKMK 382

>TPHA0C04710 Chr3 complement(1015392..1016525) [1134 bp, 377 aa]
           {ON} Anc_8.829 YMR272C
          Length = 377

 Score =  325 bits (833), Expect = e-110,   Method: Compositional matrix adjust.
 Identities = 146/240 (60%), Positives = 192/240 (80%)

Query: 28  DYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFGNFLEPFTKT 87
           DY KDF ++ FL L++PL  Q+L+ NFTR+FYIDQ+H+PRHYG  SA +FGN+LEP + T
Sbjct: 130 DYKKDFVDHHFLDLEKPLLMQMLTGNFTREFYIDQIHRPRHYGKGSAKLFGNWLEPISLT 189

Query: 88  HWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYLFHLDDSVPE 147
            W+++P+IWGPVV+Y+F V  + +  + A+  + +G+FVWT IEYC+HR+LFHLDD VP+
Sbjct: 190 PWWLIPIIWGPVVVYHFYVGAQHMHPLSAVFFYFLGIFVWTFIEYCLHRFLFHLDDWVPQ 249

Query: 148 TRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYWAHAGFAGGL 207
              F+ +HFLLHG+HHYLPMD+YRLV+PPALF +LC PFY   FA+ P Y A+ GFAGGL
Sbjct: 250 HNFFYTIHFLLHGVHHYLPMDQYRLVVPPALFVVLCTPFYKAVFALLPLYVAYVGFAGGL 309

Query: 208 FGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRVFGTYLDPKT 267
            GY+ YD+THYF+HH K+P   RK+KK+HLEHHYKN+QLGFGV++ FWD VFGTYL P +
Sbjct: 310 TGYIIYDLTHYFIHHVKLPRVFRKIKKHHLEHHYKNYQLGFGVSNYFWDLVFGTYLGPDS 369

>KAFR0B03850 Chr2 complement(796399..797532) [1134 bp, 377 aa] {ON}
           Anc_8.829 YMR272C
          Length = 377

 Score =  322 bits (825), Expect = e-109,   Method: Compositional matrix adjust.
 Identities = 148/237 (62%), Positives = 191/237 (80%), Gaps = 1/237 (0%)

Query: 28  DYNKDFNENGFLKLDEPLFWQLLSSNFTRDFYIDQVHKPRHYGIESAPIFGN-FLEPFTK 86
           +Y++DF ++ FL L++PL  Q+L   FTR+FY+DQ+++PRHYG +SAP+FGN FLEPF+K
Sbjct: 129 NYDRDFKKHKFLDLNKPLLPQILKGKFTREFYVDQINRPRHYGQKSAPLFGNAFLEPFSK 188

Query: 87  THWFMVPLIWGPVVLYNFIVSLREISIILAITLFSIGVFVWTLIEYCMHRYLFHLDDSVP 146
           T W++VP  W PVV + F V+L+ ++  LA+ LF +GVFVWTL+EYC+HR+LFH D+ +P
Sbjct: 189 TAWWVVPTFWLPVVFHFFRVALKNMNNPLALFLFCVGVFVWTLLEYCLHRFLFHFDNYLP 248

Query: 147 ETRLFFVLHFLLHGIHHYLPMDKYRLVMPPALFSILCYPFYLLTFAIFPRYWAHAGFAGG 206
           E  + F LHFLLHG HHYLPMD YRLV+PPALF ILC P Y   F + P YWA AGFAGG
Sbjct: 249 ENNIAFALHFLLHGFHHYLPMDPYRLVVPPALFIILCAPIYKTVFLLLPYYWACAGFAGG 308

Query: 207 LFGYVCYDVTHYFLHHKKMPSFMRKVKKYHLEHHYKNFQLGFGVTSSFWDRVFGTYL 263
           LFGYV YD+ HY LHH K+P FMR++K+YHLEHHYKN++LG+G+TS FWD+VFGTYL
Sbjct: 309 LFGYVYYDMCHYALHHSKLPPFMRRLKQYHLEHHYKNYELGYGITSWFWDKVFGTYL 365

>KNAG0D00540 Chr4 (74025..76544) [2520 bp, 839 aa] {ON} Anc_6.308
           YNR013C
          Length = 839

 Score = 31.2 bits (69), Expect = 3.0,   Method: Composition-based stats.
 Identities = 28/107 (26%), Positives = 43/107 (40%), Gaps = 31/107 (28%)

Query: 45  LFWQLLSSNFTRD--FYIDQVHKPRHYGIESAPIFGNFLEPFTKTHWFMVPLIWGPVVLY 102
           L W +L  +F RD    I Q+H  R              +PFT T WF+     G ++L+
Sbjct: 601 LVWIILLLSFPRDPNVKILQLHPLR--------------DPFTATQWFVAVTSLGTIILW 646

Query: 103 -------NFIVSLREISIILAITLFSIGV--------FVWTLIEYCM 134
                    +  +  ISII  +  F  G+        F+WT++   M
Sbjct: 647 CMSNQLSGLMGEMGIISIIPMLLFFGTGLLSSDDFNNFMWTIVVLAM 693

>Kpol_1035.7 s1035 complement(14838..16652) [1815 bp, 604 aa] {ON}
           complement(14838..16652) [1815 nt, 605 aa]
          Length = 604

 Score = 30.4 bits (67), Expect = 5.7,   Method: Compositional matrix adjust.
 Identities = 21/67 (31%), Positives = 29/67 (43%), Gaps = 8/67 (11%)

Query: 174 MPPALFSILCYPFYLLTFAIFPRYWAHAGFAGGLFGYVCYDVTHYFLHHKKMPSFMRKVK 233
           M   LF  L  PF LL F+     W+  G+    FG++C  +T+         SF  K  
Sbjct: 420 MVKLLFGYLMQPFILLDFSKALEVWSKVGY----FGHICVVITYLLFKGPLSTSFKHKC- 474

Query: 234 KYHLEHH 240
              L+HH
Sbjct: 475 ---LDHH 478

>Kpol_462.9 s462 complement(24921..25511) [591 bp, 196 aa] {ON}
           complement(24921..25511) [591 nt, 197 aa]
          Length = 196

 Score = 29.6 bits (65), Expect = 6.5,   Method: Compositional matrix adjust.
 Identities = 12/32 (37%), Positives = 19/32 (59%)

Query: 106 VSLREISIILAITLFSIGVFVWTLIEYCMHRY 137
           + + E+S + A+T F +G  VW  I +C H Y
Sbjct: 44  IRVGEVSFVRALTEFLMGCMVWNFIIFCGHMY 75

>KNAG0D01240 Chr4 complement(209447..210472) [1026 bp, 341 aa] {ON}
           Anc_7.490 YJR111C
          Length = 341

 Score = 29.6 bits (65), Expect = 9.6,   Method: Compositional matrix adjust.
 Identities = 20/75 (26%), Positives = 39/75 (52%), Gaps = 5/75 (6%)

Query: 55  TRDFYIDQVHKP-RH----YGIESAPIFGNFLEPFTKTHWFMVPLIWGPVVLYNFIVSLR 109
           TR  ++D +H   RH    Y   S+ +  N    +    +F+V  ++GP+  ++ I+S++
Sbjct: 211 TRKDHVDVIHDGLRHWNSIYNKVSSRVVNNLHSSYPDLWYFVVAHVYGPLFSFDDILSVQ 270

Query: 110 EISIILAITLFSIGV 124
           E S+I+  +L    V
Sbjct: 271 ETSLIVIASLVPQDV 285

>TPHA0F00860 Chr6 (199814..201520) [1707 bp, 568 aa] {ON} Anc_8.592
           YBR168W
          Length = 568

 Score = 29.6 bits (65), Expect = 9.9,   Method: Compositional matrix adjust.
 Identities = 13/38 (34%), Positives = 20/38 (52%)

Query: 177 ALFSILCYPFYLLTFAIFPRYWAHAGFAGGLFGYVCYD 214
           ++ ++L Y F +L F I  RY+ H    G L+ Y   D
Sbjct: 105 SILTVLIYTFTVLYFQIITRYFGHVVIVGLLWSYSLLD 142

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.332    0.147    0.495 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 30,593,539
Number of extensions: 1367554
Number of successful extensions: 3705
Number of sequences better than 10.0: 34
Number of HSP's gapped: 3792
Number of HSP's successfully gapped: 34
Length of query: 277
Length of database: 53,481,399
Length adjustment: 108
Effective length of query: 169
Effective length of database: 41,097,471
Effective search space: 6945472599
Effective search space used: 6945472599
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 15 ( 7.2 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 40 (21.9 bits)
S2: 65 (29.6 bits)