Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1068.98.839ON74574534460.0
TPHA0I002408.839ON73265024170.0
TDEL0B005808.839ON71363923620.0
ZYRO0G14168g8.839ON76463923220.0
TBLA0D032608.839ON76867922800.0
CAGL0M02959g8.839ON75858022730.0
NCAS0C004208.839ON72564422310.0
KAFR0B039108.839ON72465322110.0
NDAI0K004208.839ON77869621090.0
Skud_13.4498.839ON73465919860.0
YMR277W (FCP1)8.839ON73265919770.0
Smik_13.4908.839ON73266319750.0
KNAG0J002808.839ON74265919750.0
Suva_13.4658.839ON73265719640.0
SAKL0D01496g8.839ON68859519530.0
Kwal_27.102638.839ON74359619110.0
KLTH0C03894g8.839ON74558618920.0
Ecym_46108.839ON75159218830.0
ABL127W8.839ON72858518770.0
KLLA0D01595g8.839ON71958017800.0
YLR019W (PSR2)5.202ON397451101e-04
TPHA0E030705.202ON494511101e-04
SAKL0G12870g5.202ON399601092e-04
Skud_12.875.202ON392451063e-04
Smik_12.825.202ON392451064e-04
Suva_10.995.202ON385451010.001
NDAI0D018605.202ON514511020.001
TBLA0C060905.202ON48451990.003
NCAS0A068005.202ON47351960.006
Suva_10.655.202ON41545960.007
Smik_12.535.202ON41445960.007
YLL010C (PSR1)5.202ON42745950.008
KNAG0M017405.202ON48145950.008
Kpol_478.165.202ON35093940.009
KLLA0F15620g5.202ON41445940.011
TPHA0N006705.202ON45241920.021
Skud_12.575.202ON41540910.026
Kpol_1010.615.94ON932110910.031
NDAI0I021705.202ON39145880.057
TBLA0H019905.202ON68840880.070
NCAS0D027405.202ON39840870.071
Kpol_2002.1005.202ON477107860.093
CAGL0D03234g5.202ON41040860.097
TDEL0E042705.202ON45345860.11
Ecym_71045.202ON49240850.12
CAGL0D05610g5.202ON44740850.13
ZYRO0B10428g5.202ON48240850.13
AAL158W5.202ON47840830.26
Kwal_14.22294.156ON67446830.27
Kwal_33.151405.202ON41040820.32
TPHA0H010705.94ON101586820.37
Kwal_14.10425.94ON91293810.47
KLTH0C01584g5.94ON913108810.50
TBLA0I014602.530ON39397800.52
KAFR0E021405.94ON95191800.62
KAFR0A065604.156ON55584790.76
NDAI0G016203.196ON73949790.82
Skud_12.5457.514ON700130780.97
KLTH0B03388g5.202ON40940771.1
KAFR0J009905.202ON48340771.2
ZYRO0B01958g2.530ON33663761.2
NDAI0C032305.94ON103482781.3
TPHA0A051105.94ON106560771.5
SAKL0H20592g4.156ON50855761.6
Smik_8.2385.94ON107574761.8
TBLA0B073905.94ON103168761.8
TDEL0A030502.530ON35533752.1
YHR154W (RTT107)5.94ON107074752.3
KLLA0E15621g5.94ON89167742.9
SAKL0G15620g5.94ON879103734.1
Smik_9.2107.175ON56553734.4
KLTH0H08954g4.156ON63546734.4
KNAG0E041507.17ON113643725.5
NCAS0F009302.530ON42236715.6
ADL145C5.94ON87577716.4
KLLA0E23101g8.527ON48047716.8
YPL063W (TIM50)8.527ON476100717.1
Skud_16.2188.527ON480110707.6
Smik_4.7005.533ON62552707.9
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1068.9
         (745 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON...  1332   0.0  
TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839...   935   0.0  
TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {O...   914   0.0  
ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} simi...   899   0.0  
TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.8...   882   0.0  
CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} simil...   880   0.0  
NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}...   863   0.0  
KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.8...   856   0.0  
NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON...   816   0.0  
Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277...   769   0.0  
YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}  FCP1Carbo...   766   0.0  
Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277...   765   0.0  
KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON...   765   0.0  
Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277...   761   0.0  
SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {...   756   0.0  
Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {...   740   0.0  
KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {...   733   0.0  
Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar...   729   0.0  
ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic ho...   727   0.0  
KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {...   690   0.0  
YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}  PSR2Funct...    47   1e-04
TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.2...    47   1e-04
SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} simi...    47   2e-04
Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W...    45   3e-04
Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W...    45   4e-04
Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W...    44   0.001
NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202     44   0.001
TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa] ...    43   0.003
NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON} Anc_5...    42   0.006
Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {O...    42   0.007
Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {O...    42   0.007
YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON} ...    41   0.008
KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5....    41   0.008
Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}...    41   0.009
KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]...    41   0.011
TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {...    40   0.021
Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {O...    40   0.026
Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932...    40   0.031
NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202     39   0.057
TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.2...    39   0.070
NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {O...    38   0.071
Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]...    38   0.093
CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} simila...    38   0.097
TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.2...    38   0.11 
Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar t...    37   0.12 
CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {...    37   0.13 
ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} simila...    37   0.13 
AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homo...    37   0.26 
Kwal_14.2229 s14 complement(665073..667097) [2025 bp, 674 aa] {O...    37   0.27 
Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {...    36   0.32 
TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5....    36   0.37 
Kwal_14.1042 s14 complement(168504..171242) [2739 bp, 912 aa] {O...    36   0.47 
KLTH0C01584g Chr3 complement(139563..142304) [2742 bp, 913 aa] {...    36   0.50 
TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {O...    35   0.52 
KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.9...    35   0.62 
KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa] ...    35   0.76 
NDAI0G01620 Chr7 (357000..359219) [2220 bp, 739 aa] {ON} Anc_3.1...    35   0.82 
Skud_12.545 Chr12 complement(973113..975215) [2103 bp, 700 aa] {...    35   0.97 
KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} simila...    34   1.1  
KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {...    34   1.2  
ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {...    34   1.2  
NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5....    35   1.3  
TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON} Anc_...    34   1.5  
SAKL0H20592g Chr8 complement(1805321..1806847) [1527 bp, 508 aa]...    34   1.6  
Smik_8.238 Chr8 (379729..382956) [3228 bp, 1075 aa] {ON} YHR154W...    34   1.8  
TBLA0B07390 Chr2 complement(1758977..1762072) [3096 bp, 1031 aa]...    34   1.8  
TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {O...    33   2.1  
YHR154W Chr8 (402966..406178) [3213 bp, 1070 aa] {ON}  RTT107Pro...    33   2.3  
KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]...    33   2.9  
SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some...    33   4.1  
Smik_9.210 Chr9 (351328..353025) [1698 bp, 565 aa] {ON} YIR010W ...    33   4.4  
KLTH0H08954g Chr8 complement(770614..772521) [1908 bp, 635 aa] {...    33   4.4  
KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {...    32   5.5  
NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.5...    32   5.6  
ADL145C Chr4 complement(435983..438610) [2628 bp, 875 aa] {ON} S...    32   6.4  
KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]...    32   6.8  
YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}  TIM50Esse...    32   7.1  
Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063...    32   7.6  
Smik_4.700 Chr4 (1240828..1242705) [1878 bp, 625 aa] {ON} YDR425...    32   7.9  

>Kpol_1068.9 s1068 complement(15966..18203) [2238 bp, 745 aa] {ON}
           complement(15966..18203) [2238 nt, 746 aa]
          Length = 745

 Score = 1332 bits (3446), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 658/745 (88%), Positives = 658/745 (88%)

Query: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVNDEH 60
           MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVNDEH
Sbjct: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVNDEH 60

Query: 61  SKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCGK 120
           SKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCGK
Sbjct: 61  SKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCGK 120

Query: 121 EVDESDQVSANLTISHTDTNLKVSRREANDIGQGXXXXXXXXXXXXXVVDLDQTVIHCGV 180
           EVDESDQVSANLTISHTDTNLKVSRREANDIGQG             VVDLDQTVIHCGV
Sbjct: 121 EVDESDQVSANLTISHTDTNLKVSRREANDIGQGIKKRLIREKKLILVVDLDQTVIHCGV 180

Query: 181 DPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIRPGLKEF 240
           DPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIRPGLKEF
Sbjct: 181 DPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIRPGLKEF 240

Query: 241 FEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLERLFPTD 300
           FEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLERLFPTD
Sbjct: 241 FEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLERLFPTD 300

Query: 301 QSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRNHKKTED 360
           QSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRNHKKTED
Sbjct: 301 QSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRNHKKTED 360

Query: 361 TDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQVRKEDITKKIEFSASL 420
           TDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQVRKEDITKKIEFSASL
Sbjct: 361 TDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQVRKEDITKKIEFSASL 420

Query: 421 EVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEELKTDKEIQIQTLMP 480
           EVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEELKTDKEIQIQTLMP
Sbjct: 421 EVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEELKTDKEIQIQTLMP 480

Query: 481 KLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHVITKTPHTYK 540
           KLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHVITKTPHTYK
Sbjct: 481 KLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHVITKTPHTYK 540

Query: 541 AKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPTATDKELNXXXXXXXXXXXX 600
           AKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPTATDKELN            
Sbjct: 541 AKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPTATDKELNEFKEALERRKKK 600

Query: 601 XXXXXXXXXXXSLEGDSNSPSSQGASVDLFASGASWLXXXXXXXXXXXXXXXXXXXXXXX 660
                      SLEGDSNSPSSQGASVDLFASGASWL                       
Sbjct: 601 ETKTKITVSEESLEGDSNSPSSQGASVDLFASGASWLIDDDDDEIIDSEEEESKEPEYDE 660

Query: 661 FADDNNDLQTVKKHPLESNEFTDEDGSNKKVHIAXXXXXXXXXXXXXXXXXLSEDKTSQP 720
           FADDNNDLQTVKKHPLESNEFTDEDGSNKKVHIA                 LSEDKTSQP
Sbjct: 661 FADDNNDLQTVKKHPLESNEFTDEDGSNKKVHIAEEDEGQNEGQDEGQDDQLSEDKTSQP 720

Query: 721 KXXXXXXXXXXXILNALDDSDDDEE 745
           K           ILNALDDSDDDEE
Sbjct: 721 KDEESDSELEEEILNALDDSDDDEE 745

>TPHA0I00240 Chr9 (43854..46052) [2199 bp, 732 aa] {ON} Anc_8.839
           YMR277W
          Length = 732

 Score =  935 bits (2417), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 456/650 (70%), Positives = 527/650 (81%), Gaps = 18/650 (2%)

Query: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVN--- 57
           M+TPV  P G+PYPITISKLIA +GS++ KG RLFAYKFWY+VEIAKSPDE D   N   
Sbjct: 1   MATPVKFPDGMPYPITISKLIAPVGSYINKGDRLFAYKFWYLVEIAKSPDELDVNGNVQD 60

Query: 58  DEHSKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTM 117
            E SKK+IRESI+FFD+PFEG ++ WNVDVGDEIVEP + +CE+ RPC+HDIVYAGICTM
Sbjct: 61  GEQSKKTIRESIDFFDAPFEGTIIGWNVDVGDEIVEPGRIVCEVKRPCDHDIVYAGICTM 120

Query: 118 CGKEVDESDQVSANLTISHTDTNLKVSRREANDIGQGXXXXXXXXXXXXXVVDLDQTVIH 177
           CGKEVDE DQVSANLTISHTDTNLKVSR+EAN+IGQ              VVDLDQTVIH
Sbjct: 121 CGKEVDERDQVSANLTISHTDTNLKVSRQEANNIGQTNKSRLIRSKKLILVVDLDQTVIH 180

Query: 178 CGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIRPGL 237
           CGVDPTI+EWKNDP+NPN+ETLR+VKSFVLEEE ILPPMYMGPKPP HKC YYVK+RPGL
Sbjct: 181 CGVDPTISEWKNDPSNPNYETLRNVKSFVLEEEAILPPMYMGPKPPVHKCSYYVKVRPGL 240

Query: 238 KEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLERLF 297
           KEFFE+V+ +YEMHIYTMATR+YA+EIAKIIDPDG+LF +RILSR+ENGSLTHKSLERLF
Sbjct: 241 KEFFEKVAPIYEMHIYTMATRAYAEEIAKIIDPDGSLFGNRILSRDENGSLTHKSLERLF 300

Query: 298 PTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRNHKK 357
           PTDQSMVV+IDDRGDVWNW PNLIKVTPYNFFVGIGDINSNFLPRQQ TMLQ+GRRNH  
Sbjct: 301 PTDQSMVVIIDDRGDVWNWSPNLIKVTPYNFFVGIGDINSNFLPRQQATMLQMGRRNHNA 360

Query: 358 --TEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQVRKEDITKKIE 415
              ++++ELLTDI+DTEKKLQEKID+EVKRQE +L+H+SAALGEE  +QVR  DITKKIE
Sbjct: 361 EKEKESEELLTDIIDTEKKLQEKIDKEVKRQEADLTHKSAALGEEAVAQVRNGDITKKIE 420

Query: 416 FSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEELK----TDK 471
           FSASLEVQQQNRPLAELQKHMHNQQLL DDDDEL YLK+IL  VQ ++Y+ L+       
Sbjct: 421 FSASLEVQQQNRPLAELQKHMHNQQLLRDDDDELSYLKEILATVQSEFYKALELKNGNSD 480

Query: 472 EIQIQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHV 531
           +  IQ LMPKLK+ V + CNFVFSGLIPLGT+IQKADIVLWT MFGA S+++ITE+TTHV
Sbjct: 481 DTSIQELMPKLKRSVFKDCNFVFSGLIPLGTDIQKADIVLWTKMFGASSTSNITENTTHV 540

Query: 532 ITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPTATDKELNXXX 591
           ITKTP T KA+IAK+F   IKV+HPDWVFECL  WK++ E  +E  +   A+++EL    
Sbjct: 541 ITKTPGTLKARIAKSFNPSIKVVHPDWVFECLSTWKHVDEKSFELKVDQVASEREL---- 596

Query: 592 XXXXXXXXXXXXXXXXXXXXSLEGDSNSPSSQGAS----VDLFASGASWL 637
                               +  GD N+ ++  +S    VDLFA G+SWL
Sbjct: 597 -EEFKKNLEKRNKNKLTDAVNFSGDLNNGTATMSSTDNVVDLFAGGSSWL 645

>TDEL0B00580 Chr2 complement(111408..113549) [2142 bp, 713 aa] {ON}
           Anc_8.839 YMR277W
          Length = 713

 Score =  914 bits (2362), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/639 (68%), Positives = 510/639 (79%), Gaps = 16/639 (2%)

Query: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVNDEH 60
           M+TPV +P  LPYPITI +LIA IGSHVEKGQRLFA+KFWY+VEIA SPDEN+ G    H
Sbjct: 1   MTTPVFSPEVLPYPITIDQLIAPIGSHVEKGQRLFAFKFWYMVEIASSPDENEGG----H 56

Query: 61  SKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCGK 120
            KK++RESIEFF++PFEGDL+SWNVDVGDE+V PNQ ICEI RPCNHDIVY G+CT+CGK
Sbjct: 57  RKKTVRESIEFFEAPFEGDLMSWNVDVGDEVVAPNQAICEISRPCNHDIVYGGLCTLCGK 116

Query: 121 EVDESDQVSANLTISHTDTNLKVSRREANDIGQGXXXXXXXXXXXXXVVDLDQTVIHCGV 180
           EVDES+Q + NL ISHTD NLKVSR+EA DI                VVDLDQTVIHCGV
Sbjct: 117 EVDESEQFNGNLAISHTDVNLKVSRKEATDIENNLKTRLRESKKLVLVVDLDQTVIHCGV 176

Query: 181 DPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIRPGLKEF 240
           DPTI EWK D +NPN+E L+DV+SF L+EEPILP +YMGPKPP  KCWYYVK+RPGLKEF
Sbjct: 177 DPTIGEWKRDSSNPNYEALKDVQSFALDEEPILPLLYMGPKPPVRKCWYYVKVRPGLKEF 236

Query: 241 FEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLERLFPTD 300
           F++V+ L+EMHIYTMATR+YA EIAKIIDPDG+LF DRILSR+ENGS+T KSLERLFPTD
Sbjct: 237 FDKVAPLFEMHIYTMATRAYALEIAKIIDPDGSLFGDRILSRDENGSITQKSLERLFPTD 296

Query: 301 QSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRNHKKTED 360
           QSMVVVIDDRGDVWNWCPNLIKV PYNFFVG+GDINSNFLPRQQ TMLQLGR   KKT++
Sbjct: 297 QSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQNTMLQLGRGARKKTQE 356

Query: 361 TDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQVRKEDITKKIEFSASL 420
           +DEL+TDIMDTEKKLQEKIDEEVKRQEE L+HQ A+ GEE+ +   K+ + KK+E+SASL
Sbjct: 357 SDELITDIMDTEKKLQEKIDEEVKRQEEKLNHQMAS-GEEVPAPESKDQLAKKLEYSASL 415

Query: 421 EVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEELKTD--KEIQIQTL 478
           EVQQQNRPLA LQKHMHNQ+LL DDDDEL YL++IL  V  +YY+ L  D  K+  I+TL
Sbjct: 416 EVQQQNRPLATLQKHMHNQRLLVDDDDELNYLREILAKVHDEYYKTLGQDSEKKADIKTL 475

Query: 479 MPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHVITKTPHT 538
           +P +K KV E C+FVFSGLIPLGTNI +ADIVLWTNMFGAQSS +I + TTHVIT+TP T
Sbjct: 476 LPLMKSKVFEDCHFVFSGLIPLGTNINRADIVLWTNMFGAQSSPEIDDSTTHVITRTPGT 535

Query: 539 YKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPTATDKELNXXXXXXXXXX 598
           YKA+IAKAF  +IKV+HPDWVFECL++WK++ E PYE  +  TATD+EL           
Sbjct: 536 YKARIAKAFNENIKVVHPDWVFECLVSWKHVDEKPYELIVEQTATDEELGDYKQKLARRS 595

Query: 599 XXXXXXXXXXXXXSLEGDSNSPSSQGASVDLFASGASWL 637
                          E +    S++  +++LFA G SWL
Sbjct: 596 SALAEQ---------EMELAMESAKNGTINLFAGGTSWL 625

>ZYRO0G14168g Chr7 (1128601..1130895) [2295 bp, 764 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277W FCP1
           Carboxy-terminal domain (CTD) phosphatase
          Length = 764

 Score =  899 bits (2322), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 425/639 (66%), Positives = 503/639 (78%), Gaps = 8/639 (1%)

Query: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVNDEH 60
           M+TPV AP  LPYPITI +LIA IGS V+KGQRLFAYKFWY+VEIA SPDEND     +H
Sbjct: 1   MATPVIAPESLPYPITIDQLIAPIGSTVKKGQRLFAYKFWYMVEIASSPDENDGNGGAQH 60

Query: 61  SKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCGK 120
           SKK++RESIEFF+SPFEGDLVSW VD GDE+    Q ICEI+RPCNHD+VY G+CTMCGK
Sbjct: 61  SKKTVRESIEFFESPFEGDLVSWEVDRGDEVASARQVICEIMRPCNHDVVYGGLCTMCGK 120

Query: 121 EVDESDQVSANLTISHTDTNLKVSRREANDIGQGXXXXXXXXXXXXXVVDLDQTVIHCGV 180
           EVDE+DQ+ ANL ISHTDTNLKVSR+EA D+                VVDLDQTVIHCGV
Sbjct: 121 EVDENDQMEANLAISHTDTNLKVSRKEAEDMEHFLKQRLRQSKKLVLVVDLDQTVIHCGV 180

Query: 181 DPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIRPGLKEF 240
           DPTI EWK DP+NPN+ETL+DV+ F LEEEPI+PPMYMGP+ P  KCWY+VK+RPGL+EF
Sbjct: 181 DPTIGEWKKDPSNPNYETLKDVQMFSLEEEPIVPPMYMGPRLPERKCWYFVKVRPGLREF 240

Query: 241 FEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLERLFPTD 300
           F +++ LYEMHIYTMATR+YA EIAKIIDPDG+LF DRILSR+ENGSLT KSLERLFPTD
Sbjct: 241 FAQLAPLYEMHIYTMATRTYALEIAKIIDPDGSLFGDRILSRDENGSLTQKSLERLFPTD 300

Query: 301 QSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRNHKKTED 360
           QSMV+VIDDRGDVWNWCPNLIKV PYNFFVG+GDINSNFLPRQQ+ +LQLGRR HKK ++
Sbjct: 301 QSMVIVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPRQQSGLLQLGRRTHKKPQE 360

Query: 361 TDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQVRKEDITKKIEFSASL 420
           +DELLTDIMDTEK+LQEKIDEEVKRQEE LSHQ     E +  +  KE +TKK+E+SASL
Sbjct: 361 SDELLTDIMDTEKRLQEKIDEEVKRQEEKLSHQLTTNDEPVQGE-SKEQLTKKLEYSASL 419

Query: 421 EVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEELKTDKE--IQIQTL 478
           EVQQQNRPLA LQKHMHNQ+LL DDDDEL+YLKD L  + +KYY+ L    E    IQ+L
Sbjct: 420 EVQQQNRPLATLQKHMHNQRLLVDDDDELYYLKDTLAKIHRKYYKLLDEGNENSADIQSL 479

Query: 479 MPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHVITKTPHT 538
           +P +K +V + C FVFSGLIPLGTNI++ADIVLWT MFGA +S++I E+TTHVITKTP T
Sbjct: 480 VPTMKGQVFKDCYFVFSGLIPLGTNIRRADIVLWTGMFGAITSSEIDENTTHVITKTPGT 539

Query: 539 YKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPTATDKELNXXXXXXXXXX 598
           YKA+IAK F  ++KV+HPDWVFECL+ W ++ E PYE  I   AT++E+           
Sbjct: 540 YKARIAKGFNENVKVVHPDWVFECLVTWTHVDEKPYELIIQDPATEEEIQ-----DFKRK 594

Query: 599 XXXXXXXXXXXXXSLEGDSNSPSSQGASVDLFASGASWL 637
                          E ++   ++Q ++++LFA G SWL
Sbjct: 595 IEQRHLIEEQRREQFESEALMKTAQDSTLNLFAGGTSWL 633

>TBLA0D03260 Chr4 (810350..812656) [2307 bp, 768 aa] {ON} Anc_8.839
           YMR277W
          Length = 768

 Score =  882 bits (2280), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 436/679 (64%), Positives = 506/679 (74%), Gaps = 47/679 (6%)

Query: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDEND------- 53
           MSTPV +P  LP+PITI +LI  IGSHVEKGQRLFAYKFWY+VEIA+SPD ND       
Sbjct: 1   MSTPVLSPADLPFPITIDQLITPIGSHVEKGQRLFAYKFWYMVEIAQSPDNNDPTSENSS 60

Query: 54  -----------DGVNDEHSKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIV 102
                      +G N  H KKSIRESIEFF+SPFEGDL+ WNVD GDEI+  NQ +C+I 
Sbjct: 61  DLSGNNSDSNENGNNASHQKKSIRESIEFFESPFEGDLIGWNVDKGDEIISENQLLCDIK 120

Query: 103 RPCNHDIVYAGICTMCGKEVDESDQVSANLTISHTDTNLKVSRREANDIGQGXXXXXXXX 162
           RPCNHDIVYAGICT CGKEVD+SD + A+L+ISHTDTNLK+SR+EA DI Q         
Sbjct: 121 RPCNHDIVYAGICTQCGKEVDDSDIMDASLSISHTDTNLKISRKEARDIDQSSMSRLKKI 180

Query: 163 XXXXXVVDLDQTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKP 222
                VVDLDQTVIHCGVDPTI EWKNDP NPN+ETL+DV+SF L+EEPILPP YMGP+P
Sbjct: 181 KKLILVVDLDQTVIHCGVDPTIGEWKNDPKNPNYETLKDVRSFSLDEEPILPPSYMGPRP 240

Query: 223 PTHKCWYYVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSR 282
           P  KCWYYVK+RPGLKEFF +++ LYEMHIYTMATR+YA EIAKIIDPDG+LF  RILSR
Sbjct: 241 PVRKCWYYVKVRPGLKEFFAKIAPLYEMHIYTMATRAYALEIAKIIDPDGSLFGSRILSR 300

Query: 283 NENGSLTHKSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPR 342
           +ENGSLT KSLERLFPTDQSMV++IDDRGDVWNWC NLIKV PYNFFVGIGDINSNFLPR
Sbjct: 301 DENGSLTQKSLERLFPTDQSMVIIIDDRGDVWNWCNNLIKVIPYNFFVGIGDINSNFLPR 360

Query: 343 QQTTMLQLGRRNHKK--------TED--------------TDELLTDIMDTEKKLQEKID 380
           QQ+TMLQLG R+HKK        +ED              T+ELLTDIMDTEKKLQ+KID
Sbjct: 361 QQSTMLQLGIRSHKKKNTNETLNSEDDKSDSTLSVHEKDKTEELLTDIMDTEKKLQKKID 420

Query: 381 EEVKRQEENLSHQSAALGEEISSQVRKEDITKKIEFSASLEVQQQNRPLAELQKHMHNQQ 440
           EEV+RQE+ L        + IS +    +++KKIEFSASLEVQQQNRPLA LQ+H  NQ+
Sbjct: 421 EEVRRQEKKLIKDEMPKRKSISDESSNNELSKKIEFSASLEVQQQNRPLATLQRHRQNQR 480

Query: 441 LLTDDDDELFYLKDILKNVQQKYYEELKTDK--EIQIQTLMPKLKKKVLEGCNFVFSGLI 498
           LL DDDDELFYLKDIL  V   +YE+L  DK   + IQTLMP+LK  V  G NFVFSGLI
Sbjct: 481 LLIDDDDELFYLKDILTEVHDTFYEQLDEDKNESVSIQTLMPRLKFSVFSGYNFVFSGLI 540

Query: 499 PLGTNIQKADIVLWTNMFGAQSSADITEDTTHVITKTPHTYKAKIAKAFKSDIKVLHPDW 558
           PLGT+I++ADIVLWTNMFGA S+ADI E+TTHVITKT  TYKA++AKAF  +IKV+HPDW
Sbjct: 541 PLGTDIRRADIVLWTNMFGANSTADIDENTTHVITKTAGTYKARLAKAFNPEIKVVHPDW 600

Query: 559 VFECLLNWKYMPEFPYEYNIIPTATDKELNXXXXXXXXXXXXXXXXXXXXXXXSLEGDSN 618
           +FECL++WK MPE PYE  I   A+++EL                          E    
Sbjct: 601 IFECLVSWKRMPEKPYELIIEQPASEEELEEFKKKLELKNELLEKREMET-----EAQFE 655

Query: 619 SPSSQGASVDLFASGASWL 637
           + +++  ++DLFASG SWL
Sbjct: 656 ALNTRDPAIDLFASGTSWL 674

>CAGL0M02959g Chr13 (332990..335266) [2277 bp, 758 aa] {ON} similar
           to uniprot|Q03254 Saccharomyces cerevisiae YMR277w FCP1
          Length = 758

 Score =  880 bits (2273), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/580 (71%), Positives = 483/580 (83%), Gaps = 7/580 (1%)

Query: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDEND---DGVN 57
           MSTPV  P+GLPYPIT+ +L+  IGS+VEKGQRLFAYKFWY+VEIA SPD+ND   +G  
Sbjct: 1   MSTPVLTPMGLPYPITVDELMVPIGSYVEKGQRLFAYKFWYMVEIANSPDDNDIDYEGPE 60

Query: 58  DEHSKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTM 117
            E SK+ +RESIEF+++PFEGDL+SWNVD  DEI  PN  +CEI RPCNHDIVY G+CTM
Sbjct: 61  IEKSKRKVRESIEFYEAPFEGDLLSWNVDEKDEIAGPNMAVCEIKRPCNHDIVYGGLCTM 120

Query: 118 CGKEVDESDQVSANLTISHTDTNLKVSRREANDIGQGXXXXXXXXXXXXXVVDLDQTVIH 177
           CGKEVDE DQV ANLTISHTDTNL+VSR+EA D+ +              VVDLDQTVIH
Sbjct: 121 CGKEVDEYDQVDANLTISHTDTNLRVSRKEAIDLDKQITTRLKNEKKLVLVVDLDQTVIH 180

Query: 178 CGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIRPGL 237
           CGVDPTI EWK DP+NPN+ETL+DVK F LEEEPILP +YMGPKPP   CWYYVKIRPGL
Sbjct: 181 CGVDPTIGEWKADPSNPNYETLKDVKCFSLEEEPILPLIYMGPKPPVRTCWYYVKIRPGL 240

Query: 238 KEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLERLF 297
           KEFFE+++ LYEMHIYTMATR+YA EIAKIIDPD +LF DRILSR+ENGSLT KSL RLF
Sbjct: 241 KEFFEKIAPLYEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTQKSLTRLF 300

Query: 298 PTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRNHKK 357
           PTDQSMVVVIDDRGDVWNWCPNLIKV PYNFFVG+GDINSNFLP+QQTTMLQLGRR  +K
Sbjct: 301 PTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPKQQTTMLQLGRRTRQK 360

Query: 358 TEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQVRKEDITKKIEFS 417
            ++++ELLTDIMDTEKKLQEKIDEEVKRQEE L+HQ A   EE + Q  KE I KK+EFS
Sbjct: 361 IKESEELLTDIMDTEKKLQEKIDEEVKRQEEKLNHQMAT-AEESTDQESKEKIAKKLEFS 419

Query: 418 ASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYY---EELKTDKEIQ 474
           ASLEVQQQNRPLA+LQKH+H+Q+LL DDDDELFYLKD L  + +++Y   E+     E  
Sbjct: 420 ASLEVQQQNRPLAKLQKHLHDQRLLIDDDDELFYLKDTLAYIHKEFYHLLEDASDQNEAD 479

Query: 475 IQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHVITK 534
           I  L+PKLKKKV + C+FVFSGLIPLGT+I++ADIV+WT++FGA+S++DI E TTHV+TK
Sbjct: 480 ITMLLPKLKKKVFKECHFVFSGLIPLGTDIKRADIVIWTSLFGAESTSDIDEHTTHVVTK 539

Query: 535 TPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPY 574
           TP TYKA++AKAF  DIKV+HPDW+FECL +WK + E PY
Sbjct: 540 TPGTYKARLAKAFNPDIKVVHPDWIFECLASWKRIDEKPY 579

>NCAS0C00420 Chr3 complement(65252..67429) [2178 bp, 725 aa] {ON}
           Anc_8.839 YMR277W
          Length = 725

 Score =  863 bits (2231), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 413/644 (64%), Positives = 494/644 (76%), Gaps = 16/644 (2%)

Query: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVNDEH 60
           MST + AP+GLPYPITI +LI  +G  V+KG RL AYKFW++V++A SPD+ND       
Sbjct: 1   MSTQILAPIGLPYPITIDQLITHVGDEVQKGDRLLAYKFWFVVDVASSPDDNDVSSPPTA 60

Query: 61  SKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCGK 120
            KKSIRESIEFF+SP++G L+SWNVD+GDEI  PNQ + EI+RPCNHD+VY G+CT+CG+
Sbjct: 61  GKKSIRESIEFFESPYKGQLISWNVDIGDEIASPNQVLAEIIRPCNHDVVYGGLCTLCGE 120

Query: 121 EVDESDQ----VSANLTISHTDTNLKVSRREANDIGQGXXXXXXXXXXXXXVVDLDQTVI 176
           EVDE D       ANLTISHTDTNLK+S REA DIG               VVDLDQTVI
Sbjct: 121 EVDEDDNDASGSGANLTISHTDTNLKISTREALDIGLNVRTRLRKEKKLVLVVDLDQTVI 180

Query: 177 HCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIRPG 236
           HCGVDPTI EWKNDP NPNFETL+DVK F LEEEPILP +YMGPKPP  KCWYYVK+RPG
Sbjct: 181 HCGVDPTIGEWKNDPKNPNFETLKDVKQFSLEEEPILPTLYMGPKPPLRKCWYYVKVRPG 240

Query: 237 LKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLERL 296
           LKEF E+++ L+EMHIYTMATR+YA EIAKIIDP+G LF DRILSR+ENGS+T KSLERL
Sbjct: 241 LKEFLEKIAPLFEMHIYTMATRAYASEIAKIIDPNGDLFGDRILSRDENGSMTTKSLERL 300

Query: 297 FPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRNHK 356
           FPTDQSMV+VIDDRGDVWNW PNLIKV PYNFFVG+GDINSNFLP+QQ TMLQLGRR+ +
Sbjct: 301 FPTDQSMVIVIDDRGDVWNWSPNLIKVVPYNFFVGVGDINSNFLPKQQATMLQLGRRSRE 360

Query: 357 KTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGE-EISSQVRKEDITKKIE 415
           K++DT++LL DIMD+EKKL+EKID+EVKRQEE LSHQSA   E   S+   KE+I+KKIE
Sbjct: 361 KSKDTEDLLIDIMDSEKKLKEKIDQEVKRQEEELSHQSATTEEPPTSAGENKEEISKKIE 420

Query: 416 FSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEELKTDKEIQ- 474
           +SASLEVQQQNRPLA LQKH H+Q+LL DDDDEL++LKD L  +  KYY  LK D E++ 
Sbjct: 421 YSASLEVQQQNRPLAALQKHFHDQRLLIDDDDELYHLKDTLVRIHDKYYNVLKKDGELKA 480

Query: 475 -IQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHVIT 533
            I+ +MP +K+ VL+ C FVFSGLIPLGT+IQ+ADIV+WTN FGA S++DI E TTHVIT
Sbjct: 481 DIKLIMPAMKQNVLDNCRFVFSGLIPLGTDIQRADIVIWTNTFGAISTSDIDEKTTHVIT 540

Query: 534 KTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPTATDKELNXXXXX 593
           KTP TYKA++AK+F   IK+LHPDWVFECL +WK++ E PYE  +    ++ EL      
Sbjct: 541 KTPGTYKARLAKSFNPKIKILHPDWVFECLTSWKHVDEKPYELIVEQPVSETELEEFKKK 600

Query: 594 XXXXXXXXXXXXXXXXXXSLEGDSNSPSSQGASVDLFASGASWL 637
                               E  S +  +  A ++LF+ G SWL
Sbjct: 601 LAKRQLLATAN---------ENLSPANGTNSAELELFSGGMSWL 635

>KAFR0B03910 Chr2 (811940..814114) [2175 bp, 724 aa] {ON} Anc_8.839
           YMR277W
          Length = 724

 Score =  856 bits (2211), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 415/653 (63%), Positives = 499/653 (76%), Gaps = 28/653 (4%)

Query: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVND-- 58
           M+TPV AP GLPYPITI +LI  IG+++EKG RLFAYKFWY+VEIA SPD+ND    D  
Sbjct: 1   MTTPVLAPEGLPYPITIDELICPIGTYIEKGIRLFAYKFWYMVEIASSPDDNDPANTDTQ 60

Query: 59  -EHSKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTM 117
             H KK IRESIEFFD+PFEG L+SWN+DVGDE+   +Q ICEI RPCNHDIVY G+CT 
Sbjct: 61  ASHPKKKIRESIEFFDAPFEGTLISWNIDVGDELSSASQVICEIKRPCNHDIVYGGLCTQ 120

Query: 118 CGKEVDESDQ--VSANLTISHTDTNLKVSRREANDIGQGXXXXXXXXXXXXXVVDLDQTV 175
           CGKEVDES+Q    +N T+SHTDTNLK+SR+EA DIG+              VVDLDQTV
Sbjct: 121 CGKEVDESEQSQFGSNFTVSHTDTNLKISRKEALDIGEDFKKRLRNEKKLVLVVDLDQTV 180

Query: 176 IHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIRP 235
           IHCGVDPTI EWK+DP NPN++TL+DV+ F LEEEP+LP MYMGPKP   KCWYYVK+RP
Sbjct: 181 IHCGVDPTIGEWKSDPNNPNYDTLKDVQMFALEEEPVLPFMYMGPKPTPRKCWYYVKVRP 240

Query: 236 GLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLER 295
           GLKEFF++V+ L+EMHIYTMATR+YA EI KIIDP G LF +RILSR+ENGSLT KSLER
Sbjct: 241 GLKEFFKKVAPLFEMHIYTMATRAYALEITKIIDPTGELFGNRILSRDENGSLTSKSLER 300

Query: 296 LFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRNH 355
           LFPTDQSMV++IDDRGDVWNW PNLIKV PY+FFVG+GDINSNFLP+QQTTMLQLGRR+ 
Sbjct: 301 LFPTDQSMVIIIDDRGDVWNWSPNLIKVVPYSFFVGVGDINSNFLPKQQTTMLQLGRRSR 360

Query: 356 KKTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQVRKEDITKKIE 415
           +K ++ DELLTDIMDTEKKLQEKIDEEVKRQE+NLSHQ     E +S++  KE+ TKK+E
Sbjct: 361 EKAKEADELLTDIMDTEKKLQEKIDEEVKRQEKNLSHQVVPTEESVSNET-KEEWTKKLE 419

Query: 416 FSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEELKT----DK 471
            SAS+EVQQQNRPLA LQ+H+HNQ+LL DDDDEL++LKD L  V  +YY  L+     + 
Sbjct: 420 HSASVEVQQQNRPLAALQEHLHNQRLLIDDDDELYFLKDTLAKVHNEYYSILENKSLDES 479

Query: 472 EIQIQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHV 531
              I+ +MPKLK+ V EGC+FVFSGLIPL T+I++ADIV+WT+MFGA+SS++I E TTHV
Sbjct: 480 GADIKLIMPKLKQSVFEGCHFVFSGLIPLHTDIRRADIVVWTSMFGAESSSEINEVTTHV 539

Query: 532 ITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPTATDKELNXXX 591
           ITKTP T+KA++AK+F SDIK++HPDWVFECL+ W ++ E PY   +    +D+EL    
Sbjct: 540 ITKTPGTFKARLAKSFNSDIKIVHPDWVFECLIRWTHVDEKPYTLIVEEPISDRELKKFR 599

Query: 592 XXXXXXXXXXXXXXXXXXXXSLEGDSNSPSSQGA-------SVDLFASGASWL 637
                                   + NS    G        +VDLFA+G SWL
Sbjct: 600 EDLNNRKLTER-----------NNEQNSGDITGTIVENFDNTVDLFATGTSWL 641

>NDAI0K00420 Chr11 complement(94101..96437) [2337 bp, 778 aa] {ON}
           Anc_8.839 YMR277W
          Length = 778

 Score =  816 bits (2109), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 412/696 (59%), Positives = 495/696 (71%), Gaps = 64/696 (9%)

Query: 1   MSTP--VSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDE------- 51
           M+TP  + APLGLPYPITI +L+  IG+ + K  RL AYKFWY+VEIA SPDE       
Sbjct: 1   MATPTVIRAPLGLPYPITIDELMKPIGTEMNKDDRLLAYKFWYVVEIATSPDELEDDNDN 60

Query: 52  ---------------NDDGVNDEHSKKSI--------------------RESIEFFDSPF 76
                          N + V +  ++ SI                    RESIEFFD P+
Sbjct: 61  DNDNDPDGDVDKNTINGNNVTNLTNRPSIEPISRNTITHAHKKKKKKTVRESIEFFDCPY 120

Query: 77  EGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCGKEVDESD---QVSANLT 133
           +G L SW V+ GD+IV PNQ +CEI RPCNHD++Y G+CT+CGKEVDE+D       NLT
Sbjct: 121 DGILTSWLVEKGDQIVGPNQPLCEIQRPCNHDVIYGGLCTLCGKEVDENDIDDLSGPNLT 180

Query: 134 ISHTDTNLKVSRREANDIGQGXXXXXXXXXXXXXVVDLDQTVIHCGVDPTIAEWKNDPTN 193
           ISHTDTNLK+S REA DIGQ              VVDLDQTVIHCGVDPTI EWK DPTN
Sbjct: 181 ISHTDTNLKISTREAVDIGQSVKKRLRDDKKLILVVDLDQTVIHCGVDPTIGEWKRDPTN 240

Query: 194 PNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIRPGLKEFFEEVSKLYEMHIY 253
           PNFETL+DVK F LEEEPILP MYMGPKPP  KCWYYVK+RPGLK+FF++V+ L+EMHIY
Sbjct: 241 PNFETLKDVKEFALEEEPILPLMYMGPKPPARKCWYYVKVRPGLKDFFQKVAPLFEMHIY 300

Query: 254 TMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLERLFPTDQSMVVVIDDRGDV 313
           TMATR+YA EIAKIIDP G LF +RILSR+ENGSLT KSLERLFPTDQSMV++IDDRGDV
Sbjct: 301 TMATRAYASEIAKIIDPTGDLFGNRILSRDENGSLTTKSLERLFPTDQSMVIIIDDRGDV 360

Query: 314 WNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRNHK-----KTEDTDELLTDI 368
           WNW PNLIKV PYNFFVG+GDINSNFLP+QQ TMLQLGRR+ +      T++ D+LLTDI
Sbjct: 361 WNWSPNLIKVIPYNFFVGVGDINSNFLPKQQATMLQLGRRSSRGESKVSTKENDDLLTDI 420

Query: 369 MDTEKKLQEKIDEEVKRQEENLSHQSAALGE-EISSQVRKEDITKKIEFSASLEVQQQNR 427
           MDTEK LQ KI+EEVKRQEE L+HQ A + E   ++   KE+I+KKIE+SASLEVQQ+NR
Sbjct: 421 MDTEKVLQRKINEEVKRQEEKLNHQLATIEEPPTTAGENKEEISKKIEYSASLEVQQKNR 480

Query: 428 PLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEEL------KTDKEIQIQTLMPK 481
           PLA LQKH H+Q+LL DDD+EL++LKD L  +  KYYE L      K   E  I+ +MP+
Sbjct: 481 PLATLQKHFHDQRLLIDDDEELYHLKDTLSKIHSKYYEMLQKANENKDSIEPDIKYIMPQ 540

Query: 482 LKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHVITKTPHTYKA 541
           +K+ VL+ C+FVFSGLIPLGTNIQK+DIV+WTNMFGA+S+ADI E+TTHVITKTP TYKA
Sbjct: 541 MKQTVLQDCHFVFSGLIPLGTNIQKSDIVIWTNMFGARSTADIDENTTHVITKTPGTYKA 600

Query: 542 KIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPTATDKELNXXXXXXXXXXXXX 601
           ++AK++  DIK++HPDWVFECL+ WK++ E PYE  +    +DKEL              
Sbjct: 601 RLAKSYDPDIKIVHPDWVFECLMRWKHVEEKPYELLVEQLVSDKELADFNRKLERRIQLS 660

Query: 602 XXXXXXXXXXSLEGDSNSPSSQGASVDLFASGASWL 637
                       +G+ +        V+LFA G SWL
Sbjct: 661 ELKDEGLYNKLPDGNIDI-----NEVNLFAGGTSWL 691

>Skud_13.449 Chr13 (793592..795796) [2205 bp, 734 aa] {ON} YMR277W
           (REAL)
          Length = 734

 Score =  769 bits (1986), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/659 (57%), Positives = 468/659 (71%), Gaps = 36/659 (5%)

Query: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVNDEH 60
           M+T + +P GLPYPI I KL+ S+GS++ +G RL  YKFWY+VE A     +DD  +D  
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLVPSVGSYLHEGDRLIVYKFWYLVERASDTTGDDDNEHDAT 60

Query: 61  SK------------KSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHD 108
                         K +RESIEFF+SP+EGDL+SWNVDVGDEI   NQ ICEI RPCNHD
Sbjct: 61  PGGGAGSGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHD 120

Query: 109 IVYAGICTMCGKEV--DESDQVSANLTISHTDTNLKVSRREANDIGQGXXXXXXXXXXXX 166
           IVY G+CT CGKEV  D  D V  ++     D +L++S  EA   G+             
Sbjct: 121 IVYGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRSGEALKEHLRRDKKLI 177

Query: 167 XVVDLDQTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMG------P 220
            VVDLDQT+IHCGVDPTIAEWKNDP NPNFETLRDVKSF L+EE +LP MYM        
Sbjct: 178 LVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDGSVLK 237

Query: 221 KPPTHKCWYYVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRIL 280
            PP  KCWYYVK+RPGLKEFF++V+ L+EMHIYTMATR+YA +IAKI+DP G LF DRIL
Sbjct: 238 PPPVRKCWYYVKVRPGLKEFFDKVAPLFEMHIYTMATRAYAIQIAKIVDPTGELFGDRIL 297

Query: 281 SRNENGSLTHKSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFL 340
           SR+ENGSLT KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKV PYNFFVG+GDINSNFL
Sbjct: 298 SRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFL 357

Query: 341 PRQQTTMLQLGRRNHKKTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEE 400
           P+Q T MLQLGR+  +K++++ ELLTDIMD EKKLQEKID+EVKRQEE L+HQ A   EE
Sbjct: 358 PKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLAT-AEE 416

Query: 401 ISSQVRKEDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQ 460
            S+   KE++TKK+E+SASLEVQQQNRPLA+LQKH+H+Q+LL DDDDEL+YL   L N+ 
Sbjct: 417 PSANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIH 476

Query: 461 QKYYEELKTDKEIQ--IQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGA 518
             YY+ +    E +  +  ++P LK+KV + C+FVFSGLIPLGT+IQ++DIV+WT+ FGA
Sbjct: 477 NTYYQMISQSNEPEPNLMEIIPSLKQKVFQNCHFVFSGLIPLGTDIQRSDIVIWTSTFGA 536

Query: 519 QSSADITEDTTHVITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNI 578
            S++DI   TTH+ITK P TYKA++AK F  +IK++HPDW+FECL+NWK + E PY   +
Sbjct: 537 TSTSDIDYLTTHLITKNPSTYKARLAKKFNPEIKIIHPDWIFECLVNWKKVDEKPYTLIV 596

Query: 579 IPTATDKELNXXXXXXXXXXXXXXXXXXXXXXXSLEGDSNSPSSQGASVDLFASGASWL 637
               +D+EL                        + + + N          LFA+G SWL
Sbjct: 597 DSPISDEELQNFQKQLQKRQEYLEENQQQQHMLTPQENLN----------LFAAGTSWL 645

>YMR277W Chr13 (820256..822454) [2199 bp, 732 aa] {ON}
           FCP1Carboxy-terminal domain (CTD) phosphatase, essential
           for dephosphorylation of the repeated C-terminal domain
           of the RNA polymerase II large subunit (Rpo21p)
          Length = 732

 Score =  766 bits (1977), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 383/659 (58%), Positives = 469/659 (71%), Gaps = 37/659 (5%)

Query: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAK--SPDENDDGVND 58
           M+T + +P GLPYPI I KLI S+GS++ +G RL  YKFWY+VE A     D+N+  V+ 
Sbjct: 1   MTTQIRSPQGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERASDTGDDDNEHDVSP 60

Query: 59  EHSK---------KSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDI 109
             S          K +RESIEFF+SP+EGDL+SWNVDVGDE+   NQ ICEI RPCNHDI
Sbjct: 61  GGSAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRPCNHDI 120

Query: 110 VYAGICTMCGKEV--DESDQVSANLTISHTDTNLKVSRREANDIGQGXXXXXXXXXXXXX 167
           VY G+CT CGKEV  D  D V  ++     D +L++S  EA   G+              
Sbjct: 121 VYGGLCTQCGKEVSADAFDGVPLDVV---GDVDLQISETEAIRTGKALKEHLRRDKKLIL 177

Query: 168 VVDLDQTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPK------ 221
           VVDLDQT+IHCGVDPTIAEWKNDP NPNFETLRDVKSF L+EE +LP MYM         
Sbjct: 178 VVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNDDGSMLRP 237

Query: 222 PPTHKCWYYVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILS 281
           PP  KCWYYVK+RPGLKEFF +V+ L+EMHIYTMATR+YA +IAKI+DP G LF DRILS
Sbjct: 238 PPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILS 297

Query: 282 RNENGSLTHKSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLP 341
           R+ENGSLT KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKV PYNFFVG+GDINSNFLP
Sbjct: 298 RDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLP 357

Query: 342 RQQTTMLQLGRRNHKKTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEI 401
           +Q T MLQLGR+  +K++++ ELLTDIMD EKKLQEKID+EVKRQEE L+HQ A   EE 
Sbjct: 358 KQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLAT-AEEP 416

Query: 402 SSQVRKEDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQ 461
            +   KE++TKK+E+SASLEVQQQNRPLA+LQKH+H+Q+LL DDDDEL+YL   L N+ +
Sbjct: 417 PANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTLSNIHK 476

Query: 462 KYYEEL--KTDKEIQIQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQ 519
            YY+ L  + + E  +  ++P LK+KV + C FVFSGLIPLGT+IQ++DIV+WT+ FGA 
Sbjct: 477 TYYDMLSQQNEPEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGAT 536

Query: 520 SSADITEDTTHVITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNII 579
           S+ DI   TTH+ITK P TYKA++AK F   IK++HPDW+FECL+NWK + E PY   + 
Sbjct: 537 STPDIDYLTTHLITKNPSTYKARLAKKFNPQIKIVHPDWIFECLVNWKKVDEKPYTLIVD 596

Query: 580 PTATDKEL-NXXXXXXXXXXXXXXXXXXXXXXXSLEGDSNSPSSQGASVDLFASGASWL 637
              +D+EL N                       S E           +++LFA+G SWL
Sbjct: 597 SPISDEELQNFQTQLQKRQEYLEETQEQQHMLTSQE-----------NLNLFAAGTSWL 644

>Smik_13.490 Chr13 (803288..805486) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/663 (57%), Positives = 469/663 (70%), Gaps = 45/663 (6%)

Query: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVND-E 59
           M+T + +P GLPYPI I KLI S+GS++ +G RL  YKFWY+VE A     ++ GV+D E
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSYLHEGDRLLVYKFWYLVERA-----SETGVDDNE 55

Query: 60  HSK---------------KSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRP 104
           H                 K +RESIEFF+SP+EGDL+SWNVDVGDE+   NQ ICEI RP
Sbjct: 56  HDASPGGGAGSNGVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEVATANQVICEIKRP 115

Query: 105 CNHDIVYAGICTMCGKEV--DESDQVSANLTISHTDTNLKVSRREANDIGQGXXXXXXXX 162
           CNHDIVY G+CT CGKEV  D  D V  ++     D +L++S  EA   G+         
Sbjct: 116 CNHDIVYGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRTGKALKEHLRRD 172

Query: 163 XXXXXVVDLDQTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPK- 221
                VVDLDQT+IHCGVDPTIAEWKNDP NPNFETLRDVKSF L+EE +LP MYM    
Sbjct: 173 KKLILVVDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMNEDG 232

Query: 222 -----PPTHKCWYYVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFA 276
                PP  KCWYYVK+RPGLKEFF +V+ L+EMHIYTMATR+YA +IAKI+DP G LF 
Sbjct: 233 SVLRPPPVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGKLFG 292

Query: 277 DRILSRNENGSLTHKSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDIN 336
           DRILSR+ENGSLT KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKV PYNFFVG+GDIN
Sbjct: 293 DRILSRDENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDIN 352

Query: 337 SNFLPRQQTTMLQLGRRNHKKTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAA 396
           SNFLP+Q T MLQLGR+  +K++++ ELLTDIMD EKKLQEKID+EVKRQEE L+HQ A 
Sbjct: 353 SNFLPKQSTGMLQLGRKTRQKSQESQELLTDIMDNEKKLQEKIDKEVKRQEEKLNHQLAT 412

Query: 397 LGEEISSQVRKEDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDIL 456
             EE  +   KE++TKK+E+SASLEVQQQNRPLA+LQKH+H+Q+LL DDDDEL+YL   L
Sbjct: 413 -AEEPPANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELYYLMGTL 471

Query: 457 KNVQQKYYEELKTDKEIQ--IQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTN 514
            N+   YY+ L  + E +  +  ++P LK+KV + C FVFSGLIPLGT+IQ++DIV+WT+
Sbjct: 472 SNIHMTYYQMLSQENEPEPNLMEIIPSLKQKVFQNCFFVFSGLIPLGTDIQRSDIVIWTS 531

Query: 515 MFGAQSSADITEDTTHVITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPY 574
            FGA S++DI   TTH+ITK P TYKA++AK F  +IK++HPDW+FECL+NWK + E PY
Sbjct: 532 TFGATSTSDIDFLTTHLITKNPSTYKARLAKKFNPEIKIVHPDWIFECLVNWKKVDEKPY 591

Query: 575 EYNIIPTATDKELNXXXXXXXXXXXXXXXXXXXXXXXSLEGDSNSPSSQGASVDLFASGA 634
              +    +D+EL                        + + + N          LFA+G 
Sbjct: 592 TLIVDSPISDEELQNFQSQLQKRQEYLEENQEQQHMLTSQENLN----------LFATGT 641

Query: 635 SWL 637
           SWL
Sbjct: 642 SWL 644

>KNAG0J00280 Chr10 complement(41831..44059) [2229 bp, 742 aa] {ON}
           Anc_8.839 YMR277W
          Length = 742

 Score =  765 bits (1975), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/659 (56%), Positives = 470/659 (71%), Gaps = 30/659 (4%)

Query: 3   TPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAK--SPDENDDGVNDEH 60
           TPV +  GLPYP+T+ +LI  +G  V +G RLFAYKFWY+VE+A   +  E D       
Sbjct: 7   TPVVSGAGLPYPVTVDELIPQVGDRVSRGDRLFAYKFWYVVELAGVDAAAEGDSDGTGTT 66

Query: 61  SKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCGK 120
           +KKS+RES+EFF+SPFEG +VSW+VD GDEI  P   +C + RPCNHD+VY G+CT+CG+
Sbjct: 67  AKKSVRESVEFFESPFEGTVVSWDVDAGDEIPGPGAPLCLLRRPCNHDVVYNGLCTLCGR 126

Query: 121 EVDE---------SDQVSANLTISHTDTNLKVSRREANDIGQGXXXXXXXXXXXXXVVDL 171
           EVDE         S  V  NLT+SH DTNL++SR EA  +                VVDL
Sbjct: 127 EVDEYEIQAAAAASGGVGPNLTVSHRDTNLQISRVEAQQLDLQLQQRLRAAQKLVLVVDL 186

Query: 172 DQTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPT-HKCWYY 230
           DQTV+HCGVDPTI EWK DP NPN+E LRDV+SF LEEEPILP +Y+G K P   KCWYY
Sbjct: 187 DQTVVHCGVDPTIGEWKRDPRNPNYEALRDVQSFALEEEPILPFLYVGGKRPAPRKCWYY 246

Query: 231 VKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTH 290
           VK+RPGLK+FF+ ++ L+EMHIYTMATR+YA EIAKIIDPD +LF DRILSR+ENGSLTH
Sbjct: 247 VKVRPGLKQFFKRLAPLFEMHIYTMATRAYALEIAKIIDPDKSLFGDRILSRDENGSLTH 306

Query: 291 KSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQL 350
           KSLERLFPTDQSMV VIDDRGDVWNWC NLIKV PYNFFVG+GDINSNFLP+QQ TMLQ+
Sbjct: 307 KSLERLFPTDQSMVTVIDDRGDVWNWCANLIKVVPYNFFVGVGDINSNFLPKQQPTMLQM 366

Query: 351 GRRN------HKKTEDTDE-----LLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGE 399
           GRR+      H+  +  D+     LLTDIM+TEK+LQEKID+EVKRQE  L+  +AA  E
Sbjct: 367 GRRSKLNERGHESKQQQDDVKDDLLLTDIMNTEKQLQEKIDQEVKRQEHKLNKGNAAGDE 426

Query: 400 EISSQVRKEDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNV 459
           + +    KE+ TKK+EFSAS+EVQQ+NRPLA LQKH+HNQ+LL D+DDELFYLKD L ++
Sbjct: 427 QQTPGQSKEEWTKKLEFSASVEVQQKNRPLATLQKHLHNQKLLVDNDDELFYLKDRLADL 486

Query: 460 QQKYYEELKTD-KEIQIQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGA 518
            ++YY  LK + ++  IQ++M +LK +V + C+FVFSGLIPL TN+Q ADIV+WTN FGA
Sbjct: 487 HKRYYSTLKENPQDTNIQSIMTQLKTRVFQDCHFVFSGLIPLNTNVQAADIVIWTNKFGA 546

Query: 519 QSSADITEDTTHVITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNI 578
            ++ D+ E TTH+ITKTP T KA++AKAF  DIK++HPDW+FECL+ W+ +   PY   +
Sbjct: 547 TTTNDLDETTTHLITKTPGTNKARLAKAFNPDIKIVHPDWIFECLIKWERVDVKPYLLIV 606

Query: 579 IPTATDKELNXXXXXXXXXXXXXXXXXXXXXXXSLEGDSNSPSSQGASVDLFASGASWL 637
               ++ ++                             +N P+     +DLFA G SWL
Sbjct: 607 EDPVSEAQVREFKEKLTRQKERAERQTSRTALLP----ANKPAE--PDIDLFAGGISWL 659

>Suva_13.465 Chr13 (802947..805145) [2199 bp, 732 aa] {ON} YMR277W
           (REAL)
          Length = 732

 Score =  761 bits (1964), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/657 (58%), Positives = 464/657 (70%), Gaps = 34/657 (5%)

Query: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVE----------IAKSPD 50
           M+T + +P GLPYPI I KLI S+GS +++G RL  YKFWY+VE             S  
Sbjct: 1   MTTQIRSPEGLPYPIQIDKLIPSVGSFLQEGDRLLVYKFWYLVERPSDAGDDDNDHDSSP 60

Query: 51  ENDDGVNDEHSKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIV 110
               G +     K +RESIEFF+SP+EGDL+SWNVDVGDEI   NQ ICEI RPCNHDIV
Sbjct: 61  GGGGGGSVSPPTKQLRESIEFFESPYEGDLISWNVDVGDEIATANQVICEIKRPCNHDIV 120

Query: 111 YAGICTMCGKEV--DESDQVSANLTISHTDTNLKVSRREANDIGQGXXXXXXXXXXXXXV 168
           Y G+CT CGKEV  D  D V  ++     D +L++S  EA   G+              V
Sbjct: 121 YGGLCTQCGKEVSADAFDGVPLDVV---GDMDLQISETEAIRTGRALKEHLRRDKKLILV 177

Query: 169 VDLDQTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMG-----PKPP 223
           VDLDQT+IHCGVDPTIAEWKNDP NPNFETLRDVKSF L+EE +LP MYM      PKPP
Sbjct: 178 VDLDQTIIHCGVDPTIAEWKNDPNNPNFETLRDVKSFTLDEELVLPLMYMAEDGSVPKPP 237

Query: 224 -THKCWYYVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSR 282
              KCWYYVK+RPGLKEFF +V+ L+EMHIYTMATR+YA +IAKI+DP G LF DRILSR
Sbjct: 238 PVRKCWYYVKVRPGLKEFFAKVAPLFEMHIYTMATRAYALQIAKIVDPTGELFGDRILSR 297

Query: 283 NENGSLTHKSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPR 342
           +ENGSLT KSL +LFPTDQSMVVVIDDRGDVWNWCPNLIKV PYNFFVG+GDINSNFLP+
Sbjct: 298 DENGSLTTKSLAKLFPTDQSMVVVIDDRGDVWNWCPNLIKVVPYNFFVGVGDINSNFLPK 357

Query: 343 QQTTMLQLGRRNHKKTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEIS 402
           Q T MLQLGR+  +K++++ EL+TDIMD EKKLQEKID EVKRQEE L+HQ A   EE S
Sbjct: 358 QSTGMLQLGRKTRQKSQESQELITDIMDNEKKLQEKIDIEVKRQEEQLNHQLAT-AEEPS 416

Query: 403 SQVRKEDITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQK 462
           +   KE++TKK+E+SASLEVQQQNRPLA+LQKH+H+Q+LL DDDDEL YL   L N+ + 
Sbjct: 417 ANESKEELTKKLEYSASLEVQQQNRPLAKLQKHLHDQKLLVDDDDELHYLMSTLLNIHKT 476

Query: 463 YYEELKTDKEIQ--IQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQS 520
           YY+ L    EI+  +  ++P LK+KV + C FVFSGLIPLGT+IQ++DIV+WT+ FGA S
Sbjct: 477 YYQMLSQPGEIEPNLMEIIPSLKQKVFQNCYFVFSGLIPLGTDIQRSDIVIWTSTFGATS 536

Query: 521 SADITEDTTHVITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIP 580
           ++DI   TTH+ITK P TYKA++AK F  +IKV+HPDW+FECL+NWK + E PY   +  
Sbjct: 537 TSDINYLTTHLITKNPGTYKARLAKKFNPEIKVVHPDWIFECLVNWKKVDEKPYTLIVDS 596

Query: 581 TATDKELNXXXXXXXXXXXXXXXXXXXXXXXSLEGDSNSPSSQGASVDLFASGASWL 637
             +D EL                          +           +++LFA+G SWL
Sbjct: 597 PISDDELQSFQKQLQKKQEYLDEHHEQQHMLMPQ----------ENINLFAAGTSWL 643

>SAKL0D01496g Chr4 complement(120202..122268) [2067 bp, 688 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 688

 Score =  756 bits (1953), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 370/595 (62%), Positives = 448/595 (75%), Gaps = 15/595 (2%)

Query: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVNDEH 60
           M+T +  P  LPYPITI++L AS G  ++KGQRLFAYK+W   ++  SP  ND       
Sbjct: 1   MTTALKLPDNLPYPITIAQLCASTGDPIKKGQRLFAYKYWEFQDVVTSP--NDTSTK--- 55

Query: 61  SKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCGK 120
            KK   + I  FDSP EG LVS+N+ +GDE V  N  + EI + C HD+ Y G+C +CGK
Sbjct: 56  PKKQRVDLIGTFDSPVEGALVSFNLSLGDEFVNSNHVVAEIKQACTHDVTYGGLCVICGK 115

Query: 121 EVDE------SDQVSANLTISHTDTNLKVSRREANDIGQGXXXXXXXXXXXXXVVDLDQT 174
            V+E      SD     LT+SHT+TN+K+S R+A  I +              VVDLDQT
Sbjct: 116 SVEEYSSNSASDPSQNKLTMSHTNTNIKISERQAAAIEETAQKQLRKLKKLVLVVDLDQT 175

Query: 175 VIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIR 234
           VIHCGVDPTI EW  DP NPN+E L+D+KSF L EEPILPP YMGPKPP  KCWYYVK+R
Sbjct: 176 VIHCGVDPTIGEWSRDPKNPNYEALKDIKSFALVEEPILPPFYMGPKPPARKCWYYVKLR 235

Query: 235 PGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLE 294
           PGLKEFFE+++  +E+HIYTMATR+YA EIAKIIDPDG LF DRILSR+ENGS+THKSLE
Sbjct: 236 PGLKEFFEKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSITHKSLE 295

Query: 295 RLFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRN 354
           RLFP DQSMVV+IDDRGDVWNWC NLIKV PY+FFVG+GDINSNFLPRQQ +ML LGRR+
Sbjct: 296 RLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYSFFVGVGDINSNFLPRQQNSMLHLGRRH 355

Query: 355 HKKTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQVRKEDITKKI 414
            KK E+ +ELLTDI+DTEKKLQEKIDEEVKRQEE LS  +     E ++   KED+ KK+
Sbjct: 356 RKKAEE-EELLTDILDTEKKLQEKIDEEVKRQEEKLSKMTEEKQPEDTNS--KEDLAKKL 412

Query: 415 EFSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEEL-KTDKEI 473
           E SASLEVQQQNRPLAELQKH+HNQ+LL DDDDEL +L  IL  V  KYYE+L K     
Sbjct: 413 EHSASLEVQQQNRPLAELQKHLHNQKLLIDDDDELPHLSRILLQVHGKYYEDLSKHSSPP 472

Query: 474 QIQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHVIT 533
            I+ LMP+LKK+V   C+FVFSGLIPLGT+++KADI LWT+MFGA+++ADI E TTH+IT
Sbjct: 473 NIKNLMPQLKKRVFCKCSFVFSGLIPLGTDVRKADIALWTSMFGAKTTADIDEATTHIIT 532

Query: 534 KTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPTATDKELN 588
           KTP T+KA++AKAF  +IKV+HPDW+FECL+NWK + E  YE  I    +++EL+
Sbjct: 533 KTPGTFKARLAKAFNPEIKVVHPDWIFECLVNWKRVDEKAYELLIEQPVSEEELD 587

>Kwal_27.10263 s27 complement(268744..270975) [2232 bp, 743 aa] {ON}
           YMR277W (FCP1) - TFIIF interacting component of CTD
           phosphatase [contig 37] FULL
          Length = 743

 Score =  740 bits (1911), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 361/596 (60%), Positives = 446/596 (74%), Gaps = 19/596 (3%)

Query: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVNDEH 60
           M+TP+  P  LP+PITI+KL  S G  V KGQRLF YK+W + ++  +P       N+E 
Sbjct: 1   MTTPIRLPPNLPFPITIAKLYVSKGESVTKGQRLFVYKYWELQDVITAP-------NEEA 53

Query: 61  SKKSIR-ESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCG 119
           SKK  R + I  FDSP EG LVS  V VGDE V  +  I E+ +PC+H++ Y  +C +CG
Sbjct: 54  SKKKRRVDLIGTFDSPIEGTLVSLKVRVGDEFVNDSNIIAELRQPCSHEVTYGALCVVCG 113

Query: 120 KEVDESDQ-------VSANLTISHTDTNLKVSRREANDIGQGXXXXXXXXXXXXXVVDLD 172
           K VDE D         +  LT++H +TN+KVS R+A  I +              VVDLD
Sbjct: 114 KAVDEDDSNMSGSGVSNGKLTVAHNNTNIKVSERQAASIEKTAQKELRERKKLVLVVDLD 173

Query: 173 QTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVK 232
           QTVIHCGVDPTI EW NDP+NPN++ L++VK+F L+E+PILPP YMGP+PP  +C YYVK
Sbjct: 174 QTVIHCGVDPTIKEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRRCQYYVK 233

Query: 233 IRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKS 292
           +RPGL+EFF++V+  +E+HIYTMATR+YA EIAKIIDP   LF DRILSR+ENGSLTHKS
Sbjct: 234 LRPGLQEFFDKVAPHFELHIYTMATRAYALEIAKIIDPTSALFGDRILSRDENGSLTHKS 293

Query: 293 LERLFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGR 352
           LERLFP DQSMVV+IDDRGDVW+WC NLIKV PYNFFVG+GDINSNFLPRQQ +ML +GR
Sbjct: 294 LERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHMGR 353

Query: 353 RNHKKTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQVRKEDITK 412
           R+ KK E+ +ELLTDIMDTEKKLQEKID+EVK+QEE  +  S     +    + KED+TK
Sbjct: 354 RHRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFNKISEE--NQPDRSMSKEDLTK 410

Query: 413 KIEFSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEEL-KTDK 471
           K+E +ASLEVQQQNRPLAELQKHM+NQ+LL DDDDEL +L +IL NV + YYEEL KT+ 
Sbjct: 411 KLEHNASLEVQQQNRPLAELQKHMNNQKLLIDDDDELPHLSEILLNVHRTYYEELAKTEV 470

Query: 472 EIQIQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHV 531
              I+ LMP++K KV   C+FVFSGLIPLGTNI+ ADIVLWTNMFGAQ+S+DI E+TTHV
Sbjct: 471 FPDIKLLMPQMKAKVFAQCHFVFSGLIPLGTNIRHADIVLWTNMFGAQTSSDIDENTTHV 530

Query: 532 ITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPTATDKEL 587
           ITKTP T+KA++AK++  DIK++HPDW+FECL+ W    E PYE  I    +  EL
Sbjct: 531 ITKTPGTFKARLAKSYNPDIKIVHPDWIFECLVKWVRADEKPYELIIEQEVSSDEL 586

>KLTH0C03894g Chr3 complement(339897..342134) [2238 bp, 745 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase
          Length = 745

 Score =  733 bits (1892), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 356/586 (60%), Positives = 448/586 (76%), Gaps = 23/586 (3%)

Query: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVNDEH 60
           M+TP+  P  LP+P+TI+KL  S G  V+KGQRLF YK+W + +I  +P       N+E 
Sbjct: 1   MTTPIRLPSNLPFPVTIAKLCVSTGDSVKKGQRLFVYKYWELQDIITAP-------NEEA 53

Query: 61  SKKSIR-ESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCG 119
            KK  R + I  FDSP EG LVS N+ +GDE V     I E+ + C+H++ Y G+C +CG
Sbjct: 54  PKKKRRVDLIGTFDSPVEGTLVSLNIGLGDEFVNDANVIAEVNQLCSHEVTYGGLCVVCG 113

Query: 120 KEVDESDQ-VSAN------LTISHTDTNLKVSRREANDIGQGXXXXXXXXXXXXXVVDLD 172
           K V+E DQ VS N      LT++H +TN+KVS R+A  I +              VVDLD
Sbjct: 114 KTVEEDDQNVSDNGISNSKLTVAHNNTNIKVSERQAATIEKTAQKHLREHKKLVLVVDLD 173

Query: 173 QTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVK 232
           QTVIHCGVDPTI EW NDP+NPN++ L++VK+F L+E+PILPP YMGP+PP  KC YYVK
Sbjct: 174 QTVIHCGVDPTIHEWANDPSNPNYDALKNVKTFSLDEDPILPPFYMGPRPPPRKCQYYVK 233

Query: 233 IRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKS 292
           +RPGL+EFF++++  +E+HIYTMATR+YA EIAKIIDP G LF DRILSR+ENGSLTHKS
Sbjct: 234 LRPGLQEFFDKIAPHFELHIYTMATRAYALEIAKIIDPKGELFGDRILSRDENGSLTHKS 293

Query: 293 LERLFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGR 352
           LERLFP DQSMVV+IDDRGDVW+WC NLIKV PYNFFVG+GDINSNFLPRQQ +ML LGR
Sbjct: 294 LERLFPMDQSMVVIIDDRGDVWSWCENLIKVVPYNFFVGVGDINSNFLPRQQNSMLHLGR 353

Query: 353 RNHKKTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQ--VRKEDI 410
           RN KK E+ +ELLTDIMDTEKKLQEKID+EVK+QEE  +     + EE   +  + KED+
Sbjct: 354 RNRKKAEE-EELLTDIMDTEKKLQEKIDQEVKKQEEKFN----KINEENQPERPISKEDL 408

Query: 411 TKKIEFSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEEL-KT 469
           TKK+E +ASLEVQQQNRPLAELQKHM+NQ+LLTDDDDEL +L +IL NV + YY++L + 
Sbjct: 409 TKKLEHNASLEVQQQNRPLAELQKHMNNQKLLTDDDDELPHLSNILLNVHKTYYDKLAEQ 468

Query: 470 DKEIQIQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTT 529
            +   I+TLMP++K +V + C+FVFSGLIPLGTN+++ADIVLWT+MFGA +S D+ E TT
Sbjct: 469 GQPPDIKTLMPQMKSQVFKRCHFVFSGLIPLGTNVRQADIVLWTSMFGATTSVDVDEATT 528

Query: 530 HVITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYE 575
           HVITKTP T+KA++AK +  +IKV+HPDW+FECL+ W  + E PYE
Sbjct: 529 HVITKTPGTFKARLAKTYNPNIKVIHPDWIFECLVKWVRVNEKPYE 574

>Ecym_4610 Chr4 (1188871..1191126) [2256 bp, 751 aa] {ON} similar to
           Ashbya gossypii ABL127W
          Length = 751

 Score =  729 bits (1883), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 354/592 (59%), Positives = 435/592 (73%), Gaps = 27/592 (4%)

Query: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVNDEH 60
           MSTP+  P  LPYPIT+++L  S G  VE+GQRLFAYK+W   +I  SP +   G     
Sbjct: 1   MSTPIRLPDNLPYPITVAQLAVSAGDMVERGQRLFAYKYWDFEQIVTSPGDESAG----- 55

Query: 61  SKKSIRESIEF---FDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTM 117
             KS R+ I+    FDSP  G +VS N+ +GDE V    T+ EI +PC HD+ Y G+C  
Sbjct: 56  -GKSKRQRIDLVGTFDSPVSGQVVSLNITLGDEFVNSQCTVAEIKQPCTHDVTYGGLCVQ 114

Query: 118 CGKEVDESDQVS-------ANLTISHTDTNLKVSRREANDIGQGXXXXXXXXXXXXXVVD 170
           CG+ V E +Q S       A LT+SHT+ N+++S ++A  + +              VVD
Sbjct: 115 CGQTV-EDEQTSGSLLDNQAKLTMSHTNMNIRISEKQAYTLEKSAQKQLREARKLVLVVD 173

Query: 171 LDQTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYY 230
           LDQTVIHCGVDPTI EW  DP NPN+E+L+DV+SF L EEP+LPP YMGPKPPT KCWYY
Sbjct: 174 LDQTVIHCGVDPTIGEWSKDPDNPNYESLKDVRSFSLHEEPVLPPFYMGPKPPTRKCWYY 233

Query: 231 VKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTH 290
           VK+RPGL++FF  ++  +E+HIYTMATR+YA EIAKIIDPDGTLF DRILSR+ENGSLT 
Sbjct: 234 VKLRPGLQDFFSNIAPHFELHIYTMATRTYALEIAKIIDPDGTLFGDRILSRDENGSLTQ 293

Query: 291 KSLERLFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQL 350
           KSLERLFP DQSMVV+IDDRGDVWNWC NLIKV PY+FFVGIGDINSNFLPRQQ +ML L
Sbjct: 294 KSLERLFPMDQSMVVIIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPRQQNSMLHL 353

Query: 351 GRRNHKKTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQ-VRKED 409
           GRRN KK +  +ELLTDI+DTEKKL+ KI EEVKRQEE +   S    E+I      KED
Sbjct: 354 GRRNRKKLKQDEELLTDILDTEKKLKVKISEEVKRQEEEMQKLSE---EKIPDHTTSKED 410

Query: 410 ITKKIEFSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEELKT 469
           I KK+E +ASLEVQQQNRPLAELQKH+HN++LL DDDDEL +L DIL  V   YY++L+ 
Sbjct: 411 IAKKLEHNASLEVQQQNRPLAELQKHLHNERLLIDDDDELPHLTDILLRVHSAYYDQLEK 470

Query: 470 DKEIQ------IQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSAD 523
           +K         I+ L+P LK+ V +GCNFVFSGLIPL TNI +ADIVLWTN FGA+++ +
Sbjct: 471 NKHGATELSPDIKHLIPSLKEIVFKGCNFVFSGLIPLHTNIDRADIVLWTNTFGAKTTIN 530

Query: 524 ITEDTTHVITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYE 575
           I  +TTH+ITKTP T KA++A +F  DIK++HPDW+FEC++NWK + E PYE
Sbjct: 531 IDYNTTHLITKTPGTMKARLASSFNRDIKIVHPDWIFECIVNWKRVDEKPYE 582

>ABL127W Chr2 (156798..158984) [2187 bp, 728 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR277W (FCP1)
          Length = 728

 Score =  727 bits (1877), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 353/585 (60%), Positives = 436/585 (74%), Gaps = 20/585 (3%)

Query: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVNDEH 60
           MSTP+  P  LPYPITI++L  S G  VEKGQRL AYK+W +V++  +P E + G     
Sbjct: 1   MSTPIRLPDSLPYPITIAQLGVSTGDTVEKGQRLLAYKYWDLVDVITAPGEEEAG----K 56

Query: 61  SKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCGK 120
           ++K   + +  FDSP  G +VS +V VGDE V   + + EI + C HD+ Y G+C  CG+
Sbjct: 57  ARKQRVDLVGTFDSPVAGTVVSLDVRVGDEFVNSQRPVVEIRQACPHDVTYGGLCVQCGQ 116

Query: 121 EVDE----SDQV-SANLTISHTDTNLKVSRREANDIGQGXXXXXXXXXXXXXVVDLDQTV 175
            V++    +D V  A LT+SHT+T+++VS R+A  +GQ              VVDLDQTV
Sbjct: 117 AVEDEAGAADGVEQAKLTVSHTNTHIRVSERQAASLGQSAQLKLREARKLVLVVDLDQTV 176

Query: 176 IHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIRP 235
           IHCGVDPTI EW  DP NPN+E L+DV+SF L+EEP+LPP YMGPKPPT KCWYYVK+RP
Sbjct: 177 IHCGVDPTIGEWSKDPNNPNYEALKDVQSFSLDEEPVLPPFYMGPKPPTRKCWYYVKLRP 236

Query: 236 GLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLER 295
           GLKEFF +++  +E+HIYTMATR+YA EIAKIIDPDG LF DRILSR+ENGSLT KSLER
Sbjct: 237 GLKEFFAKIAPHFELHIYTMATRAYALEIAKIIDPDGKLFGDRILSRDENGSLTQKSLER 296

Query: 296 LFPTDQSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRNH 355
           LFP DQSMVVVIDDRGDVWNWC NLIKV PY+FFVGIGDINSNFLP QQ +ML LGRRN 
Sbjct: 297 LFPMDQSMVVVIDDRGDVWNWCENLIKVVPYDFFVGIGDINSNFLPIQQNSMLHLGRRNR 356

Query: 356 KKTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQVRKEDITKKIE 415
           KK +  +ELLTDI+DTEKKL+EKI+EEVKRQE+ +      L +E     R  DI KK+E
Sbjct: 357 KKPKQEEELLTDILDTEKKLKEKINEEVKRQEDQMHR----LTDEKLPDTR--DIAKKLE 410

Query: 416 FSASLEVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEELKT-----D 470
            +ASLEVQQQNRPLAELQKHM N++LL DDDDEL +L +IL  V   YY++L+      D
Sbjct: 411 HNASLEVQQQNRPLAELQKHMRNERLLFDDDDELPHLGNILLKVHSAYYDQLQRYNSGED 470

Query: 471 KEIQIQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTH 530
               I+ LMPKLK+ V EGC FVFSGLIPL TNI++ADIVLWTNMFGA ++A++  +TTH
Sbjct: 471 PIPDIKILMPKLKETVFEGCRFVFSGLIPLHTNIERADIVLWTNMFGASTTANLDYNTTH 530

Query: 531 VITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYE 575
           +IT+TP T KA++AK+F   IK++HPDW+FECL+ W+ + E PYE
Sbjct: 531 LITRTPGTMKARLAKSFNPAIKIVHPDWIFECLVGWERVEESPYE 575

>KLLA0D01595g Chr4 complement(141459..143618) [2160 bp, 719 aa] {ON}
           similar to uniprot|Q03254 Saccharomyces cerevisiae
           YMR277W FCP1 Carboxy-terminal domain (CTD) phosphatase ,
          Length = 719

 Score =  690 bits (1780), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/580 (58%), Positives = 417/580 (71%), Gaps = 12/580 (2%)

Query: 1   MSTPVSAPLGLPYPITISKLIASIGSHVEKGQRLFAYKFWYIVEIAKSPDENDDGVNDEH 60
           + T V     LPYPIT+++L    G HVEKGQRLFAY++W   ++            +E 
Sbjct: 3   LETNVKVTSDLPYPITVAQLYVKPGDHVEKGQRLFAYEYWDFQDVLVK--------YEEK 54

Query: 61  SKKSIRESIEFFDSPFEGDLVSWNVDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMCGK 120
           +KK   + +  FDSP  G +  W+  V DE    N  +  I + CNHDI Y G+C  CG 
Sbjct: 55  TKKQRVDRVATFDSPVSGTVKEWHCSVKDEFASANHEVITIRQDCNHDITYGGLCVQCGN 114

Query: 121 EVDESDQVSANLTISHTDTNLKVSRREANDIGQGXXXXXXXXXXXXXVVDLDQTVIHCGV 180
            VDE D  S NLTISH +TN+KVS ++A  + +              VVDLDQTVIHCGV
Sbjct: 115 TVDEEDN-SKNLTISHVNTNIKVSEQQAETLERSSLTRLREEKKLVLVVDLDQTVIHCGV 173

Query: 181 DPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIRPGLKEF 240
           DPTI EW  DP NPN++ L+DVKSF LE+EPI+P  Y GPKPP  K WYYVK+RPGLKEF
Sbjct: 174 DPTIGEWMRDPKNPNYKALQDVKSFTLEDEPIIPSFYFGPKPPARKSWYYVKLRPGLKEF 233

Query: 241 FEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRILSRNENGSLTHKSLERLFPTD 300
           FE VS  +EMHIYTMATRSYA EIAKIIDP G LF DRILSR+ENGSLT KSLERLFP D
Sbjct: 234 FEAVSPHFEMHIYTMATRSYAHEIAKIIDPTGELFGDRILSRDENGSLTTKSLERLFPMD 293

Query: 301 QSMVVVIDDRGDVWNWCPNLIKVTPYNFFVGIGDINSNFLPRQQTTMLQLGRRNHKKTED 360
           QSMVVVIDDRGDVWNW  NLIKV PY+FFVGIGDINSNFLPRQQ ++L LG R+H++ ++
Sbjct: 294 QSMVVVIDDRGDVWNWFENLIKVVPYSFFVGIGDINSNFLPRQQNSVLHLG-RHHRRKQE 352

Query: 361 TDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQVRKEDITKKIEFSASL 420
            ++L++DI+D EKKL+EKIDEEVKRQEE +SH       +      KEDI+KK+E SASL
Sbjct: 353 EEKLISDIIDNEKKLKEKIDEEVKRQEEIISHIGDDNTRKEGGPPNKEDISKKLEHSASL 412

Query: 421 EVQQQNRPLAELQKHMHNQQLLTDDDDELFYLKDILKNVQQKYYEELKTDKE--IQIQTL 478
           EVQQQNRPLAELQKH+HNQ LL DDDDEL +L  IL  V ++Y+ +     +    I+ L
Sbjct: 413 EVQQQNRPLAELQKHLHNQTLLIDDDDELPHLSQILLRVHKEYFNQYTEAPKNPPDIKYL 472

Query: 479 MPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHVITKTPHT 538
           +P++K KV +GC+FVFSGLIPL T+++KADIVLWT+MFGA +S+DI   TTH+IT T  T
Sbjct: 473 LPQMKYKVFQGCHFVFSGLIPLETDVRKADIVLWTDMFGATTSSDINYKTTHIITTTSRT 532

Query: 539 YKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNI 578
           +KA++AK+F  DIK++HPDW+FECL+ W+ + E PYE  I
Sbjct: 533 FKARLAKSFNPDIKIVHPDWLFECLVQWERVKESPYELLI 572

>YLR019W Chr12 (180288..181481) [1194 bp, 397 aa] {ON}
           PSR2Functionally redundant Psr1p homolog, a plasma
           membrane phosphatase involved in the general stress
           response; required with Psr1p and Whi2p for full
           activation of STRE-mediated gene expression, possibly
           through dephosphorylation of Msn2p
          Length = 397

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/45 (42%), Positives = 29/45 (64%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTL 274
           YV  RPG+ EF   VS+LYE+ ++T +   YA  +   +DP+GT+
Sbjct: 265 YVIKRPGVDEFLNRVSQLYEVVVFTASVSRYANPLLDTLDPNGTI 309

>TPHA0E03070 Chr5 (644651..646135) [1485 bp, 494 aa] {ON} Anc_5.202
           YLL010C
          Length = 494

 Score = 47.0 bits (110), Expect = 1e-04,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 30/51 (58%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRIL 280
           YV  RPG+ EF + VS+LYE+ ++T +   Y   +  I+DP  T+   R+ 
Sbjct: 361 YVIKRPGVDEFLKRVSELYEVVVFTASVSRYGDPLLNILDPANTIIHHRLF 411

>SAKL0G12870g Chr7 (1100535..1101734) [1200 bp, 399 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 399

 Score = 46.6 bits (109), Expect = 2e-04,   Method: Compositional matrix adjust.
 Identities = 23/60 (38%), Positives = 32/60 (53%), Gaps = 4/60 (6%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGT----LFADRILSRNEN 285
           YV  RPG+ EF E V KLYE+ ++T +   Y   +  I+DP G     LF D   + + N
Sbjct: 267 YVIKRPGVDEFLERVGKLYEVVVFTASVSRYGDPLLDILDPRGAVHHRLFRDSCYNYDGN 326

>Skud_12.87 Chr12 (172096..173274) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 45.4 bits (106), Expect = 3e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 29/45 (64%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTL 274
           YV  RPG+ EF   VS++YE+ ++T +   YA  +   +DP+GT+
Sbjct: 260 YVIKRPGVDEFLHRVSQVYEVVVFTASVSRYANPLLDTLDPNGTI 304

>Smik_12.82 Chr12 (167115..168293) [1179 bp, 392 aa] {ON} YLR019W
           (REAL)
          Length = 392

 Score = 45.4 bits (106), Expect = 4e-04,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTL 274
           YV  RPG+ EF   V +LYE+ ++T +   YA  +   +DP+GT+
Sbjct: 260 YVIKRPGVDEFLSRVCQLYEVVVFTASVSRYANPLLDTLDPNGTI 304

>Suva_10.99 Chr10 (186341..187498) [1158 bp, 385 aa] {ON} YLR019W
           (REAL)
          Length = 385

 Score = 43.5 bits (101), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 18/45 (40%), Positives = 28/45 (62%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTL 274
           YV  RPG+ EF   VS+LYE+ ++T +   YA  +   +DP+ T+
Sbjct: 253 YVIKRPGVDEFLHRVSQLYEVVVFTASVSRYANPLLDTLDPNRTI 297

>NDAI0D01860 Chr4 (437370..438914) [1545 bp, 514 aa] {ON} Anc_5.202
          Length = 514

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 28/51 (54%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRIL 280
           YV  RPG+ EF E+V KL+E+ I+T +   Y   +   +DP G     R+ 
Sbjct: 381 YVIKRPGVDEFLEKVGKLFEVVIFTASVSRYGDPLLDRLDPKGKSIHHRLF 431

>TBLA0C06090 Chr3 complement(1478726..1480180) [1455 bp, 484 aa]
           {ON} Anc_5.202 YLL010C
          Length = 484

 Score = 42.7 bits (99), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 19/51 (37%), Positives = 27/51 (52%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRIL 280
           YV  RPG+  F  EV K YE+ I+T +   YA  +  ++D D  L   R+ 
Sbjct: 351 YVIKRPGVDRFLREVKKWYEIVIFTASLSRYANPLLDLLDKDHNLINHRLF 401

>NCAS0A06800 Chr1 (1346677..1348098) [1422 bp, 473 aa] {ON}
           Anc_5.202
          Length = 473

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/51 (33%), Positives = 29/51 (56%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRIL 280
           YV  RPG++EF + V +L+E+ ++T +   Y   +  I+DP   L   R+ 
Sbjct: 340 YVIKRPGVEEFLKRVGELFEVVVFTASVARYGDPLLDILDPGRQLIHHRLF 390

>Suva_10.65 Chr10 complement(134276..135523) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTL 274
           YV  RPG++EF E V KL+E+ ++T +   Y   +  I+D D  +
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTDKVI 327

>Smik_12.53 Chr12 complement(116428..117672) [1245 bp, 414 aa] {ON}
           YLL010C (REAL)
          Length = 414

 Score = 41.6 bits (96), Expect = 0.007,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTL 274
           YV  RPG++EF E V KL+E+ ++T +   Y   +  I+D D  +
Sbjct: 282 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDADKVI 326

>YLL010C Chr12 complement(129330..130613) [1284 bp, 427 aa] {ON}
           PSR1Plasma membrane associated protein phosphatase
           involved in the general stress response; required along
           with binding partner Whi2p for full activation of
           STRE-mediated gene expression, possibly through
           dephosphorylation of Msn2p
          Length = 427

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 27/45 (60%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTL 274
           YV  RPG++EF E V KL+E+ ++T +   Y   +  I+D D  +
Sbjct: 295 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILDTDKVI 339

>KNAG0M01740 Chr13 (321477..322922) [1446 bp, 481 aa] {ON} Anc_5.202
           YLL010C
          Length = 481

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 17/45 (37%), Positives = 26/45 (57%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTL 274
           YV  RPG+ EF   V KLYE+ ++T +   Y   +  I+D D ++
Sbjct: 349 YVIKRPGVDEFLRRVGKLYEVVVFTASVSRYGDPLLDILDKDKSI 393

>Kpol_478.16 s478 complement(58800..59852) [1053 bp, 350 aa] {ON}
           complement(58800..59852) [1053 nt, 351 aa]
          Length = 350

 Score = 40.8 bits (94), Expect = 0.009,   Method: Compositional matrix adjust.
 Identities = 27/93 (29%), Positives = 46/93 (49%), Gaps = 5/93 (5%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTLFADRIL---SRNENG 286
           YV  RPG+  F +  SKL+E+ I+T +   Y   +  I+D    L   R+      N NG
Sbjct: 217 YVIKRPGVDAFLQYTSKLFEVVIFTASVEKYGNPLLDILDSTNDLVHHRLFRDACYNYNG 276

Query: 287 SLTHKSLERLFPTDQSMVVVIDDRGDVWNWCPN 319
           +   K+L +L     S ++++D+    + + PN
Sbjct: 277 NYI-KNLAQL-GRPLSDIIILDNSPTSYLFHPN 307

>KLLA0F15620g Chr6 complement(1441560..1442804) [1245 bp, 414 aa]
           {ON} similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010C
          Length = 414

 Score = 40.8 bits (94), Expect = 0.011,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 27/45 (60%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTL 274
           YV  RPG+ EF   +++LYE+ ++T +   Y   +  I+D D T+
Sbjct: 282 YVIKRPGVDEFLRRITELYEVVVFTASVSRYGDPLLDILDKDKTI 326

>TPHA0N00670 Chr14 complement(147329..148687) [1359 bp, 452 aa] {ON}
           Anc_5.202 YLL010C
          Length = 452

 Score = 40.0 bits (92), Expect = 0.021,   Method: Compositional matrix adjust.
 Identities = 16/41 (39%), Positives = 24/41 (58%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDP 270
           YV  RPG+ EF + V  LYE+ ++T +   Y   +  I+DP
Sbjct: 320 YVSKRPGVDEFLKIVGDLYEVIVFTASVSRYGNPLMDILDP 360

>Skud_12.57 Chr12 complement(120706..121953) [1248 bp, 415 aa] {ON}
           YLL010C (REAL)
          Length = 415

 Score = 39.7 bits (91), Expect = 0.026,   Method: Compositional matrix adjust.
 Identities = 16/40 (40%), Positives = 25/40 (62%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIID 269
           YV  RPG++EF E V KL+E+ ++T +   Y   +  I+D
Sbjct: 283 YVIKRPGVEEFLERVGKLFEVVVFTASVSRYGDPLLDILD 322

>Kpol_1010.61 s1010 (148944..151325,151327..151743) [2799 bp, 932
           aa] {ON} (148944..151325,151327..151743) [2799 nt, 933
           aa]
          Length = 932

 Score = 39.7 bits (91), Expect = 0.031,   Method: Compositional matrix adjust.
 Identities = 31/110 (28%), Positives = 53/110 (48%), Gaps = 8/110 (7%)

Query: 484 KKVLEGCNFVFSGLIPLGT-NIQKADIVLWTNMFGAQSSADITEDTTHVITKTPH--TYK 540
           + +L+ C    S  +   T NI  ++++   N  G   S  I+  TTH+I+  P      
Sbjct: 120 RHILKDCTIYVSRTVFNRTENILYSELI---NALGGSVSDMISNKTTHLISSDPTDPALI 176

Query: 541 AKIAKAFKSDIKVLHPDWVFECLLNWKYMPE--FPYEYNIIPTATDKELN 588
           A +A    S IK ++P W+ +C L  KY+ E  F  + ++ P   ++ LN
Sbjct: 177 AIVASDCHSRIKQVYPAWLCQCFLEVKYVDEKNFILDSSLSPEDAEETLN 226

>NDAI0I02170 Chr9 (498399..499574) [1176 bp, 391 aa] {ON} Anc_5.202
          Length = 391

 Score = 38.5 bits (88), Expect = 0.057,   Method: Compositional matrix adjust.
 Identities = 15/45 (33%), Positives = 26/45 (57%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTL 274
           YV  RPG+ EF   V++LYE+ ++T +   Y   +  I+D   ++
Sbjct: 259 YVIKRPGVDEFLRRVAQLYEVVVFTASVSRYGDPLLDILDSSNSI 303

>TBLA0H01990 Chr8 (472045..474111) [2067 bp, 688 aa] {ON} Anc_5.202
           YLL010C
          Length = 688

 Score = 38.5 bits (88), Expect = 0.070,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 25/40 (62%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIID 269
           YV  RPG+ +F E VSK++E+ ++T +   Y   +  ++D
Sbjct: 556 YVIKRPGVDQFLETVSKIFEVVVFTASVSRYGDPLLDVLD 595

>NCAS0D02740 Chr4 complement(525116..526312) [1197 bp, 398 aa] {ON}
           Anc_5.202
          Length = 398

 Score = 38.1 bits (87), Expect = 0.071,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIID 269
           YV  RPG+ EF + V +LYE+ ++T +   Y   +  I+D
Sbjct: 266 YVIKRPGVDEFLKRVGELYEVVVFTASVSRYGDPLLNILD 305

>Kpol_2002.100 s2002 complement(238947..240380) [1434 bp, 477 aa]
           {ON} complement(238947..240380) [1434 nt, 478 aa]
          Length = 477

 Score = 37.7 bits (86), Expect = 0.093,   Method: Compositional matrix adjust.
 Identities = 28/107 (26%), Positives = 50/107 (46%), Gaps = 28/107 (26%)

Query: 168 VVDLDQTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKC 227
           V+DLD+T++H                  F+ + D   FVL       P+ +  +  TH+ 
Sbjct: 311 VLDLDETLVHSS----------------FKYI-DTADFVL-------PVTIDDQ--THQV 344

Query: 228 WYYVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTL 274
             YV  RPG+ EF + V K++E+ ++T +   Y   +  I+D   ++
Sbjct: 345 --YVIKRPGVDEFLKRVGKIFEVVVFTASVSRYGDPLLDILDSSKSI 389

>CAGL0D03234g Chr4 (334913..336145) [1233 bp, 410 aa] {ON} similar
           to uniprot|Q07949 Saccharomyces cerevisiae YLR019w PSR2
           oruniprot|Q07800 Saccharomyces cerevisiae YLL010c PSR1
          Length = 410

 Score = 37.7 bits (86), Expect = 0.097,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIID 269
           YV  RPG+ EF + V +LYE+ ++T +   Y   +  I+D
Sbjct: 278 YVIKRPGVDEFLKRVGELYEVVVFTASVARYGDPLLDILD 317

>TDEL0E04270 Chr5 (798352..799713) [1362 bp, 453 aa] {ON} Anc_5.202
           YLL010C
          Length = 453

 Score = 37.7 bits (86), Expect = 0.11,   Method: Compositional matrix adjust.
 Identities = 16/45 (35%), Positives = 25/45 (55%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGTL 274
           YV  RPG+ EF + V  LYE+ ++T +   Y   +  I+D   T+
Sbjct: 321 YVIKRPGVDEFLKRVGALYEVVVFTASVSRYGDPLLDILDKHKTI 365

>Ecym_7104 Chr7 (203366..204844) [1479 bp, 492 aa] {ON} similar to
           Ashbya gossypii AAL158W
          Length = 492

 Score = 37.4 bits (85), Expect = 0.12,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 23/40 (57%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIID 269
           YV  RPG+ EF   V +LYE+ ++T +   Y   +  I+D
Sbjct: 360 YVIKRPGVDEFLRRVGELYEVVVFTASVSRYGDPLLDILD 399

>CAGL0D05610g Chr4 complement(534849..536192) [1344 bp, 447 aa] {ON}
           similar to uniprot|Q07800 Saccharomyces cerevisiae
           YLL010c PSR1 or uniprot|Q07949 Saccharomyces cerevisiae
           YLR019w PSR2
          Length = 447

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIID 269
           YV  RPG+ EF + V +LYE+ ++T +   Y   +  ++D
Sbjct: 315 YVIKRPGVDEFLQRVGELYEVVVFTASVSRYGDPLLDVLD 354

>ZYRO0B10428g Chr2 (823155..824603) [1449 bp, 482 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 482

 Score = 37.4 bits (85), Expect = 0.13,   Method: Compositional matrix adjust.
 Identities = 15/40 (37%), Positives = 24/40 (60%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIID 269
           YV  RPG+ EF ++V  L+E+ I+T +   Y   +  I+D
Sbjct: 350 YVMKRPGVDEFLKKVGSLFEVVIFTASVARYGDPLLDILD 389

>AAL158W Chr1 (67892..69328) [1437 bp, 478 aa] {ON} Syntenic homolog
           of Saccharomyces cerevisiae YLL010C (PSR1) and YLR019W
           (PSR2)
          Length = 478

 Score = 36.6 bits (83), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIID 269
           YV  RPG+ EF + V +L+E+ ++T +   Y   +  I+D
Sbjct: 346 YVIKRPGVDEFLKRVGELFEVVVFTASVSRYGDPLLDILD 385

>Kwal_14.2229 s14 complement(665073..667097) [2025 bp, 674 aa] {ON}
           YLR330W (CHS5) - involved in cell wall biogenesis
           [contig 227] FULL
          Length = 674

 Score = 36.6 bits (83), Expect = 0.27,   Method: Compositional matrix adjust.
 Identities = 16/46 (34%), Positives = 27/46 (58%)

Query: 524 ITEDTTHVITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYM 569
           +T DTTH I+    +  A+  KA +S+I ++ P+WV  C L  + +
Sbjct: 208 VTIDTTHFISNEKESDDAEFHKAQQSNIPIVRPEWVRACELERRIV 253

>Kwal_33.15140 s33 complement(975769..977001) [1233 bp, 410 aa] {ON}
           YLR019W (PSR2) - Plasma membrane Sodium Response 2
           [contig 94] FULL
          Length = 410

 Score = 36.2 bits (82), Expect = 0.32,   Method: Compositional matrix adjust.
 Identities = 14/40 (35%), Positives = 24/40 (60%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIID 269
           YV  RPG+ EF + V +LYE+ ++T +   Y   +  ++D
Sbjct: 278 YVIKRPGVDEFLKLVGQLYEVVVFTASVSRYGDPLLDVLD 317

>TPHA0H01070 Chr8 (229632..232679) [3048 bp, 1015 aa] {ON} Anc_5.94
           YHR154W
          Length = 1015

 Score = 36.2 bits (82), Expect = 0.37,   Method: Compositional matrix adjust.
 Identities = 23/86 (26%), Positives = 40/86 (46%), Gaps = 5/86 (5%)

Query: 504 IQKADIVLWT---NMFGAQSSADITEDTTHVITKTP--HTYKAKIAKAFKSDIKVLHPDW 558
             K +++ ++   N  G  +   I+  TTH+IT  P      A IA   K +I  ++P W
Sbjct: 132 FNKTEVLFYSELINALGGTTVDHISTLTTHLITNDPTDQAVIATIASEQKQNISFVYPTW 191

Query: 559 VFECLLNWKYMPEFPYEYNIIPTATD 584
           + +C  +   + E  +  NI  +A D
Sbjct: 192 LCQCFKSMTLVNESDHLINIQSSAED 217

 Score = 34.7 bits (78), Expect = 1.0,   Method: Compositional matrix adjust.
 Identities = 22/99 (22%), Positives = 44/99 (44%), Gaps = 2/99 (2%)

Query: 466 ELKTDKEIQIQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADIT 525
           E++T  +   +  +   KKK+ E    + +     G   Q+  I   T + G  +S D++
Sbjct: 321 EMETFVDATSKIFLKPFKKKIFERSQLILAYTNYFGP--QRYYIQRLTRLMGGIASTDLS 378

Query: 526 EDTTHVITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLL 564
           +  TH+I  +PH  K   A    + +   +  W+ +C +
Sbjct: 379 KKNTHLIFGSPHGKKYDFAMRRPNILVTTNHSWLEDCYI 417

>Kwal_14.1042 s14 complement(168504..171242) [2739 bp, 912 aa] {ON}
           YHR154W (RTT107) - involved in silencing [contig 244]
           FULL
          Length = 912

 Score = 35.8 bits (81), Expect = 0.47,   Method: Compositional matrix adjust.
 Identities = 24/93 (25%), Positives = 44/93 (47%), Gaps = 3/93 (3%)

Query: 481 KLKKKVLEGCNFVFSGLIPLGTNI---QKADIVLWTNMFGAQSSADITEDTTHVITKTPH 537
           KL    L  C F  S L+   TN    Q+  I       G +S+ ++T+  TH+++  PH
Sbjct: 331 KLLLSPLRPCIFQKSELVLSYTNYMGQQRHYIQRLVEALGGKSTTELTKKNTHLLSCLPH 390

Query: 538 TYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMP 570
             K + A  + ++  +++  W+ +C    + MP
Sbjct: 391 GQKYEAASRWGNNCIIVNHLWLEDCYKEHRKMP 423

>KLTH0C01584g Chr3 complement(139563..142304) [2742 bp, 913 aa] {ON}
           some similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 913

 Score = 35.8 bits (81), Expect = 0.50,   Method: Compositional matrix adjust.
 Identities = 26/108 (24%), Positives = 45/108 (41%), Gaps = 2/108 (1%)

Query: 474 QIQTLMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHVIT 533
           Q + L+  L+  V      + S    LG   Q+  I       G  S+ ++T+  TH++T
Sbjct: 328 QFKLLLSPLRPPVFNKGQLILSYTNYLGQ--QRYYIQKLVEALGGVSTTELTKKNTHLLT 385

Query: 534 KTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIPT 581
             P   K + A  ++   K+ +  W+ +C      +P     YN IP 
Sbjct: 386 CLPLGQKYEAALRWEGTCKIANHLWLEDCYRKQTQVPFVGTRYNEIPA 433

>TBLA0I01460 Chr9 complement(318104..319285) [1182 bp, 393 aa] {ON}
           Anc_2.530 YHR004C
          Length = 393

 Score = 35.4 bits (80), Expect = 0.52,   Method: Compositional matrix adjust.
 Identities = 29/97 (29%), Positives = 45/97 (46%), Gaps = 10/97 (10%)

Query: 168 VVDLDQTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMYMGPKPPTHKC 227
           ++DLD+T+IH     +++   +  T  N+  L +VK       P   P   GP  P    
Sbjct: 196 ILDLDETLIH-----SMSRNISSSTISNYH-LIEVKFPTPTSAPTSAP---GPSLPLSSL 246

Query: 228 WYYVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEI 264
            YYV  RP    F   VS  Y++ I+T + + YA  +
Sbjct: 247 -YYVYKRPYCDHFLNLVSDWYDLIIFTASMKEYADPV 282

>KAFR0E02140 Chr5 (426065..428920) [2856 bp, 951 aa] {ON} Anc_5.94
           YHR154W
          Length = 951

 Score = 35.4 bits (80), Expect = 0.62,   Method: Compositional matrix adjust.
 Identities = 24/91 (26%), Positives = 43/91 (47%), Gaps = 6/91 (6%)

Query: 500 LGTNIQKADIVLWTNM---FGAQSSADITEDTTHVITKTPHTYKAKIAKA-FKSDIKVLH 555
           L  + + ++ +L+T +    G     +I   TTH+IT  P     +I K    + IK ++
Sbjct: 133 LKPSFEASEYLLYTELIHSMGGTCVENINNKTTHIITTNPKESCFEILKRNGTTSIKYIY 192

Query: 556 PDWVFECLLNWKYMPEFPYEYNIIPTATDKE 586
           P W+  C+   + + E   E+ I+P   D E
Sbjct: 193 PTWLIHCVKESQLIDE--SEHEIVPFTDDTE 221

>KAFR0A06560 Chr1 complement(1329583..1331250) [1668 bp, 555 aa]
           {ON} Anc_4.156 YLR330W
          Length = 555

 Score = 35.0 bits (79), Expect = 0.76,   Method: Compositional matrix adjust.
 Identities = 20/84 (23%), Positives = 38/84 (45%), Gaps = 2/84 (2%)

Query: 487 LEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQS-SADITEDTTHVITKTPHTYKAKIAK 545
           + G       L P+  NI +  I     + GA+     ++ DTTH I        A++ +
Sbjct: 171 MSGITVCLGSLDPM-LNISEEQIEKCLQVIGAKPLQKHVSIDTTHFICNDEEEEDAELIR 229

Query: 546 AFKSDIKVLHPDWVFECLLNWKYM 569
           A  S+I ++ P+W+  C +  + +
Sbjct: 230 AKNSNIPIVRPEWIRACAVEKRIV 253

>NDAI0G01620 Chr7 (357000..359219) [2220 bp, 739 aa] {ON} Anc_3.196
           YBR007C
          Length = 739

 Score = 35.0 bits (79), Expect = 0.82,   Method: Compositional matrix adjust.
 Identities = 16/49 (32%), Positives = 25/49 (51%), Gaps = 8/49 (16%)

Query: 169 VDLDQTVIHCGVDPTIAEWKNDPTNPNFETLRDVKSFVLEEEPILPPMY 217
           + +D+ V+HC VDP   E KN+         RD   + +  EP+ P +Y
Sbjct: 607 ISIDKDVLHCHVDPMEIEKKNN--------FRDKSMYQIMREPLAPALY 647

>Skud_12.545 Chr12 complement(973113..975215) [2103 bp, 700 aa] {ON}
           YLR452C (REAL)
          Length = 700

 Score = 34.7 bits (78), Expect = 0.97,   Method: Compositional matrix adjust.
 Identities = 37/130 (28%), Positives = 51/130 (39%), Gaps = 16/130 (12%)

Query: 27  HVEKGQRLFAY--KFWYIVEIAKSPDENDDGVNDEHSKKSIRESIEFFDSPFEGDLVSWN 84
           HV++   L A   K   IV +   P   D        K  I  S  F  S    DLVSW 
Sbjct: 314 HVKEAVSLAALFLKMGLIVPVLLQPSRTDK------KKFQISRSSFFTLSELGWDLVSWK 367

Query: 85  VDVGDEIVEPNQTICEIVRPCNHDIVYAGICTMC--GKEVDESDQVSANLTISHTDTNLK 142
               + ++ PN       RP   D  + G  T+    K +DE++    ++ IS TD +L 
Sbjct: 368 SCKSNNVLAPNS------RPMGLDFTFTGHVTVRDERKTLDENESFPQDILISSTDHSLN 421

Query: 143 VSRREANDIG 152
                 ND G
Sbjct: 422 KFDYVLNDPG 431

>KLTH0B03388g Chr2 (272914..274143) [1230 bp, 409 aa] {ON} similar
           to uniprot|Q07800 Saccharomyces cerevisiae YLL010C
          Length = 409

 Score = 34.3 bits (77), Expect = 1.1,   Method: Compositional matrix adjust.
 Identities = 13/40 (32%), Positives = 23/40 (57%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIID 269
           YV  RPG+ +F   V +LYE+ ++T +   Y   +  ++D
Sbjct: 277 YVIKRPGVDDFLRLVGQLYEVVVFTASVSRYGDPLLDVLD 316

>KAFR0J00990 Chr10 complement(178980..180431) [1452 bp, 483 aa] {ON}
           Anc_5.202 YLL010C
          Length = 483

 Score = 34.3 bits (77), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 12/40 (30%), Positives = 24/40 (60%)

Query: 230 YVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIID 269
           YV  RPG+ EF + V +++E+ ++T +   Y   +  ++D
Sbjct: 351 YVIKRPGVDEFLKRVGEIFEVVVFTASVSRYGDPLLDVLD 390

>ZYRO0B01958g Chr2 complement(159965..160975) [1011 bp, 336 aa] {ON}
           similar to uniprot|P38757 Saccharomyces cerevisiae
           YHR004C NEM1 Protein of the nuclear envelope required
           for the spherical shape of the nucleus required for
           normal sporulation
          Length = 336

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 19/63 (30%), Positives = 30/63 (47%), Gaps = 1/63 (1%)

Query: 222 PPTHKCWYYVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDPDGT-LFADRIL 280
           P +    YYV  RP    F  +VSK Y++ I+T + + YA  +   ++   T  F  R+ 
Sbjct: 189 PSSISTLYYVHKRPHCDLFLSKVSKWYDLIIFTASMKEYADPVIDWLESSFTGKFCKRLY 248

Query: 281 SRN 283
             N
Sbjct: 249 RHN 251

>NDAI0C03230 Chr3 (734531..737635) [3105 bp, 1034 aa] {ON} Anc_5.94
           YHR154W
          Length = 1034

 Score = 34.7 bits (78), Expect = 1.3,   Method: Compositional matrix adjust.
 Identities = 20/82 (24%), Positives = 40/82 (48%), Gaps = 2/82 (2%)

Query: 478 LMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHVITKTPH 537
           L    KKK+ +    + +     G   Q++ I   T M G  S+ ++++  TH++++ P 
Sbjct: 348 LFEPFKKKIFKSSELILTYTNYFGR--QRSYIQRLTEMLGGISTTELSKRNTHLVSRMPV 405

Query: 538 TYKAKIAKAFKSDIKVLHPDWV 559
             K   AK +K   +V++  W+
Sbjct: 406 GKKFFQAKKWKDRCQVINHLWL 427

>TPHA0A05110 Chr1 (1149460..1152657) [3198 bp, 1065 aa] {ON}
           Anc_5.94 YHR154W
          Length = 1065

 Score = 34.3 bits (77), Expect = 1.5,   Method: Compositional matrix adjust.
 Identities = 16/60 (26%), Positives = 33/60 (55%)

Query: 516 FGAQSSADITEDTTHVITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYE 575
            G +S+  +++  TH+I   P+  K   A++  + I V++  W+ +C+L    +PE  +E
Sbjct: 374 LGGKSTPTLSKRNTHLIFGVPYGKKYNYARSKLNKINVVNIKWLEQCVLLKSRVPENLFE 433

>SAKL0H20592g Chr8 complement(1805321..1806847) [1527 bp, 508 aa]
           {ON} some similarities with uniprot|Q12114 Saccharomyces
           cerevisiae YLR330W CHS5 Protein of unknown function
           involved in chitin biosynthesis by regulating Chs3p
           localization also involved in cell fusion during mating
          Length = 508

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 18/55 (32%), Positives = 29/55 (52%), Gaps = 1/55 (1%)

Query: 516 FGAQSSAD-ITEDTTHVITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYM 569
            GA++  D +  DTTH I     +   ++ KA  S+I V+ P+WV  C L  + +
Sbjct: 198 IGAKALQDHVGLDTTHFICNEKDSEDPELEKAQNSNIPVVRPEWVRACELERRIV 252

>Smik_8.238 Chr8 (379729..382956) [3228 bp, 1075 aa] {ON} YHR154W
           (REAL)
          Length = 1075

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/74 (32%), Positives = 35/74 (47%), Gaps = 18/74 (24%)

Query: 510 VLWTNMFGAQ--------------SSADITEDTTHVITKTPHTYKAKIAKAFKSD----I 551
           V +TN FG+Q              S+ ++T   TH+ITK     K K+AK +  D    I
Sbjct: 382 VAYTNYFGSQRFYIQRLVEILGGLSTPELTRKNTHLITKNAIGKKFKVAKKWSLDPQNAI 441

Query: 552 KVLHPDWVFECLLN 565
            V +  W+ EC +N
Sbjct: 442 IVTNHLWLEECYMN 455

>TBLA0B07390 Chr2 complement(1758977..1762072) [3096 bp, 1031 aa]
           {ON} Anc_5.94 YHR154W
          Length = 1031

 Score = 33.9 bits (76), Expect = 1.8,   Method: Compositional matrix adjust.
 Identities = 24/68 (35%), Positives = 37/68 (54%), Gaps = 5/68 (7%)

Query: 517 GAQSSADITED-TTHVITKTPHTYKAKIAKAFKS---DIKVLHPDWVFECLLNWKYMPEF 572
           GA SS ++T+  T  +I K P   K + AK + S   DIK+L+  W+ +C +  K +   
Sbjct: 399 GANSSVNLTKKFTNFLIVKKPIGKKFESAKLWNSKGQDIKILNHRWLHDCYIQNKNLKLI 458

Query: 573 PYEYNIIP 580
           P +Y I P
Sbjct: 459 P-KYLIFP 465

>TDEL0A03050 Chr1 complement(546922..547989) [1068 bp, 355 aa] {ON}
           Anc_2.530 YHR004C
          Length = 355

 Score = 33.5 bits (75), Expect = 2.1,   Method: Compositional matrix adjust.
 Identities = 14/33 (42%), Positives = 20/33 (60%)

Query: 229 YYVKIRPGLKEFFEEVSKLYEMHIYTMATRSYA 261
           YYV  RP    F  +VSK Y++ ++T + R YA
Sbjct: 211 YYVHKRPHCDLFLSKVSKWYDLVVFTASMREYA 243

>YHR154W Chr8 (402966..406178) [3213 bp, 1070 aa] {ON}
           RTT107Protein implicated in Mms22-dependent DNA repair
           during S phase; involved in recruiting the SMC5/6
           complex to double-strand breaks; DNA damage induces
           phosphorylation by Mec1p at one or more SQ/TQ motifs;
           interacts with Mms22p and Slx4p; has four BRCT domains;
           has a role in regulation of Ty1 transposition
          Length = 1070

 Score = 33.5 bits (75), Expect = 2.3,   Method: Compositional matrix adjust.
 Identities = 23/74 (31%), Positives = 36/74 (48%), Gaps = 18/74 (24%)

Query: 510 VLWTNMFGAQ--------------SSADITEDTTHVITKTPHTYKAKIAKAFKSD----I 551
           V +TN FG+Q              S+ ++T   TH+ITK+    K K+AK +  D    I
Sbjct: 382 VAYTNYFGSQRFYIQRLVEILGGLSTPELTRKNTHLITKSTIGKKFKVAKKWSLDPQNAI 441

Query: 552 KVLHPDWVFECLLN 565
            V +  W+ +C +N
Sbjct: 442 IVTNHMWLEQCYMN 455

>KLLA0E15621g Chr5 complement(1397950..1400625) [2676 bp, 891 aa]
           {ON} some similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 891

 Score = 33.1 bits (74), Expect = 2.9,   Method: Compositional matrix adjust.
 Identities = 18/67 (26%), Positives = 32/67 (47%), Gaps = 1/67 (1%)

Query: 513 TNMFGAQSSADITEDTTHVITKTPHTYKAKIAKAF-KSDIKVLHPDWVFECLLNWKYMPE 571
            ++FG      ++   TH+IT   +    K  + F K  +  L P+W+ +CL   +Y+ E
Sbjct: 146 VSVFGGTCMDYLSTKATHIITWDKNDVAIKAMQKFHKYTVIYLMPNWLVDCLCGLEYIKE 205

Query: 572 FPYEYNI 578
             Y  N+
Sbjct: 206 DEYLINV 212

>SAKL0G15620g Chr7 (1342049..1344688) [2640 bp, 879 aa] {ON} some
           similarities with uniprot|P38850 Saccharomyces
           cerevisiae YHR154W RTT107 Regulator of Ty1 Transposition
           Establishes Silent Chromatin involved in silencing
          Length = 879

 Score = 32.7 bits (73), Expect = 4.1,   Method: Compositional matrix adjust.
 Identities = 25/103 (24%), Positives = 44/103 (42%), Gaps = 2/103 (1%)

Query: 478 LMPKLKKKVLEGCNFVFSGLIPLGTNIQKADIVLWTNMFGAQSSADITEDTTHVITKTPH 537
           L+  L+ K+      + S    LG   Q+  I       G  S+ ++++  THV++  P+
Sbjct: 332 LLSPLRPKIFHKNELLLSYTNYLGQ--QRFYIQKLVEALGGASTTELSKKNTHVLSCMPY 389

Query: 538 TYKAKIAKAFKSDIKVLHPDWVFECLLNWKYMPEFPYEYNIIP 580
             K + A  +    KV++  W+ EC    K +      Y  IP
Sbjct: 390 GQKYQAAVRWSDTCKVVNHLWLEECYKFAKKLDTDTTRYREIP 432

>Smik_9.210 Chr9 (351328..353025) [1698 bp, 565 aa] {ON} YIR010W
           (REAL)
          Length = 565

 Score = 32.7 bits (73), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 22/53 (41%), Positives = 32/53 (60%), Gaps = 1/53 (1%)

Query: 355 HKKTEDTDELLTDIMDTEKKLQEKIDEEVKRQEENLSHQSAALGEEISSQVRK 407
           H+   DT+E    I D E+KLQ K+D E++ Q   L+  S+AL E  +S+V K
Sbjct: 474 HEIISDTEESDIVIADMEEKLQTKVD-ELRYQSHMLNSHSSALNEITASKVNK 525

>KLTH0H08954g Chr8 complement(770614..772521) [1908 bp, 635 aa] {ON}
           some similarities with uniprot|Q12114 Saccharomyces
           cerevisiae YLR330W CHS5 Protein of unknown function
           involved in chitin biosynthesis by regulating Chs3p
           localization also involved in cell fusion during mating
          Length = 635

 Score = 32.7 bits (73), Expect = 4.4,   Method: Compositional matrix adjust.
 Identities = 14/46 (30%), Positives = 26/46 (56%)

Query: 524 ITEDTTHVITKTPHTYKAKIAKAFKSDIKVLHPDWVFECLLNWKYM 569
           +T DTTH I+    +   +  KA +S++ ++ P+WV  C L  + +
Sbjct: 208 VTIDTTHFISNDKDSDDDEFHKAQQSNVPIVRPEWVRACELERRIV 253

>KNAG0E04150 Chr5 complement(823063..826473) [3411 bp, 1136 aa] {ON}
           
          Length = 1136

 Score = 32.3 bits (72), Expect = 5.5,   Method: Compositional matrix adjust.
 Identities = 19/43 (44%), Positives = 24/43 (55%), Gaps = 1/43 (2%)

Query: 202 VKSFVLEEEPILPPMYMGPKPPTHKCWYYVKIRPGL-KEFFEE 243
           ++SF+ E E ILPP  +  K  TH C Y     P L +E FEE
Sbjct: 301 LQSFIQEFETILPPFEVIQKYKTHFCEYIFPNLPFLQREMFEE 343

>NCAS0F00930 Chr6 (187211..188479) [1269 bp, 422 aa] {ON} Anc_2.530
           YHR004C
          Length = 422

 Score = 32.0 bits (71), Expect = 5.6,   Method: Compositional matrix adjust.
 Identities = 14/36 (38%), Positives = 21/36 (58%)

Query: 229 YYVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEI 264
           YYV  RP    F  +VSK Y++ I+T + + YA  +
Sbjct: 268 YYVHKRPYCDFFLSKVSKWYDLIIFTASMKEYADPV 303

>ADL145C Chr4 complement(435983..438610) [2628 bp, 875 aa] {ON}
           Syntenic homolog of Saccharomyces cerevisiae YHR154W
           (ESC4)
          Length = 875

 Score = 32.0 bits (71), Expect = 6.4,   Method: Compositional matrix adjust.
 Identities = 24/77 (31%), Positives = 38/77 (49%), Gaps = 3/77 (3%)

Query: 505 QKADIVLWTNMFGAQSSADITEDTTHVITKTPHTYKAKIAKAFKSDIKVLHPDWVFECL- 563
           Q+  I    ++ G  S+ +++   TH+I+  PH  K + A  + S I V H  W+ +C  
Sbjct: 354 QRYYIQRLVDLLGGSSTTELSRKNTHLISLFPHGKKHETALKWNSCIVVNHL-WLEQCYK 412

Query: 564 LNWKYMPEFPYEYNIIP 580
           L  K  P  P E+  IP
Sbjct: 413 LRKKLDPNAP-EFTRIP 428

>KLLA0E23101g Chr5 complement(2059506..2060948) [1443 bp, 480 aa]
           {ON} similar to uniprot|Q02776 Saccharomyces cerevisiae
           YPL063W TIM50 Protein of the inner mitochondrial
           membrane required for import of mitochondrial matrix
           proteins
          Length = 480

 Score = 32.0 bits (71), Expect = 6.8,   Method: Compositional matrix adjust.
 Identities = 14/47 (29%), Positives = 27/47 (57%)

Query: 224 THKCWYYVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDP 270
           T +  +    RPG+  F   +S+ YE+ +++     YA++IA+ +DP
Sbjct: 211 TQQSGWRTAKRPGVDYFLGYLSQYYEIVLFSSNYMMYAEKIAEKLDP 257

>YPL063W Chr16 (429939..431369) [1431 bp, 476 aa] {ON}
           TIM50Essential component of the Translocase of the Inner
           Mitochondrial membrane (TIM23 complex); acts as receptor
           for the TIM23 complex guiding incoming precursors from
           the TOM complex; may control the gating of the
           Tim23p-Tim17p channel
          Length = 476

 Score = 32.0 bits (71), Expect = 7.1,   Method: Compositional matrix adjust.
 Identities = 27/100 (27%), Positives = 49/100 (49%), Gaps = 10/100 (10%)

Query: 234 RPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDP-----DGTLFADRILSRNENGSL 288
           RPG   F   +S+ YE+ +++     Y+ +IA+ +DP        LF +  + ++    +
Sbjct: 218 RPGADYFLGYLSQYYEIVLFSSNYMMYSDKIAEKLDPIHAFVSYNLFKEHCVYKD---GV 274

Query: 289 THKSLERLFPTDQSMVVVIDDRGDVWNWCP-NLIKVTPYN 327
             K L +L   D S V++ID   + +   P N I + P+N
Sbjct: 275 HIKDLSKL-NRDLSKVIIIDTDPNSYKLQPENAIPMEPWN 313

>Skud_16.218 Chr16 (401347..402789) [1443 bp, 480 aa] {ON} YPL063W
           (REAL)
          Length = 480

 Score = 31.6 bits (70), Expect = 7.6,   Method: Compositional matrix adjust.
 Identities = 27/110 (24%), Positives = 53/110 (48%), Gaps = 10/110 (9%)

Query: 224 THKCWYYVKIRPGLKEFFEEVSKLYEMHIYTMATRSYAQEIAKIIDP-----DGTLFADR 278
           + K  +    RPG + F   +S+ YE+ +++     Y+++ A+ +DP        LF + 
Sbjct: 211 SQKYGWRTAKRPGAEYFLGYLSQYYEIVLFSSNYMMYSEKTAEKLDPIHAFVSYNLFKEH 270

Query: 279 ILSRNENGSLTHKSLERLFPTDQSMVVVIDDRGDVWNWCP-NLIKVTPYN 327
            + ++    +  K L +L   D S V++ID   + +   P N I + P+N
Sbjct: 271 CVYKD---GVHIKDLSKL-KRDLSKVIIIDTDPNSYKLQPENAIPMDPWN 316

>Smik_4.700 Chr4 (1240828..1242705) [1878 bp, 625 aa] {ON} YDR425W
           (REAL)
          Length = 625

 Score = 31.6 bits (70), Expect = 7.9,   Method: Compositional matrix adjust.
 Identities = 19/52 (36%), Positives = 23/52 (44%), Gaps = 10/52 (19%)

Query: 522 ADITEDTTHVITKTPHTYK------AKIAKAFKSDIKVLHPDWVFECLLNWK 567
           +D+ E  T       H YK      AKI K F +  K     W+ ECL NWK
Sbjct: 568 SDMVEINTSSYNSLMHAYKHIHLTIAKILKLFTTSFKA----WIKECLKNWK 615

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.314    0.133    0.391 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 77,797,072
Number of extensions: 3449501
Number of successful extensions: 13766
Number of sequences better than 10.0: 396
Number of HSP's gapped: 14296
Number of HSP's successfully gapped: 427
Length of query: 745
Length of database: 53,481,399
Length adjustment: 117
Effective length of query: 628
Effective length of database: 40,065,477
Effective search space: 25161119556
Effective search space used: 25161119556
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 42 (22.0 bits)
S2: 70 (31.6 bits)