Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1069.38.830ON1151155202e-69
ZYRO0G13970g8.830ON1121093381e-41
TDEL0B006708.830ON1111093268e-40
TBLA0B031908.830ON1221153233e-39
Suva_13.368.830ON1051083143e-38
CAGL0J06666g8.830ON1121053144e-38
YML108W8.830ON1051063127e-38
Smik_13.268.830ON1051053092e-37
TPHA0I001908.830ON138733122e-37
SAKL0D01738g8.830ON1781063135e-37
KAFR0A027608.830ON1121113076e-37
NCAS0B011008.830ON115773076e-37
Skud_13.338.830ON1051093059e-37
KLLA0D01661g8.830ON1121093069e-37
NDAI0E003608.830ON1221153052e-36
KNAG0G033608.830ON1111113032e-36
Kwal_27.103288.830ON1271092904e-34
AAL184W8.830ON1121092884e-34
KLTH0C04070g8.830ON1131052861e-33
Ecym_27118.830ON1151152833e-33
NCAS0B012208.689ON65645690.41
TBLA0B023403.101ON73640606.6
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1069.3
         (115 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1069.3 s1069 (4998..5345) [348 bp, 115 aa] {ON} (4998..5345...   204   2e-69
ZYRO0G13970g Chr7 complement(1111500..1111838) [339 bp, 112 aa] ...   134   1e-41
TDEL0B00670 Chr2 (127614..127949) [336 bp, 111 aa] {ON} Anc_8.83...   130   8e-40
TBLA0B03190 Chr2 complement(742438..742806) [369 bp, 122 aa] {ON...   129   3e-39
Suva_13.36 Chr13 (54612..54929) [318 bp, 105 aa] {ON} YML108W (R...   125   3e-38
CAGL0J06666g Chr10 complement(639077..639415) [339 bp, 112 aa] {...   125   4e-38
YML108W Chr13 (54793..55110) [318 bp, 105 aa] {ON} Putative prot...   124   7e-38
Smik_13.26 Chr13 (51023..51340) [318 bp, 105 aa] {ON} YML108W (R...   123   2e-37
TPHA0I00190 Chr9 complement(33784..34200) [417 bp, 138 aa] {ON} ...   124   2e-37
SAKL0D01738g Chr4 (138687..139223) [537 bp, 178 aa] {ON} similar...   125   5e-37
KAFR0A02760 Chr1 complement(575048..575386) [339 bp, 112 aa] {ON...   122   6e-37
NCAS0B01100 Chr2 complement(181912..182259) [348 bp, 115 aa] {ON...   122   6e-37
Skud_13.33 Chr13 (54349..54666) [318 bp, 105 aa] {ON} YML108W (R...   122   9e-37
KLLA0D01661g Chr4 complement(148193..148531) [339 bp, 112 aa] {O...   122   9e-37
NDAI0E00360 Chr5 (57992..58360) [369 bp, 122 aa] {ON} Anc_8.830 ...   122   2e-36
KNAG0G03360 Chr7 complement(723353..723688) [336 bp, 111 aa] {ON...   121   2e-36
Kwal_27.10328 s27 (287686..288069) [384 bp, 127 aa] {ON} YML108W...   116   4e-34
AAL184W Chr1 (12906..13244) [339 bp, 112 aa] {ON} Syntenic homol...   115   4e-34
KLTH0C04070g Chr3 (355923..356264) [342 bp, 113 aa] {ON} similar...   114   1e-33
Ecym_2711 Chr2 (1376908..1377255) [348 bp, 115 aa] {ON} similar ...   113   3e-33
NCAS0B01220 Chr2 (202044..204014) [1971 bp, 656 aa] {ON} Anc_8.6...    31   0.41 
TBLA0B02340 Chr2 complement(545918..548128) [2211 bp, 736 aa] {O...    28   6.6  

>Kpol_1069.3 s1069 (4998..5345) [348 bp, 115 aa] {ON} (4998..5345)
           [348 nt, 116 aa]
          Length = 115

 Score =  204 bits (520), Expect = 2e-69,   Method: Compositional matrix adjust.
 Identities = 103/115 (89%), Positives = 103/115 (89%)

Query: 1   MAGGAESNYRMLILLEEGMENLXXXXXXXXXXXXPKESKKMHEFVDELVLPFQVDEIDSL 60
           MAGGAESNYRMLILLEEGMENL            PKESKKMHEFVDELVLPFQVDEIDSL
Sbjct: 1   MAGGAESNYRMLILLEEGMENLDEEQTQQDRTEEPKESKKMHEFVDELVLPFQVDEIDSL 60

Query: 61  NDWFDKFDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQSNHDSK 115
           NDWFDKFDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQSNHDSK
Sbjct: 61  NDWFDKFDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQSNHDSK 115

>ZYRO0G13970g Chr7 complement(1111500..1111838) [339 bp, 112 aa]
           {ON} highly similar to uniprot|Q03759 Saccharomyces
           cerevisiae YML108W defines a new subfamily of the split
           beta-alpha-beta sandwiches.
          Length = 112

 Score =  134 bits (338), Expect = 1e-41,   Method: Compositional matrix adjust.
 Identities = 67/109 (61%), Positives = 83/109 (76%), Gaps = 11/109 (10%)

Query: 3   GGAESNYRMLILLEEGMENLXXXXXXXXXXXXPKESKKMHEFVDELVLPFQVDEIDSLND 62
            G E++YRML+LLEE +               P++ KK+HEF+DELVLPF VDEID LN 
Sbjct: 2   SGPENSYRMLVLLEEPVSG-----------SKPEDEKKVHEFMDELVLPFNVDEIDQLNS 50

Query: 63  WFDKFDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQSN 111
           WFDKFDE+ICIPNEGHIKYEITSDGIIVLILDKE+E ++ +V+ FV+ +
Sbjct: 51  WFDKFDEQICIPNEGHIKYEITSDGIIVLILDKEMEPLVSQVRSFVEKH 99

>TDEL0B00670 Chr2 (127614..127949) [336 bp, 111 aa] {ON} Anc_8.830
           YML108W
          Length = 111

 Score =  130 bits (326), Expect = 8e-40,   Method: Compositional matrix adjust.
 Identities = 65/109 (59%), Positives = 84/109 (77%), Gaps = 1/109 (0%)

Query: 3   GGAESNYRMLILLEEGMENLXXXXXXXXXXXXPKESKKMHEFVDELVLPFQVDEIDSLND 62
           GG ++ Y M+I LEE +EN              ++ K  HEFVDELVLPFQVDEID+LN+
Sbjct: 2   GGNDNFYHMIIFLEESIEN-GQEGNSVDNGEDKQDVKSSHEFVDELVLPFQVDEIDALNE 60

Query: 63  WFDKFDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQSN 111
           WFDKFDE++CIPNEGHIKYEITSDG++VL+LDKE+E++++ VK FV+ N
Sbjct: 61  WFDKFDEKLCIPNEGHIKYEITSDGMMVLLLDKELEHLVNDVKTFVEEN 109

>TBLA0B03190 Chr2 complement(742438..742806) [369 bp, 122 aa] {ON}
           Anc_8.830 YML108W
          Length = 122

 Score =  129 bits (323), Expect = 3e-39,   Method: Compositional matrix adjust.
 Identities = 66/115 (57%), Positives = 83/115 (72%), Gaps = 11/115 (9%)

Query: 9   YRMLILLEEGME------NLXXXXXX-----XXXXXXPKESKKMHEFVDELVLPFQVDEI 57
           YRM++LLEE ME      NL                   E KK HEF+DEL+LPF VDE+
Sbjct: 8   YRMMVLLEEDMEPIEDDINLKSESSSNDNTEKVTTTKNTEPKKSHEFIDELILPFHVDEL 67

Query: 58  DSLNDWFDKFDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQSNH 112
           D LN+WFDKFDE+ICIPNEGHIKYEITSDG+I+LILD +I++V+++VK+FVQ+N 
Sbjct: 68  DILNEWFDKFDEQICIPNEGHIKYEITSDGLIILILDNDIKHVVEQVKDFVQNNQ 122

>Suva_13.36 Chr13 (54612..54929) [318 bp, 105 aa] {ON} YML108W
           (REAL)
          Length = 105

 Score =  125 bits (314), Expect = 3e-38,   Method: Compositional matrix adjust.
 Identities = 65/108 (60%), Positives = 79/108 (73%), Gaps = 5/108 (4%)

Query: 4   GAESNYRMLILLEEGMENLXXXXXXXXXXXXPKESKKMHEFVDELVLPFQVDEIDSLNDW 63
              + YRML+LLE+  +                +  KMHEFVDEL+LPFQVDE+D LN W
Sbjct: 2   AKNNTYRMLVLLEDDTK-----INKEDEKFLKGKPGKMHEFVDELMLPFQVDELDELNVW 56

Query: 64  FDKFDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQSN 111
           FDKFD EICIPNEGHIKYEI+SDG+IVL+LDKEIE+V++KVK FV+ N
Sbjct: 57  FDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEIEDVVEKVKRFVEEN 104

>CAGL0J06666g Chr10 complement(639077..639415) [339 bp, 112 aa] {ON}
           similar to uniprot|Q03759 Saccharomyces cerevisiae
           YML108w
          Length = 112

 Score =  125 bits (314), Expect = 4e-38,   Method: Compositional matrix adjust.
 Identities = 67/105 (63%), Positives = 78/105 (74%), Gaps = 7/105 (6%)

Query: 9   YRMLILLEEGMENLXXXXXXXXXXXXPKESKKMHEFVDELVLPFQVDEIDSLNDWFDKFD 68
           YRM++LLEE ME               +E K MHEF+DEL LPFQ+DEID LN WFDKFD
Sbjct: 5   YRMMVLLEEPMEE------DITISDSKEEKKVMHEFMDELTLPFQIDEIDLLNKWFDKFD 58

Query: 69  EEICIPNEGHIKYEITSDGIIVLILDKEI-ENVLDKVKEFVQSNH 112
           +EICIPNEGHIKYEITSDG+IVLILDKE+ E  + KVK FV+ N+
Sbjct: 59  DEICIPNEGHIKYEITSDGLIVLILDKELGEEFVGKVKTFVEQNN 103

>YML108W Chr13 (54793..55110) [318 bp, 105 aa] {ON} Putative protein
           of unknown function whose structure defines a new
           subfamily of the split beta-alpha-beta sandwiches; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; YML108W is not an essential
           gene
          Length = 105

 Score =  124 bits (312), Expect = 7e-38,   Method: Compositional matrix adjust.
 Identities = 64/106 (60%), Positives = 79/106 (74%), Gaps = 5/106 (4%)

Query: 7   SNYRMLILLEEGMENLXXXXXXXXXXXXPKESKKMHEFVDELVLPFQVDEIDSLNDWFDK 66
           + YRML+LLE+  +                +  KMHEFVDEL+LPF VDE+D LN WFDK
Sbjct: 5   NTYRMLVLLEDDTK-----INKEDEKFLKGKPGKMHEFVDELILPFNVDELDELNTWFDK 59

Query: 67  FDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQSNH 112
           FD EICIPNEGHIKYEI+SDG+IVL+LDKEIE V++KVK+FV+ N+
Sbjct: 60  FDAEICIPNEGHIKYEISSDGLIVLMLDKEIEEVVEKVKKFVEENN 105

>Smik_13.26 Chr13 (51023..51340) [318 bp, 105 aa] {ON} YML108W
           (REAL)
          Length = 105

 Score =  123 bits (309), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 64/105 (60%), Positives = 78/105 (74%), Gaps = 5/105 (4%)

Query: 7   SNYRMLILLEEGMENLXXXXXXXXXXXXPKESKKMHEFVDELVLPFQVDEIDSLNDWFDK 66
           + YRML+LLE+  +                +  KMHEFVDEL+LPF VDE+D LN WFDK
Sbjct: 5   NTYRMLVLLEDDAK-----VNKEDEKFLKGKPGKMHEFVDELILPFDVDELDELNIWFDK 59

Query: 67  FDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQSN 111
           FD EICIPNEGHIKYEI+SDG+IVL+LDKEIE V++KVK+FV+ N
Sbjct: 60  FDAEICIPNEGHIKYEISSDGLIVLMLDKEIEEVIEKVKQFVEDN 104

>TPHA0I00190 Chr9 complement(33784..34200) [417 bp, 138 aa] {ON}
           Anc_8.830 YML108W
          Length = 138

 Score =  124 bits (312), Expect = 2e-37,   Method: Compositional matrix adjust.
 Identities = 57/73 (78%), Positives = 67/73 (91%)

Query: 40  KMHEFVDELVLPFQVDEIDSLNDWFDKFDEEICIPNEGHIKYEITSDGIIVLILDKEIEN 99
           K HEFVDEL+LPF VDE+D LN+WFDKFD+E+CIPNEGHIKYEITSDG+IVL+LDKEIE+
Sbjct: 47  KSHEFVDELILPFNVDELDMLNEWFDKFDDEVCIPNEGHIKYEITSDGLIVLMLDKEIEH 106

Query: 100 VLDKVKEFVQSNH 112
           V+ KVKEFV +N 
Sbjct: 107 VVSKVKEFVSANQ 119

>SAKL0D01738g Chr4 (138687..139223) [537 bp, 178 aa] {ON} similar to
           uniprot|Q03759 Saccharomyces cerevisiae YML108W defines
           a new subfamily of the split beta-alpha- beta
           sandwiches.
          Length = 178

 Score =  125 bits (313), Expect = 5e-37,   Method: Compositional matrix adjust.
 Identities = 63/106 (59%), Positives = 78/106 (73%), Gaps = 7/106 (6%)

Query: 4   GAESNYRMLILLEEGMENLXXXXXXXXXXXXPKESKKMHEFVDELVLPFQVDEIDSLNDW 63
             ++ YRML+LLEE + +                +K  HEFVDELVLP QVDE+D LNDW
Sbjct: 71  SGDNGYRMLMLLEEAIPD-------SSQENNENTTKTSHEFVDELVLPIQVDEMDLLNDW 123

Query: 64  FDKFDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQ 109
           FDKFDE+ICIPNEG+IKYEI+SDG+IVLIL+KE E V+DKV+ FV+
Sbjct: 124 FDKFDEQICIPNEGYIKYEISSDGLIVLILNKEREEVVDKVRRFVE 169

>KAFR0A02760 Chr1 complement(575048..575386) [339 bp, 112 aa] {ON}
           Anc_8.830 YML108W
          Length = 112

 Score =  122 bits (307), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 65/111 (58%), Positives = 87/111 (78%), Gaps = 1/111 (0%)

Query: 3   GGAESNYRMLILLEEGMENLXXXXXXXXXXXXPK-ESKKMHEFVDELVLPFQVDEIDSLN 61
            G+++ YRML+LLEE  E +            PK ES K HEF++EL+LPF+  E+D+LN
Sbjct: 2   AGSDNRYRMLVLLEEESEEVIEKFEDNDNGEQPKQESTKSHEFIEELILPFETSELDTLN 61

Query: 62  DWFDKFDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQSNH 112
           +WFDKFDEEICIPNEG+IKYEI+SDG++VL++DK+IENV++KVKEFV +N 
Sbjct: 62  EWFDKFDEEICIPNEGNIKYEISSDGLVVLLIDKQIENVVEKVKEFVNNNQ 112

>NCAS0B01100 Chr2 complement(181912..182259) [348 bp, 115 aa] {ON}
           Anc_8.830 YML108W
          Length = 115

 Score =  122 bits (307), Expect = 6e-37,   Method: Compositional matrix adjust.
 Identities = 56/77 (72%), Positives = 69/77 (89%)

Query: 37  ESKKMHEFVDELVLPFQVDEIDSLNDWFDKFDEEICIPNEGHIKYEITSDGIIVLILDKE 96
           E KK HEF++EL+LPF+V E+D+LN WFDKFDEEICIPNEGHIKYEI+SDG+IVL+LDKE
Sbjct: 34  EPKKTHEFIEELLLPFEVSELDALNKWFDKFDEEICIPNEGHIKYEISSDGLIVLLLDKE 93

Query: 97  IENVLDKVKEFVQSNHD 113
           IENV+ +VK+F+  N D
Sbjct: 94  IENVISEVKKFIDDNQD 110

>Skud_13.33 Chr13 (54349..54666) [318 bp, 105 aa] {ON} YML108W
           (REAL)
          Length = 105

 Score =  122 bits (305), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 64/109 (58%), Positives = 82/109 (75%), Gaps = 6/109 (5%)

Query: 5   AESN-YRMLILLEEGMENLXXXXXXXXXXXXPKESKKMHEFVDELVLPFQVDEIDSLNDW 63
           ++SN YRML+LLE+  +                +  KMHEFVDEL+LPF++DE+D LN W
Sbjct: 2   SKSNAYRMLVLLEDDTK-----ISKEDEKFLKGKPGKMHEFVDELILPFEIDELDELNIW 56

Query: 64  FDKFDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQSNH 112
           FDKFD EICIPNEGHIKYEI+SDG+IVL+LDKEI+ V++KVK FV+ N+
Sbjct: 57  FDKFDAEICIPNEGHIKYEISSDGLIVLMLDKEIQEVVEKVKNFVEDNN 105

>KLLA0D01661g Chr4 complement(148193..148531) [339 bp, 112 aa] {ON}
           similar to uniprot|Q03759 Saccharomyces cerevisiae
           YML108W defines a new subfamily of the split beta-alpha-
           beta sandwiches.
          Length = 112

 Score =  122 bits (306), Expect = 9e-37,   Method: Compositional matrix adjust.
 Identities = 63/109 (57%), Positives = 75/109 (68%), Gaps = 8/109 (7%)

Query: 3   GGAESNYRMLILLEEGMENLXXXXXXXXXXXXPKESKKMHEFVDELVLPFQVDEIDSLND 62
              E+ YRMLILLEE +                K+    HEFVDEL LP QVDE+D LN 
Sbjct: 2   SATENVYRMLILLEEPISE--------SAGDTKKKQNATHEFVDELPLPIQVDEMDLLNS 53

Query: 63  WFDKFDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQSN 111
           WFDKFDE+ICIPNEGHIKYEI+SDG+IVLILDK IE+++ +V  FV+ N
Sbjct: 54  WFDKFDEKICIPNEGHIKYEISSDGLIVLILDKSIEHIVQEVTSFVEQN 102

>NDAI0E00360 Chr5 (57992..58360) [369 bp, 122 aa] {ON} Anc_8.830
           YML108W
          Length = 122

 Score =  122 bits (305), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 62/115 (53%), Positives = 81/115 (70%), Gaps = 11/115 (9%)

Query: 9   YRMLILLEEGM-----------ENLXXXXXXXXXXXXPKESKKMHEFVDELVLPFQVDEI 57
           YR++ILLEE +           E               K  KKMHEF++EL+LPF  +E+
Sbjct: 8   YRLMILLEEEIGEPDLKDGSIDEATETETKDVHNSDEEKNVKKMHEFIEELILPFGTEEL 67

Query: 58  DSLNDWFDKFDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQSNH 112
           D LN+WFDKFDEEICIPNEGHIKYEITSDG+IVL+LDKEIE+V+ ++K+F+++N 
Sbjct: 68  DLLNEWFDKFDEEICIPNEGHIKYEITSDGLIVLLLDKEIEDVVGEIKKFIETNQ 122

>KNAG0G03360 Chr7 complement(723353..723688) [336 bp, 111 aa] {ON}
           Anc_8.830 YML108W
          Length = 111

 Score =  121 bits (303), Expect = 2e-36,   Method: Compositional matrix adjust.
 Identities = 59/111 (53%), Positives = 81/111 (72%), Gaps = 1/111 (0%)

Query: 1   MAGGAESNYRMLILLEEGMENLXXXXXXXXXXXXPKESKKMHEFVDELVLPFQVDEIDSL 60
           M    +  YRMLIL+EE +E+              +  K  HE++DEL LPF +DE+D+L
Sbjct: 1   MVQQGDDTYRMLILVEEPLED-DVPTTEVTSEDGSQPIKSTHEYIDELHLPFGLDELDAL 59

Query: 61  NDWFDKFDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQSN 111
           N+WFDKFDEEICIPNEGHIKYEI+SDG+IVL+L KEIE+V +++K F++++
Sbjct: 60  NEWFDKFDEEICIPNEGHIKYEISSDGLIVLMLGKEIEHVYEQIKSFIETH 110

>Kwal_27.10328 s27 (287686..288069) [384 bp, 127 aa] {ON} YML108W -
           Hypothetical ORF [contig 36] FULL
          Length = 127

 Score =  116 bits (290), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 56/109 (51%), Positives = 78/109 (71%), Gaps = 2/109 (1%)

Query: 6   ESNYRMLILLEEGMENLXXXXXXXXXXXXPKESKKMHEFVDELVLPFQVDEIDSLNDWFD 65
           E  YRML+L+E+ +++                 K  HEFVDEL+LPF++D++D+LN+WFD
Sbjct: 18  ERAYRMLVLVEDPVKS--EGTVDGEKEENTDAPKATHEFVDELILPFEIDDMDTLNEWFD 75

Query: 66  KFDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQSNHDS 114
           KFD EICIPNEG IKYEI+SDG++VL+LD+  E V+ +V++FVQS   S
Sbjct: 76  KFDAEICIPNEGFIKYEISSDGLVVLLLDRSREEVVAEVRKFVQSERAS 124

>AAL184W Chr1 (12906..13244) [339 bp, 112 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YML108W
          Length = 112

 Score =  115 bits (288), Expect = 4e-34,   Method: Compositional matrix adjust.
 Identities = 60/109 (55%), Positives = 75/109 (68%), Gaps = 8/109 (7%)

Query: 4   GAESNYRMLILLEEGMENLXXXXXXXXXXXXPKESKKMHEFVDELVLPFQVDEIDSLNDW 63
             ++ YRM+ILLEE  +               K     H+FVDEL+LP QVD+++ LN W
Sbjct: 2   ATDNFYRMMILLEEPHKQ--------HSTDGRKIENASHDFVDELLLPIQVDDLEVLNTW 53

Query: 64  FDKFDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQSNH 112
           FDKFDEEICIPNEGHIKYEI+SDG+IVLILDKEI  V+  V++FV +N 
Sbjct: 54  FDKFDEEICIPNEGHIKYEISSDGLIVLILDKEISEVIGLVRDFVAANQ 102

>KLTH0C04070g Chr3 (355923..356264) [342 bp, 113 aa] {ON} similar to
           uniprot|Q03759 Saccharomyces cerevisiae YML108W defines
           a new subfamily of the split beta-alpha- beta
           sandwiches.
          Length = 113

 Score =  114 bits (286), Expect = 1e-33,   Method: Compositional matrix adjust.
 Identities = 54/105 (51%), Positives = 77/105 (73%), Gaps = 2/105 (1%)

Query: 6   ESNYRMLILLEEGMENLXXXXXXXXXXXXPKESKKMHEFVDELVLPFQVDEIDSLNDWFD 65
           E NYRML+L+E+ +E                  K  HEFVDEL+LPF++D++D LN+WFD
Sbjct: 4   ERNYRMLVLVEDVLEQAGEKNEQETKGEGA--PKATHEFVDELILPFEIDDMDKLNEWFD 61

Query: 66  KFDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQS 110
           KFD +ICIPNEG IKYEI+SDG++VL+LD+  E+V+ +V++FV++
Sbjct: 62  KFDADICIPNEGFIKYEISSDGLVVLLLDRSKEDVVAQVRKFVEA 106

>Ecym_2711 Chr2 (1376908..1377255) [348 bp, 115 aa] {ON} similar to
           Ashbya gossypii AAL184W
          Length = 115

 Score =  113 bits (283), Expect = 3e-33,   Method: Compositional matrix adjust.
 Identities = 58/115 (50%), Positives = 80/115 (69%), Gaps = 19/115 (16%)

Query: 2   AGGAESNYRMLILLEEGM-----ENLXXXXXXXXXXXXPKESKKMHEFVDELVLPFQVDE 56
           A  A++ YRM+ILLEE +     EN+              ++   H+FVDE+VLP QVDE
Sbjct: 3   AMSADNFYRMMILLEEAIPESKDENI--------------KANATHDFVDEVVLPMQVDE 48

Query: 57  IDSLNDWFDKFDEEICIPNEGHIKYEITSDGIIVLILDKEIENVLDKVKEFVQSN 111
           +D LN WFDKFDEEIC+PNEG+IKYEI+SDG+IVL++ +E  +++++VK FV  N
Sbjct: 49  LDVLNKWFDKFDEEICLPNEGYIKYEISSDGLIVLMVSQERSSIVNQVKNFVAKN 103

>NCAS0B01220 Chr2 (202044..204014) [1971 bp, 656 aa] {ON}
          Anc_8.689 YOR249C
          Length = 656

 Score = 31.2 bits (69), Expect = 0.41,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 24/45 (53%), Gaps = 2/45 (4%)

Query: 44 FVDELVLPFQVDEIDSLN--DWFDKFDEEICIPNEGHIKYEITSD 86
          FV  ++  FQ    D L+  DW+ K ++ I +P  GH    +TS+
Sbjct: 44 FVKLIIPTFQTSAFDPLSESDWYTKNNDGILLPTSGHFVSLLTSN 88

>TBLA0B02340 Chr2 complement(545918..548128) [2211 bp, 736 aa] {ON}
           Anc_3.101 YOL095C
          Length = 736

 Score = 27.7 bits (60), Expect = 6.6,   Method: Compositional matrix adjust.
 Identities = 17/40 (42%), Positives = 29/40 (72%), Gaps = 5/40 (12%)

Query: 75  NEGHIKYEITSDGIIVLIL-DKEIENVLDKVKEFVQSNHD 113
           +EGH+K    +D I++L L +K ++NV+DK+K+ VQ  +D
Sbjct: 46  SEGHLK----ADEILILSLTNKAVDNVIDKLKKNVQELND 81

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.315    0.138    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 12,043,854
Number of extensions: 504151
Number of successful extensions: 1220
Number of sequences better than 10.0: 33
Number of HSP's gapped: 1208
Number of HSP's successfully gapped: 33
Length of query: 115
Length of database: 53,481,399
Length adjustment: 85
Effective length of query: 30
Effective length of database: 43,734,789
Effective search space: 1312043670
Effective search space used: 1312043670
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 59 (27.3 bits)