Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1068.88.840ON63263234040.0
YMR278W (PGM3)8.840ON62262521110.0
Suva_13.4668.840ON62262520910.0
Smik_13.4918.840ON62262120650.0
NCAS0C004108.840ON62562320630.0
Skud_13.4508.840ON62262120390.0
TDEL0B005708.840ON63062820310.0
TPHA0I002508.840ON62963320310.0
NDAI0K004108.840ON62662220190.0
SAKL0D01474g8.840ON62462419740.0
KNAG0J002708.840ON62562319730.0
TBLA0B032508.840ON64364919050.0
CAGL0M02981g8.840ON61762119010.0
ZYRO0G14190g8.840ON61062118930.0
KAFR0B039208.840ON62463218160.0
Ecym_46118.840ON63062918040.0
Kwal_27.102588.840ON62063017970.0
ABL126W8.840ON62462917450.0
KLLA0D01573g8.840ON60762917360.0
KLTH0C03872g8.840ON62162417170.0
TDEL0A022102.445ON5726011127e-05
ZYRO0G02508g2.445ON5695901030.001
TDEL0E00210singletonON5706051020.001
Kpol_1018.1612.445ON569457980.003
NCAS0F002006.11ON54931960.006
TBLA0G009806.11ON55830960.006
TDEL0G046006.11ON52864950.008
CAGL0B03597g6.11ON54030950.008
ABL029W2.445ON568418940.010
Kpol_1032.26.11ON53930940.010
TBLA0I013802.445ON571431940.010
Kwal_26.76282.445ON570451930.013
KNAG0E023902.445ON569457920.017
KAFR0L003406.11ON54031910.020
Smik_5.296.11ON55531900.033
YEL058W (PCM1)6.11ON55731900.034
Skud_5.316.11ON55731890.035
KNAG0E009406.11ON53822890.035
Suva_5.106.11ON55331890.035
NDAI0K028906.11ON56130890.037
Smik_13.2912.445ON569307880.049
ZYRO0F00506g6.11ON55027860.079
Kwal_56.223556.11ON54127860.079
KLTH0C11506g6.11ON54422860.082
ACR015W6.11ON55227860.091
SAKL0E00902g6.11ON54458860.098
TPHA0M002106.11ON54530830.21
KLLA0D00858g6.11ON54119820.26
KAFR0D030102.445ON569573820.30
NCAS0F014702.445ON569370810.33
KLTH0D04796g2.445ON570445810.40
NDAI0H023502.445ON569369800.49
Ecym_30146.11ON55122790.61
SAKL0E03630g2.445ON571450790.67
Kpol_1033.542.445ON570128780.88
CAGL0K03421g2.445ON568377761.2
TPHA0E019705.393ON679144761.6
TPHA0G029002.445ON569416742.5
YMR105C (PGM2)2.445ON569307742.6
Skud_13.2632.445ON569312723.8
KLLA0F10527g6.147ON42656698.4
NCAS0H017205.363ON1053123708.9
CAGL0K07480g2.445ON567134699.1
KNAG0A062802.445ON570617699.8
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1068.8
         (632 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON...  1315   0.0  
YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}  PGM3Phosp...   817   0.0  
Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278...   810   0.0  
Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278...   800   0.0  
NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}...   799   0.0  
Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278...   790   0.0  
TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {O...   786   0.0  
TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840...   786   0.0  
NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON...   782   0.0  
SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {...   764   0.0  
KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON...   764   0.0  
TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.8...   738   0.0  
CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} simil...   736   0.0  
ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} simi...   733   0.0  
KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.8...   704   0.0  
Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar...   699   0.0  
Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {...   696   0.0  
ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic ho...   676   0.0  
KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {...   673   0.0  
KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {...   665   0.0  
TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.4...    48   7e-05
ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly...    44   0.001
TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445...    44   0.001
Kpol_1018.161 s1018 (412372..414081) [1710 bp, 569 aa] {ON} (412...    42   0.003
NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}...    42   0.006
TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {O...    42   0.006
TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.1...    41   0.008
CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {...    41   0.008
ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic ho...    41   0.010
Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON} ...    41   0.010
TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {O...    41   0.010
Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C...    40   0.013
KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.4...    40   0.017
KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON...    40   0.020
Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)    39   0.033
YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essentia...    39   0.034
Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)    39   0.035
KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.1...    39   0.035
Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)    39   0.035
NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6....    39   0.037
Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {...    39   0.049
ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON...    38   0.079
Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON...    38   0.079
KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} simila...    38   0.082
ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic ho...    38   0.091
SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON...    38   0.098
TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON...    37   0.21 
KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON...    36   0.26 
KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.4...    36   0.30 
NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {O...    36   0.33 
KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly...    36   0.40 
NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {O...    35   0.49 
Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON} s...    35   0.61 
SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {...    35   0.67 
Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON} (1362...    35   0.88 
CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa] ...    34   1.2  
TPHA0E01970 Chr5 (406803..408842) [2040 bp, 679 aa] {ON} Anc_5.3...    34   1.6  
TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON}               33   2.5  
YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON} ...    33   2.6  
Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {...    32   3.8  
KLLA0F10527g Chr6 (969804..971084) [1281 bp, 426 aa] {ON} simila...    31   8.4  
NCAS0H01720 Chr8 complement(326096..329251,329324..329329) [3162...    32   8.9  
CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa] ...    31   9.1  
KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON}               31   9.8  

>Kpol_1068.8 s1068 complement(13542..15440) [1899 bp, 632 aa] {ON}
           complement(13542..15440) [1899 nt, 633 aa]
          Length = 632

 Score = 1315 bits (3404), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 632/632 (100%), Positives = 632/632 (100%)

Query: 1   MVSSNSEFDSVLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRIL 60
           MVSSNSEFDSVLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRIL
Sbjct: 1   MVSSNSEFDSVLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRIL 60

Query: 61  FGTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIA 120
           FGTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIA
Sbjct: 61  FGTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIA 120

Query: 121 TSVFLSAGFTVYNLNPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNG 180
           TSVFLSAGFTVYNLNPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNG
Sbjct: 121 TSVFLSAGFTVYNLNPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNG 180

Query: 181 CQIIPPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNI 240
           CQIIPPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNI
Sbjct: 181 CQIIPPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNI 240

Query: 241 IDKKTIREFDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFP 300
           IDKKTIREFDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFP
Sbjct: 241 IDKKTIREFDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFP 300

Query: 301 TISFPNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGF 360
           TISFPNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGF
Sbjct: 301 TISFPNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGF 360

Query: 361 LFGYYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKA 420
           LFGYYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKA
Sbjct: 361 LFGYYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKA 420

Query: 421 IDLKKEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQG 480
           IDLKKEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQG
Sbjct: 421 IDLKKEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQG 480

Query: 481 IEKYGAFKEYNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGF 540
           IEKYGAFKEYNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGF
Sbjct: 481 IEKYGAFKEYNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGF 540

Query: 541 QSDTVDNIPSLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSK 600
           QSDTVDNIPSLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSK
Sbjct: 541 QSDTVDNIPSLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSK 600

Query: 601 DPIAASKIAKLTWDVLKKEWIRPEVTGVTTSY 632
           DPIAASKIAKLTWDVLKKEWIRPEVTGVTTSY
Sbjct: 601 DPIAASKIAKLTWDVLKKEWIRPEVTGVTTSY 632

>YMR278W Chr13 (822763..824631) [1869 bp, 622 aa] {ON}
           PGM3Phosphoglucomutase, catalyzes interconversion of
           glucose-1-phosphate and glucose-6-phospate;
           transcription induced in response to stress; green
           fluorescent protein (GFP)-fusion protein localizes to
           the cytoplasm and nucleus; non-essential
          Length = 622

 Score =  817 bits (2111), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 382/625 (61%), Positives = 480/625 (76%), Gaps = 4/625 (0%)

Query: 8   FDSVLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLR 67
              +LET+P DL+D +  W  QD+NP+TI EV  LCK +  NELHKRFD+RI FGTAGLR
Sbjct: 2   LQGILETVPSDLKDPISLWFKQDRNPKTIEEVTALCKKSDWNELHKRFDSRIQFGTAGLR 61

Query: 68  SKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSA 127
           S+M+AGFSRMNTLVV+QA+QGLATY++QQFP NL AV+GHDHR+HSKEFA    + FL  
Sbjct: 62  SQMQAGFSRMNTLVVIQASQGLATYVRQQFPDNLVAVVGHDHRFHSKEFARATAAAFLLK 121

Query: 128 GFTVYNLNPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPV 187
           GF V+ LNP   FVHTPLVPF VD++ ASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 
Sbjct: 122 GFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPH 181

Query: 188 DASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKKTIR 247
           D +I+  ID NLEPW+N WD    +   L   KL+Y R EML  Y ++V  N+++   ++
Sbjct: 182 DHAISDSIDANLEPWANVWDFDDVLNKALKQGKLMYSREEMLKLYLEEVSKNLVEINPLK 241

Query: 248 EFDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNP 307
             +   KPWFVYTPMHGVG++IF+++V + + L E +DYL V EQ  PDP+FPT+ FPNP
Sbjct: 242 -LEVKAKPWFVYTPMHGVGFDIFSTIVKKTLCLVEGKDYLCVPEQQNPDPSFPTVGFPNP 300

Query: 308 EEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLF 367
           EEKGALD+ I LA+++DI L++ANDPDADRFS A+ +  SGEW+QLTGNEIGFLF +Y +
Sbjct: 301 EEKGALDIGINLAEKHDIDLLVANDPDADRFSVAVKDMQSGEWRQLTGNEIGFLFAFYEY 360

Query: 368 NKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEG 427
            KY +MD EF+  HPLAMLNSTVSS+M+K MA+ E F + DTLTGFKWIGN+AI L+K+G
Sbjct: 361 QKYKSMDKEFQHVHPLAMLNSTVSSQMIKKMAEIEGFHYEDTLTGFKWIGNRAILLEKKG 420

Query: 428 YHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKYGAF 487
           Y+V FG+EEAIGYMFPAMEHDKDGI+AS+VFLQAY +W     +  +++LE G +KYG F
Sbjct: 421 YYVPFGFEEAIGYMFPAMEHDKDGISASIVFLQAYCKWKIDHNLDPLNVLENGFKKYGVF 480

Query: 488 KEYNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDN 547
           KEYNGYYVV NP VT DIF YIRN Y   G  YP  IG  +EV  +RDLTTG+QSDT+++
Sbjct: 481 KEYNGYYVVPNPTVTKDIFDYIRNVYTPEGASYPSSIGEEIEVLYYRDLTTGYQSDTINH 540

Query: 548 IPSLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASK 607
            P+LPVDP+SQMIT++A+  +      +  +RFT+RGSGTEPKLK+YIE  + +   AS 
Sbjct: 541 KPTLPVDPTSQMITVSARPSNGS---ENEHIRFTIRGSGTEPKLKVYIEACANEEQRASF 597

Query: 608 IAKLTWDVLKKEWIRPEVTGVTTSY 632
           +AKLTW+VL++EW RP+   + T +
Sbjct: 598 LAKLTWNVLRREWFRPDEMNIVTKF 622

>Suva_13.466 Chr13 (805414..807282) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  810 bits (2091), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 384/625 (61%), Positives = 476/625 (76%), Gaps = 4/625 (0%)

Query: 8   FDSVLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLR 67
           +  +LET+P DL+  +  W  QD+NPETI EV  LCK +  +ELHKRFD RI FGTAGLR
Sbjct: 2   YQQLLETVPSDLKGPISLWFDQDRNPETIEEVTTLCKNSDWDELHKRFDTRIQFGTAGLR 61

Query: 68  SKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSA 127
           S+M+AGFSRMNTLV++QATQGLATYIKQQFP NL  V+GHDHR+HSKEFA    + FL  
Sbjct: 62  SEMQAGFSRMNTLVIIQATQGLATYIKQQFPDNLVVVVGHDHRFHSKEFARATATAFLLK 121

Query: 128 GFTVYNLNPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPV 187
           GF V+ LNP   FVHTPLVPF VD++ ASVGVMITASHNPKMDNGYKVYYSNGCQIIPP 
Sbjct: 122 GFKVHYLNPDHEFVHTPLVPFAVDKLKASVGVMITASHNPKMDNGYKVYYSNGCQIIPPH 181

Query: 188 DASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKKTIR 247
           D +I+  ID NLEPW+N W  S  +   L   KL+Y R EML  YS +V   +++   ++
Sbjct: 182 DHAISDSIDMNLEPWANVWKFSDVLNKALKQGKLMYSREEMLNLYSKEVSKTLVETNPLK 241

Query: 248 EFDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNP 307
             +   KPWFVYTPMHGVG+ IF+++V + ++L E  DYL V EQ  PDP+FPT+ FPNP
Sbjct: 242 -LEIKAKPWFVYTPMHGVGFNIFSTIVKKTMSLVEGEDYLCVPEQQNPDPSFPTVGFPNP 300

Query: 308 EEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLF 367
           EEKGALD+ + LA+E+DI+L++ANDPDADRFS A+ ++ S +W+QLTGNEIGFLF ++ F
Sbjct: 301 EEKGALDIGMRLAEEHDINLLVANDPDADRFSIAVKDTQSSKWRQLTGNEIGFLFAFFEF 360

Query: 368 NKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEG 427
            +Y N D EF+++HPLAML+STVSS+M+K MA+ E F + DTLTGFKWIGN+AI L+KEG
Sbjct: 361 QRYKNKDEEFQRSHPLAMLSSTVSSQMIKKMAEVEGFLYEDTLTGFKWIGNRAIILEKEG 420

Query: 428 YHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKYGAF 487
           Y+V FG+EEAIGYMFPAMEHDKDGI+A+VV LQAY +W   S +  IDILE G +KYG F
Sbjct: 421 YYVPFGFEEAIGYMFPAMEHDKDGISAAVVLLQAYCKWKIDSNLDPIDILENGFQKYGVF 480

Query: 488 KEYNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDN 547
           KEYNGYYVV +P VT +IF YIRN Y   G  YP  IG  +EV  +RDLTTG+QSDT D+
Sbjct: 481 KEYNGYYVVPSPLVTTEIFEYIRNVYTPTGVPYPPSIGEEIEVVYYRDLTTGYQSDTPDH 540

Query: 548 IPSLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASK 607
            P LPVDP+SQMIT++ K  D      +  +RFT+RGSGTEPKLK+YIE  + +   AS 
Sbjct: 541 KPVLPVDPTSQMITLSGKPSDG---NGNEHIRFTIRGSGTEPKLKVYIEACADNEKRASY 597

Query: 608 IAKLTWDVLKKEWIRPEVTGVTTSY 632
           +AKLTWDVL++ W RPE+  +TT +
Sbjct: 598 LAKLTWDVLRRGWFRPEIMNITTDF 622

>Smik_13.491 Chr13 (805767..807635) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  800 bits (2065), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 375/621 (60%), Positives = 478/621 (76%), Gaps = 4/621 (0%)

Query: 12  LETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSKME 71
           LE +P +L++ +  W  QD+NPETI EV  LCK +  NELH+RFD+RI FGTAGLRS+M+
Sbjct: 6   LEAVPSNLKEAISLWFEQDQNPETIEEVTALCKKSDWNELHRRFDSRIQFGTAGLRSQMQ 65

Query: 72  AGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGFTV 131
           AGF+RMNTLV++QA+QGLATY KQQFP+NL AV+GHDHR+HSKEFA    + FL  GF V
Sbjct: 66  AGFNRMNTLVIIQASQGLATYAKQQFPNNLVAVVGHDHRFHSKEFARATATAFLLKGFKV 125

Query: 132 YNLNPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPVDASI 191
           + LNP   FVHTPLVPF VD++ ASVGVM+TASHNPKMDNGYKVYYSNGCQIIPP D +I
Sbjct: 126 HYLNPDHEFVHTPLVPFAVDKLKASVGVMVTASHNPKMDNGYKVYYSNGCQIIPPHDHAI 185

Query: 192 AKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKKTIREFDE 251
           +  ID NLEPW+N W+    +  GL   KL+Y R E+L  Y  +V  N++    ++ F+ 
Sbjct: 186 SDSIDMNLEPWANVWNFDDVLNKGLKQGKLMYSREEILKLYLGEVSKNLVGTDPLK-FEV 244

Query: 252 HRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPEEKG 311
             KPWFVYTPMHGVG++IF+++V + ++L E +DYL V EQ  PDP+FPT++FPNPEEKG
Sbjct: 245 KAKPWFVYTPMHGVGFDIFSTIVKKTMSLVEGKDYLCVPEQQEPDPSFPTVAFPNPEEKG 304

Query: 312 ALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLFNKYT 371
           ALD+ I LA+ + I+L+IANDPDADRFS AI +  SGEW+QLTGNEIGFLF  + F K+ 
Sbjct: 305 ALDLGINLAENHGINLLIANDPDADRFSVAIKDIRSGEWRQLTGNEIGFLFAIFEFQKFK 364

Query: 372 NMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEGYHVV 431
           +M+ +F+  HPLAML+STVSS+M+K MA+ E F + +TLTGFKWIGN+AI L+KEGY+V 
Sbjct: 365 SMEKQFQHAHPLAMLSSTVSSQMIKKMAEVEGFHYEETLTGFKWIGNRAILLEKEGYYVP 424

Query: 432 FGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKYGAFKEYN 491
           FG+EEAIGYMFPAMEHDKDG++AS+VFLQAY +W     +  I ILE G +KYG FKEYN
Sbjct: 425 FGFEEAIGYMFPAMEHDKDGLSASIVFLQAYCQWKIDHNLDPISILEDGFKKYGVFKEYN 484

Query: 492 GYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNIPSL 551
           GYY+VS+P VTN+IF YIRN Y   G  YP  IG  +EV ++RDLT G+QSDT ++ P+L
Sbjct: 485 GYYIVSSPIVTNEIFDYIRNAYTPKGVSYPSSIGKEIEVLNYRDLTIGYQSDTSNHKPTL 544

Query: 552 PVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASKIAKL 611
           P+DPSSQMIT++AK  D    +    +RFT+RGSGTEPK+K+YIE  + +   A+ +AKL
Sbjct: 545 PIDPSSQMITVSAKPSDGNEGEH---IRFTIRGSGTEPKIKVYIEACADEEQRATFLAKL 601

Query: 612 TWDVLKKEWIRPEVTGVTTSY 632
           TW+VLK+EW RPE   + T +
Sbjct: 602 TWNVLKREWFRPEKMDIVTHF 622

>NCAS0C00410 Chr3 complement(62893..64770) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  799 bits (2063), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 377/623 (60%), Positives = 470/623 (75%), Gaps = 3/623 (0%)

Query: 10  SVLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSK 69
           S L   P +LR+ +  WL  D+N ET  EV++LC+  +  ELH+RFD RI+FGTAGLRS+
Sbjct: 6   SSLSNCPENLREPINLWLRLDQNEETRKEVLQLCENKNWPELHQRFDTRIVFGTAGLRSR 65

Query: 70  MEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGF 129
           MEAGFSRMN+L++LQ+TQGLA YIK+QFP+NL AV+GHDHR+HSKEFA +  S+FL AGF
Sbjct: 66  MEAGFSRMNSLIILQSTQGLANYIKEQFPNNLTAVVGHDHRFHSKEFAIVTASIFLRAGF 125

Query: 130 TVYNLNPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPVDA 189
            V+ L P   FVHTPLVPF+V  + ASVGVMITASHNPKMDNGYKVYY N CQIIPP D 
Sbjct: 126 KVFYLTPDDQFVHTPLVPFSVLNLKASVGVMITASHNPKMDNGYKVYYDNACQIIPPHDK 185

Query: 190 SIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKKTIREF 249
           +IA+ I +NLEPWS SWD     + GL   KL+++++ M   Y  ++   +I    +   
Sbjct: 186 NIAEMIQKNLEPWSTSWDWDATFKKGLETNKLVFIKDLMTEKYLMQMKRVLIHSSHL-SL 244

Query: 250 DEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPEE 309
            + + P+FVYTPMHGVG EIF  +  E +NL EN DYL V EQ +PDP+FPT+SFPNPEE
Sbjct: 245 KDVKTPFFVYTPMHGVGAEIFAKVSSELLNLHENVDYLVVSEQRLPDPSFPTVSFPNPEE 304

Query: 310 KGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLFNK 369
           KGAL +AI LA+EN +SLVIANDPDADRFSAA+ N  +G+W+QLTGNEIGFL GYY F  
Sbjct: 305 KGALSLAIKLAQENGLSLVIANDPDADRFSAAVLNKKTGKWRQLTGNEIGFLLGYYEFQL 364

Query: 370 YTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEGYH 429
           Y   D  F+K HPLAM+NSTVSS+M+K MAD   F + DTLTGFKWIGNKAIDL++EGY+
Sbjct: 365 YEQQDVAFRKTHPLAMINSTVSSQMIKRMADMNGFHYEDTLTGFKWIGNKAIDLRQEGYY 424

Query: 430 VVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKYGAFKE 489
           V FG+EEAIGYMFP ME DKDGI+A+ VFLQAY  W N  +++  DI+E+G  K+G FKE
Sbjct: 425 VPFGFEEAIGYMFPDMECDKDGISAATVFLQAYCHWMNQYQMSPFDIMEEGFGKFGVFKE 484

Query: 490 YNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNIP 549
           YNGYY++ +  +T  +F +IR+EYP    +YP  IG  L V  FRDLT G+QS+T DNIP
Sbjct: 485 YNGYYILKDLSITKTVFDFIRHEYPSTNKKYPSEIGNELIVTVFRDLTVGYQSNTKDNIP 544

Query: 550 SLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASKIA 609
           +LPVDP+SQMIT+ AK    E+   +  VR TMRGSGTEPKLK+YIE  SK   +A+ +A
Sbjct: 545 NLPVDPTSQMITVEAK--PSEFSNLEGTVRLTMRGSGTEPKLKVYIEACSKSEESATNLA 602

Query: 610 KLTWDVLKKEWIRPEVTGVTTSY 632
           + TWD+LK+EW RPEVTG+TTS+
Sbjct: 603 RSTWDILKREWFRPEVTGLTTSF 625

>Skud_13.450 Chr13 (796030..797898) [1869 bp, 622 aa] {ON} YMR278W
           (REAL)
          Length = 622

 Score =  790 bits (2039), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 378/621 (60%), Positives = 480/621 (77%), Gaps = 4/621 (0%)

Query: 12  LETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSKME 71
           L T+P DL+  +  W  QD++PETI EV  LCK +  +ELHKRFD RI FGTAGLRS+M+
Sbjct: 6   LGTIPSDLKGPISLWFDQDRDPETIEEVTALCKKSDWDELHKRFDTRIQFGTAGLRSQMQ 65

Query: 72  AGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGFTV 131
           AGFSRMN LV++QA+QGLATYI+QQFP+NL AV+GHDHR+HSK+FA    + FL  GF V
Sbjct: 66  AGFSRMNNLVIIQASQGLATYIRQQFPNNLVAVVGHDHRFHSKKFARATATAFLLKGFKV 125

Query: 132 YNLNPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPVDASI 191
           + LNP   FVHTPLVPF VD++ ASVGVMITASHNPKMDNGYKVYYSNGCQIIPP D +I
Sbjct: 126 HYLNPGQEFVHTPLVPFAVDELNASVGVMITASHNPKMDNGYKVYYSNGCQIIPPHDQAI 185

Query: 192 AKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKKTIREFDE 251
           +  ID NLEPW+N+W+    +   L   KL+Y R EML  Y +K+ +N+++   ++  + 
Sbjct: 186 SNAIDMNLEPWANAWNFDDILSKNLKQGKLMYSREEMLKLYLEKISDNLVETTPLK-LEV 244

Query: 252 HRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPEEKG 311
             KPWFVYTPMHGVG++IF+++V + + L E +DYL V EQ  PDP+FPT+ FPNPEEKG
Sbjct: 245 RSKPWFVYTPMHGVGFDIFSTIVKKSMCLVEGKDYLCVPEQQNPDPSFPTVGFPNPEEKG 304

Query: 312 ALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLFNKYT 371
           AL++ + LA+++DISL+IANDPDADRFS AI +  SG WQQLTGNEIGFLF ++ F K+ 
Sbjct: 305 ALNIGMRLAEKHDISLLIANDPDADRFSVAIKDMQSGMWQQLTGNEIGFLFAFFEFEKFK 364

Query: 372 NMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEGYHVV 431
           +MD +F++ HPLAML+STVSS+M+K MA+ E F + DTLTGFKWIGN+AI L+KEGY+V 
Sbjct: 365 SMDEQFQQTHPLAMLSSTVSSQMIKRMAEVEGFHYEDTLTGFKWIGNRAIILEKEGYYVP 424

Query: 432 FGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKYGAFKEYN 491
           FG+EEAIGYMFPAMEHDKDGI+ASVVFLQAY +W   + +  I++LE G +KYG FKEYN
Sbjct: 425 FGFEEAIGYMFPAMEHDKDGISASVVFLQAYCKWKLANNLDPINVLENGFKKYGVFKEYN 484

Query: 492 GYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNIPSL 551
           GYY+V NP VT +IF YIR+ Y      YP  IG  + V  +RDLTTG+QSDT+D+ P+L
Sbjct: 485 GYYIVPNPIVTKEIFKYIRDVYTPRNVPYPPYIGEEIRVLCYRDLTTGYQSDTLDHKPTL 544

Query: 552 PVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASKIAKL 611
           PVDP+SQMIT+ A+  D      +  +RFT+RGSGTEPKLK+YIE  + +   AS +AKL
Sbjct: 545 PVDPTSQMITVFARPND---SNGNEHIRFTIRGSGTEPKLKVYIETRANEERRASFLAKL 601

Query: 612 TWDVLKKEWIRPEVTGVTTSY 632
           TWDVL++EW RPE T +TT++
Sbjct: 602 TWDVLRREWFRPEKTNITTNF 622

>TDEL0B00570 Chr2 complement(109270..111162) [1893 bp, 630 aa] {ON}
           Anc_8.840 YMR278W
          Length = 630

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 376/628 (59%), Positives = 476/628 (75%), Gaps = 4/628 (0%)

Query: 5   NSEFDSVLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTA 64
            S+   V+ ++P DL   V +WL+QD N +T  E++ LCKA    ELHKR D RILFGTA
Sbjct: 7   QSDEKEVINSVPTDLSQLVASWLSQDGNKQTRLEILNLCKAKDWLELHKRLDTRILFGTA 66

Query: 65  GLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVF 124
           GLRS+MEAGFSRMNTLVVLQATQGLA +IK+QFP  L AV+GHDHR++S+EFA    + F
Sbjct: 67  GLRSRMEAGFSRMNTLVVLQATQGLAQHIKKQFPDALTAVVGHDHRFNSQEFALATVATF 126

Query: 125 LSAGFTVYNLNPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQII 184
           L AGF V  LN    FVHTP+VPFTV+++GASVGVMITASHNPKMDNGYKVYYSNGCQII
Sbjct: 127 LQAGFKVIFLNDGDKFVHTPIVPFTVNEVGASVGVMITASHNPKMDNGYKVYYSNGCQII 186

Query: 185 PPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKK 244
           PP D+ IA+ I+ENL  W  +W   + ++ GL  K L+Y   EM+  Y+ K+  +++D+ 
Sbjct: 187 PPHDSEIAQSIEENLTLWPKAWKWDELLKEGLDTKCLVYAGEEMIERYTKKMGQSLVDRT 246

Query: 245 TIREFDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISF 304
           TI   ++  KPWFVYTP+HGVGY+IF  +  E +NL   RDYL VKEQ +PDP+FPT+ F
Sbjct: 247 TISA-EKEGKPWFVYTPIHGVGYDIFRQIAEETMNLINGRDYLCVKEQQLPDPSFPTVPF 305

Query: 305 PNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGY 364
           PNPEEKGALDMAI++A +N ISLV+ANDPDADRFSAA+ ++ +G W+QLTGNEIG LF +
Sbjct: 306 PNPEEKGALDMAISVADKNGISLVLANDPDADRFSAAVKDNKTGTWRQLTGNEIGALFAF 365

Query: 365 YLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLK 424
           Y F KY   + E+K+ HPLAMLNSTVSS+++  MA+ E F +IDTLTGFKWIGN+ +DL+
Sbjct: 366 YEFQKYQKKNEEYKEKHPLAMLNSTVSSQLIMKMAEIEQFHYIDTLTGFKWIGNRTLDLE 425

Query: 425 KEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKY 484
              Y+V FG+EEAIGYMFP MEHDKDGI+A+ VFLQ Y +W   SK T++ +LE   EKY
Sbjct: 426 AMNYYVPFGFEEAIGYMFPVMEHDKDGISAASVFLQMYRKWLVGSKKTLLTVLEDIFEKY 485

Query: 485 GAFKEYNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDT 544
           G FKEYNGYY V++P+V  ++F +IRN+Y +  + YP  IG  L+V  FRDLT G+QSDT
Sbjct: 486 GVFKEYNGYYSVNDPKVIKEVFDFIRNDYSETHDPYPSRIGEELKVNKFRDLTLGYQSDT 545

Query: 545 VDNIPSLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIA 604
           V+  P LPVDP+SQMIT   K+   +  +S   VRFT+RGSGTEPKLK+YIE  SK    
Sbjct: 546 VNQRPDLPVDPNSQMITAWTKVNGAKPYES---VRFTIRGSGTEPKLKVYIEACSKSEER 602

Query: 605 ASKIAKLTWDVLKKEWIRPEVTGVTTSY 632
           AS++A+LTW VLK+EW RP+VTG+TT++
Sbjct: 603 ASELAQLTWRVLKREWFRPDVTGLTTTF 630

>TPHA0I00250 Chr9 (46554..48443) [1890 bp, 629 aa] {ON} Anc_8.840
           YMR278W
          Length = 629

 Score =  786 bits (2031), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 381/633 (60%), Positives = 488/633 (77%), Gaps = 5/633 (0%)

Query: 1   MVSSNSEFDSVLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRIL 60
           M  S+ E +++L ++P DL++K+  W   D N ET++EV  LC   SL+ELHKRFD RI+
Sbjct: 1   MTLSDQEIENLLSSIPEDLKEKIRVWFRYDDNQETVDEVKELCVNKSLDELHKRFDQRIV 60

Query: 61  FGTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIA 120
           FGTAGLRS+MEAGF+RMN L VLQ+TQGLA+YIK QFPSNL AV+GHDHRYHSKEFA+I 
Sbjct: 61  FGTAGLRSRMEAGFNRMNALTVLQSTQGLASYIKSQFPSNLTAVVGHDHRYHSKEFAQIT 120

Query: 121 TSVFLSAGFTVYNLNPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNG 180
            +VFL+AGF VY LNP   FVHTP+VPF ++   AS+GVMITASHNP+MDNGYKVYY+NG
Sbjct: 121 AAVFLNAGFKVYYLNPNDEFVHTPMVPFGINLYSASIGVMITASHNPEMDNGYKVYYNNG 180

Query: 181 CQIIPPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNI 240
           CQIIPP D +IA+CI++NLEP S++W++   I   + N KLIY + ++L  Y   +D  I
Sbjct: 181 CQIIPPHDKNIAECIEKNLEPLSDNWNTEAVISKAIENVKLIYSKEDVLQQYMLNLDKYI 240

Query: 241 IDKK-TIREFDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAF 299
           I K  ++    + +KPWFVYTPMHGVGY+IF  +    +NL E+ DY+ VKEQIVPDP+F
Sbjct: 241 IPKNISLGTTIKGKKPWFVYTPMHGVGYQIFHRISSTCLNLVEDIDYVCVKEQIVPDPSF 300

Query: 300 PTISFPNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIG 359
           PT+SFPNPEEKGALD+ I  AK+++I LV+ANDPDADRFS A+ N  + E+QQLTGNEIG
Sbjct: 301 PTVSFPNPEEKGALDLGIKYAKKHNIDLVVANDPDADRFSVAVRNPLTDEFQQLTGNEIG 360

Query: 360 FLFGYYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNK 419
           FLF Y+L+ +Y+ +  +FK   PLAM+NSTVSS+M+K MA+ E F + DTLTGFKWIGNK
Sbjct: 361 FLFAYFLWEQYSMLPADFKDKFPLAMINSTVSSQMIKKMAEVEGFYYEDTLTGFKWIGNK 420

Query: 420 AIDLKKEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQ 479
           A +L+KEGY+V FG+EEAIGYMFP ME DKDGITA+VVFLQAY+ W   +K ++ DI+E 
Sbjct: 421 ARELEKEGYYVPFGFEEAIGYMFPKMECDKDGITATVVFLQAYYGWCMNNKQSLFDIIET 480

Query: 480 GIEKYGAFKEYNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTG 539
           G +KYG FKEYNGYY+V++  +T  IF  IR E   +  +Y   IGT  +V +FRDLT G
Sbjct: 481 GFKKYGVFKEYNGYYIVNDLSLTKIIFDNIR-ENKNDKEKYVSHIGTEFKVITFRDLTLG 539

Query: 540 FQSDTVDNIPSLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHS 599
           +QSDT+ N+P+LPVDPSSQMIT+T  I      ++ S VRFT+RGSGTEPKLK+YIE ++
Sbjct: 540 YQSDTIGNVPTLPVDPSSQMITMT--IIPTSLPENGS-VRFTIRGSGTEPKLKVYIEANA 596

Query: 600 KDPIAASKIAKLTWDVLKKEWIRPEVTGVTTSY 632
           K    A+++AKLTWDVLK+EW   E TG+TT++
Sbjct: 597 KTEAEANRLAKLTWDVLKREWFSSEKTGLTTNF 629

>NDAI0K00410 Chr11 complement(91807..93687) [1881 bp, 626 aa] {ON}
           Anc_8.840 YMR278W
          Length = 626

 Score =  782 bits (2019), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 380/622 (61%), Positives = 470/622 (75%), Gaps = 3/622 (0%)

Query: 11  VLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSKM 70
           + +  P +LR+ +  WL QDK  ET NEVI+LCK ++  ELHKRFD+RI+FGTAGLRS+M
Sbjct: 8   ICDDCPANLRENIDLWLRQDKCEETRNEVIQLCKDSNWIELHKRFDSRIVFGTAGLRSRM 67

Query: 71  EAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGFT 130
           EAGFSRMN LV+LQA+QGLA YIK QFP+NL AV+GHDHR+HSK+FA I  SVFL  GF 
Sbjct: 68  EAGFSRMNPLVILQASQGLAKYIKAQFPTNLTAVVGHDHRFHSKQFAMITASVFLRVGFK 127

Query: 131 VYNLNPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPVDAS 190
           VY LNP  +FVHTPLVPF+V+ + AS+GVMITASHNPKMDNGYKVYYSNGCQIIPP D +
Sbjct: 128 VYYLNPEDSFVHTPLVPFSVNHLNASIGVMITASHNPKMDNGYKVYYSNGCQIIPPHDKN 187

Query: 191 IAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKKTIREFD 250
           IA  IDENLEPWS+ W+     E  L  KKL+Y+R EM   Y   + + ++     R  +
Sbjct: 188 IAATIDENLEPWSSDWNWDSTFEKNLKEKKLVYVREEMTNKYLQAMKDILVSSSISRPNN 247

Query: 251 EHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPEEK 310
             +KPWFVYTPMHGVGY IFT +    ++ +EN DY  VKEQ+ PDPAFPT+SFPNPEEK
Sbjct: 248 NGKKPWFVYTPMHGVGYNIFTKISKNILHYEENMDYFVVKEQMYPDPAFPTVSFPNPEEK 307

Query: 311 GALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLFNKY 370
           GAL +A  LA+EN+ISLVIANDPDADRFS A  N  +G+WQQL+GNEIGFLF  +   KY
Sbjct: 308 GALSLATKLAEENNISLVIANDPDADRFSVASKNEKTGQWQQLSGNEIGFLFASFELEKY 367

Query: 371 TNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEGYHV 430
            + D E+++ HPLAM+NSTVSS+M+K MA  E+F + DTLTGFKWIGN+A+DL+ +GY+V
Sbjct: 368 MSQDIEWRRTHPLAMINSTVSSQMIKKMAQVESFHYEDTLTGFKWIGNRALDLQGQGYYV 427

Query: 431 VFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKYGAFKEY 490
            FG+EEAIGYMFP M  DKDG++A+VVFL AY  W N       DILE+G +K+G FKEY
Sbjct: 428 PFGFEEAIGYMFPTMVTDKDGVSAAVVFLLAYSYWLNNDGSYPFDILEKGFKKFGFFKEY 487

Query: 491 NGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNIPS 550
           NGYY+  +P+ T  IF ++R +Y  +GN YPK IG   ++  FRDLTTG+QS+T+DN+P+
Sbjct: 488 NGYYIYDDPKTTKQIFDFVRYQYDTSGNPYPKNIGKEFKIEVFRDLTTGYQSNTIDNLPN 547

Query: 551 LPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASKIAK 610
           LPVDP S+MITI A    D      S VRFTMRGSGTEPKLKLYIE  + +   A  +A 
Sbjct: 548 LPVDPHSEMITIEAVPKQD---IGKSKVRFTMRGSGTEPKLKLYIEAVADNEKCAIDLAY 604

Query: 611 LTWDVLKKEWIRPEVTGVTTSY 632
             W+VLKKEWIRP+VTG+TT++
Sbjct: 605 EMWNVLKKEWIRPDVTGLTTTF 626

>SAKL0D01474g Chr4 complement(117178..119052) [1875 bp, 624 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 624

 Score =  764 bits (1974), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 360/624 (57%), Positives = 454/624 (72%), Gaps = 11/624 (1%)

Query: 14  TLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSKMEAG 73
           T+P DL++ V  WL  DKNPET +E++ L +     ELH R D RI FGTAGLRS+MEAG
Sbjct: 7   TVPDDLKESVNLWLTYDKNPETRSELLNLVEGKHWEELHGRLDERISFGTAGLRSRMEAG 66

Query: 74  FSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGFTVYN 133
           FSRMNTL VLQA+QGLA+YIK QFP NL  ++GHDHRYHS EFA +  + FL  GF VY 
Sbjct: 67  FSRMNTLTVLQASQGLASYIKSQFPENLSVIVGHDHRYHSNEFARVTVTAFLQLGFKVYY 126

Query: 134 LNPPG-----TFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPVD 188
           LN        TFVHTP+VPFT++Q+ AS G+MITASHNPKMDNGYKVYYSNGCQIIPP D
Sbjct: 127 LNLSSKDSTETFVHTPMVPFTINQLNASAGIMITASHNPKMDNGYKVYYSNGCQIIPPHD 186

Query: 189 ASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKKTIRE 248
             I++ ID+NL PW+ +WD  + I+  + +  L  ++ ++   Y   V + ++    +  
Sbjct: 187 RLISETIDQNLVPWNKAWDCDEVIKTAIESGFLFDVKEKVTSKYIKTVSDELVRVPML-- 244

Query: 249 FDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPE 308
             +  KPWFVYTPMHGVG+EIF  + L  + LKE + Y+ V EQ  PDPAFPT+SFPNPE
Sbjct: 245 --DCDKPWFVYTPMHGVGFEIFEQIALLALGLKEGKHYVCVPEQRCPDPAFPTVSFPNPE 302

Query: 309 EKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLFN 368
           EKGALD++IALA+E DI LVIANDPDADRFS A+ N     W QLTGNEIGFLF YY + 
Sbjct: 303 EKGALDLSIALAEEQDIRLVIANDPDADRFSVAVKNGD--RWSQLTGNEIGFLFAYYQWQ 360

Query: 369 KYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEGY 428
            Y  +   FKK HPLAM+NSTVSS+M+KS+A+ E F + DTLTGFKW+GN+A +L+ +GY
Sbjct: 361 DYQKLGESFKKQHPLAMINSTVSSQMIKSLAEAEKFHYEDTLTGFKWLGNRAFELETQGY 420

Query: 429 HVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKYGAFK 488
           +V F YEEAIGYMFP +EHDKDGI+A+VVFLQ Y EW +  ++T + +L++G  KYG FK
Sbjct: 421 YVPFAYEEAIGYMFPEVEHDKDGISAAVVFLQMYCEWLSKDRMTPLQVLDEGFGKYGVFK 480

Query: 489 EYNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNI 548
           EYNGYY+V    +T ++F YIR +Y  +G+ YP  IG+   V SFRDLTTG+QSDT+DN+
Sbjct: 481 EYNGYYIVPRLSLTKEVFDYIREDYTPSGHAYPPAIGSEFSVISFRDLTTGYQSDTIDNV 540

Query: 549 PSLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASKI 608
           P+LPVD SSQMIT T +  + +   S   VRFT+RGSGTEPKLK+YIE  S D   A  +
Sbjct: 541 PNLPVDASSQMITATLRPSNGKESTSGEQVRFTIRGSGTEPKLKVYIEAKSTDEKRAQHL 600

Query: 609 AKLTWDVLKKEWIRPEVTGVTTSY 632
           A+ TW VL++EW RPE TG+ T +
Sbjct: 601 ARETWQVLRREWFRPERTGLETKF 624

>KNAG0J00270 Chr10 complement(39750..41627) [1878 bp, 625 aa] {ON}
           Anc_8.840 YMR278W
          Length = 625

 Score =  764 bits (1973), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 366/623 (58%), Positives = 459/623 (73%), Gaps = 6/623 (0%)

Query: 11  VLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSKM 70
           +L+  P  L+ ++  WL  DKN ET  EV+ LC+    +EL+ RF  RILFGTAGLRS+M
Sbjct: 8   ILQNAPEGLQHRILEWLRLDKNEETRREVLDLCQRQDWSELNSRFSQRILFGTAGLRSRM 67

Query: 71  EAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGFT 130
           EAG +R+N+LV+LQATQGLA YI  QFP N  AV+GHDHR+HSKEFA +  +VFL AGF 
Sbjct: 68  EAGTNRLNSLVILQATQGLARYIASQFPKNKVAVVGHDHRFHSKEFATVTAAVFLRAGFK 127

Query: 131 VYNLNPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPVDAS 190
           V  LNP  T VHTPLVPFTVD + ASVGVMITASHNPKMDNGYKVY++NGCQIIPP D +
Sbjct: 128 VLYLNPGDTLVHTPLVPFTVDHLNASVGVMITASHNPKMDNGYKVYFANGCQIIPPHDLN 187

Query: 191 IAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIID-KKTIREF 249
           IA+ ID+NLEPW  SWD    I+A     +++Y++++M   Y+   +  +I  +K +R  
Sbjct: 188 IARSIDQNLEPWEPSWDWPTVIQAAEKEDRIVYVKDQMTQLYTKTAELQLIGGRKVLR-- 245

Query: 250 DEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPEE 309
           +    PWFVYTPMHGVG EIF+ +  + + +KEN DYL V EQ  PDP+FPT+SFPNPEE
Sbjct: 246 NPGSGPWFVYTPMHGVGSEIFSRISEDVLGIKENEDYLCVPEQKHPDPSFPTVSFPNPEE 305

Query: 310 KGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLFNK 369
           KGALD AI LA +N I+LVIANDPDADRFS A+++S +  W+QLTGNEIGFLF Y  F  
Sbjct: 306 KGALDKAIELASQNGINLVIANDPDADRFSLAVFDSKTANWRQLTGNEIGFLFAYQQFEM 365

Query: 370 YTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEGYH 429
           Y  MD  F+K HPL +LNSTVSS+M+K MA+ E F + DTLTGFKWIGN+A DL+K+G+ 
Sbjct: 366 YKAMDDIFQKEHPLVLLNSTVSSQMIKKMAEVEGFHYEDTLTGFKWIGNRARDLEKKGFF 425

Query: 430 VVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKYGAFKE 489
             FGYEEAIGYMF  MEHDKDGI+AS++FL +Y+ W   +    +DILE G +KYG FKE
Sbjct: 426 APFGYEEAIGYMFTQMEHDKDGISASLMFLLSYYHWVYDAHKFPLDILEDGYKKYGVFKE 485

Query: 490 YNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNIP 549
           YNGYY+V NP++  + F YIRN+  K G QYP+ IG+  +V SFRDLT GFQSDT D+IP
Sbjct: 486 YNGYYIVDNPKIMKETFDYIRNDR-KPGTQYPEAIGSEFQVVSFRDLTLGFQSDTSDHIP 544

Query: 550 SLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASKIA 609
           +LPVDP+SQMIT+ AK   D  ++    VRFT+RGSGTEPKLK+YIE  S     A ++A
Sbjct: 545 TLPVDPNSQMITVCAKPTHDNVERDH--VRFTIRGSGTEPKLKVYIEACSGSETGAQQLA 602

Query: 610 KLTWDVLKKEWIRPEVTGVTTSY 632
           K  WD L++ W RP+ TG+ T +
Sbjct: 603 KQMWDTLQEVWFRPQTTGLVTDF 625

>TBLA0B03250 Chr2 (757928..759859) [1932 bp, 643 aa] {ON} Anc_8.840
           YMR278W
          Length = 643

 Score =  738 bits (1905), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 371/649 (57%), Positives = 465/649 (71%), Gaps = 24/649 (3%)

Query: 2   VSSNSEFDSVLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILF 61
           +S   +F+++++  P DL+ KV  WL QDK+  T  E+I LCK+ ++ ELH+RFD+RI F
Sbjct: 1   MSDEQQFNALIKDYPEDLQKKVLLWLEQDKDDSTRKEIIDLCKSANVKELHERFDSRITF 60

Query: 62  GTAGLRSKMEAGFSRMNTLVVLQATQGLATYIK---QQFPSNLKAVIGHDHRYHSKEFAE 118
           GTAGLRS MEAGFSRMNTL VLQA+QGLATY+K   +     L AVIGHDHRYHSKEFA+
Sbjct: 61  GTAGLRSTMEAGFSRMNTLTVLQASQGLATYMKNDAKNTGQKLIAVIGHDHRYHSKEFAK 120

Query: 119 IATSVFLSAGFTVYNLNPPG-------TFVHTPLVPFTVDQIGASVGVMITASHNPKMDN 171
           IA +VFL AGF VY LN           FVHTP+VPFTV  + ASVGVM+TASHNPKMDN
Sbjct: 121 IAATVFLIAGFKVYYLNDDSLEDPRDNKFVHTPMVPFTVKNLKASVGVMVTASHNPKMDN 180

Query: 172 GYKVYYSNGCQIIPPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLA 231
           GYKVYYSNGCQIIPP D+ I++CID NLEPW NSW+  + +    S   LIY R+ ML  
Sbjct: 181 GYKVYYSNGCQIIPPHDSGISQCIDANLEPWENSWNYKEIMANAESKGDLIYHRDVMLND 240

Query: 232 YSDKVDNNIIDKKTI---REFDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLT 288
           Y  +++  +  K  I   ++ D   KPWFVYTPMHGVGYEIFT +  E +++KE  D++ 
Sbjct: 241 YITQLEEKLTSKDIIHLSKKIDVKSKPWFVYTPMHGVGYEIFTKISNEILHMKEGEDFIV 300

Query: 289 VKEQIVPDPAFPTISFPNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHS- 347
           V+EQ  PDP FPT+SFPNPEEKGA+DM I LA++N ISLVIANDPDADRFS A+ +  S 
Sbjct: 301 VEEQKHPDPGFPTVSFPNPEEKGAIDMGIKLAEDNGISLVIANDPDADRFSIAVKSKGSQ 360

Query: 348 GEWQQLTGNEIGFLFGYYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFI 407
           G W Q TGNEIG+LF Y+ F KY     +    H L M+NSTVSS+M+K MA+ E F + 
Sbjct: 361 GTWHQFTGNEIGYLFAYFEFQKYKISKQDL---HRLYMVNSTVSSQMIKKMAEIEGFNYE 417

Query: 408 DTLTGFKWIGNKAIDLKKEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDN 467
           +TLTGFKWIGN+AIDL  +G  V FGYEEAIGYMFP ME DKDGI A+V+F+QA+  W+ 
Sbjct: 418 ETLTGFKWIGNRAIDLINKGNIVPFGYEEAIGYMFPTMEIDKDGIAATVIFIQAFMYWNQ 477

Query: 468 LSKVTVIDILEQGIEKYGAFKEYNGYYVVSNPQVTNDIFHYIRNEYPKN---GN-QYPKM 523
           + K+   +I++ G +KYG F EYNGYY  ++  +T  IF Y+R +Y K    GN +YP  
Sbjct: 478 IDKMDPYEIIQLGFKKYGVFIEYNGYYRYTDLGITKKIFDYVRYDYDKGVSEGNKKYPDH 537

Query: 524 IGTLLEVCSFRDLTTGFQSDTVDNIPSLPVDPSSQMITITAKICDDEYQKSDSIVRFTMR 583
           IG   ++  +RDLTTG+QSDT DN P LPVDPSSQMIT+     D+E   SD  +R T+R
Sbjct: 538 IGEEFKIIKYRDLTTGYQSDTPDNKPLLPVDPSSQMITVEMIPTDNE---SDGSIRLTIR 594

Query: 584 GSGTEPKLKLYIEGHSKDPIAASKIAKLTWDVLKKEWIRPEVTGVTTSY 632
           GSGTEPKLK+YIE  S+    AS +AK  W+VLK+EW+RPE TG+TT++
Sbjct: 595 GSGTEPKLKVYIEACSRSATEASFLAKQAWNVLKREWMRPEQTGITTAF 643

>CAGL0M02981g Chr13 (335863..337716) [1854 bp, 617 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278w
          Length = 617

 Score =  736 bits (1901), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 358/621 (57%), Positives = 453/621 (72%), Gaps = 12/621 (1%)

Query: 15  LPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSKMEAGF 74
           +PV+LR  + +WL  DKN ET NEVI+LC   + +ELHKRFD+RI+FGTAGLR++MEAG 
Sbjct: 6   IPVELRTAIESWLQLDKNEETRNEVIKLCNDQNWDELHKRFDSRIVFGTAGLRARMEAGT 65

Query: 75  SRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGFTVYNL 134
           +R+N LV+LQA+QGLATYIK +FP NL AV+GHDHRYHS+EFA++  + F+ AGF VY L
Sbjct: 66  NRLNKLVILQASQGLATYIKDKFPQNLTAVVGHDHRYHSQEFAQVTAATFIRAGFKVYYL 125

Query: 135 NPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPVDASIAKC 194
           NP   FVHTP+VP++VD + ASVGVMITASHNPKMDNGYKVYY+NGCQIIPP D  IA+ 
Sbjct: 126 NPHDEFVHTPMVPYSVDHLNASVGVMITASHNPKMDNGYKVYYTNGCQIIPPHDHGIAET 185

Query: 195 IDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKKTIREF---DE 251
           I+ NLEPWS  W+ +K +    ++ K+ Y+R  ML +Y + V N +I     R+F   DE
Sbjct: 186 INNNLEPWSTDWNFTKILSNAETDGKIEYVRKRMLTSYLNSVVNQLIQ----RDFAAPDE 241

Query: 252 HRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPEEKG 311
             KPWFVYTPMHGVG++IF++++ E +NLK+N DY+TV EQ  PDP+F T+SFPNPEEKG
Sbjct: 242 --KPWFVYTPMHGVGHQIFSTILNESLNLKDNIDYITVPEQKDPDPSFRTVSFPNPEEKG 299

Query: 312 ALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLFNKYT 371
           AL++AI LA+ N I LV+ANDP+ADRFS A+ +    EW+QLTGNEIG LF +Y F  Y 
Sbjct: 300 ALNLAITLAEANGIKLVLANDPNADRFSVAVRDDSKNEWKQLTGNEIGLLFAFYEFKMYQ 359

Query: 372 NMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEGYHVV 431
               +  KN PLAMLNSTVS++++K MA+ E F + DTLTGFKWIGN+A  L+++GY V 
Sbjct: 360 KAADKGIKNKPLAMLNSTVSAQVIKRMAEKEGFLYKDTLTGFKWIGNEAAKLEEKGYFVP 419

Query: 432 FGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKYGAFKEYN 491
           FGYEEAIGYMFPAMEHDKDG++A++VFLQAY  W   S    IDI+ +  +KYG   EYN
Sbjct: 420 FGYEEAIGYMFPAMEHDKDGVSAAIVFLQAYANWLQ-SSSNPIDIIHECYDKYGVSAEYN 478

Query: 492 GYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNIPSL 551
           GYY+VS+P  T+ +F  IR+ Y   G  +P+ IG    V  FRDLT GF S T D  P L
Sbjct: 479 GYYIVSDPSKTDKVFESIRSSYTSMGLSFPESIGEHFRVTEFRDLTIGFDSTTADKKPLL 538

Query: 552 PVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASKIAKL 611
           PVD +SQMITITA         +   VRFT+RGSGTEPKLK+YIEG S     A  +AK 
Sbjct: 539 PVDKNSQMITITA--VPSGASNTGESVRFTIRGSGTEPKLKVYIEGISSTEGRARILAKS 596

Query: 612 TWDVLKKEWIRPEVTGVTTSY 632
            W+ LK EW +P   G++T +
Sbjct: 597 LWETLKHEWFKPSSNGLSTDF 617

>ZYRO0G14190g Chr7 (1131206..1133038) [1833 bp, 610 aa] {ON} similar
           to uniprot|Q03262 Saccharomyces cerevisiae YMR278W
           Hypothetical ORF
          Length = 610

 Score =  733 bits (1893), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 357/621 (57%), Positives = 459/621 (73%), Gaps = 18/621 (2%)

Query: 15  LPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSKMEAGF 74
           +P +L+  +  WLAQD+N +T  E+  LC A + +ELH+R ++R+ FGTAGLR++MEAGF
Sbjct: 5   IPENLKQPISLWLAQDRNEKTCKEIAELCDAENWSELHERLNSRLQFGTAGLRARMEAGF 64

Query: 75  SRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGFTVYNL 134
           SRMNTLVV+QATQGLA YIK+QFP +L AV+GHDHR++S +FA+   +V L AGF V+ L
Sbjct: 65  SRMNTLVVIQATQGLAQYIKKQFPDHLVAVVGHDHRFNSMDFAKATATVLLKAGFEVHYL 124

Query: 135 NPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPVDASIAKC 194
           N   ++VHTP+VPFTVD++ ASVGVMITASHNPK+DNGYKVYY+NGCQIIPP D++IA+ 
Sbjct: 125 NQGDSYVHTPMVPFTVDRVKASVGVMITASHNPKLDNGYKVYYANGCQIIPPHDSAIARS 184

Query: 195 IDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKKTIREFDE--H 252
           I+ NLEP +  WD  + ++      KLIY R++ML  Y   V ++      + E D    
Sbjct: 185 IESNLEPGNGVWDWDQTMQQAADEGKLIYGRDKMLEQYISCVKDSF-----VTELDSLPK 239

Query: 253 RKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPEEKGA 312
            KPWFVYTPMHGVGY++F  +  + + L+ NRD+L V EQ+ PDP FPT+ FPNPEEKGA
Sbjct: 240 GKPWFVYTPMHGVGYQVFDQIASKILQLEVNRDFLVVSEQLNPDPEFPTVQFPNPEEKGA 299

Query: 313 LDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLFNKYTN 372
           LD+AI LA+ + I LVIA+DPDADRFS A    H   WQQL+GN+IGFLF YY   KY  
Sbjct: 300 LDLAIKLAENHGIKLVIASDPDADRFSVAFKGPHG--WQQLSGNDIGFLFAYYELQKYRG 357

Query: 373 MDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEGYHVVF 432
            D E++K+HPLAMLNSTVSS+M+ SMA  E F   DTLTGFKWIGN+A++L+  GY+V F
Sbjct: 358 FDAEYQKSHPLAMLNSTVSSQMINSMAALEGFHHEDTLTGFKWIGNRALELEARGYYVPF 417

Query: 433 GYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKYGAFKEYNG 492
           G+EEAIGYMFPA EHDKDGI+A+VVFLQAY  W +  K + +DIL++   KYG F+EYNG
Sbjct: 418 GFEEAIGYMFPATEHDKDGISAAVVFLQAYHSWISQGK-SPLDILDEASAKYGVFREYNG 476

Query: 493 YYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNIPSLP 552
           YY+V  P +TN  F YIR +Y   G  YP+ IG  L+V +FRDLTTG+QSDT +NIP+L 
Sbjct: 477 YYLVDEPSLTNKTFAYIREDYTPKGENYPRTIGD-LQVKTFRDLTTGYQSDTPNNIPNLH 535

Query: 553 VDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASKIAKLT 612
           VDPSSQMITI A+    +   S   VRFT+RGSGTEPKLK+YIE  ++    A ++A+ T
Sbjct: 536 VDPSSQMITIVAQ---PKGGGSGEHVRFTLRGSGTEPKLKVYIEAGAQSDPRARELARQT 592

Query: 613 WDVLKKEWI-RPEVTGVTTSY 632
           WD+L++EW  RP   G+TT +
Sbjct: 593 WDILREEWFNRP---GLTTKF 610

>KAFR0B03920 Chr2 (814394..816268) [1875 bp, 624 aa] {ON} Anc_8.840
           YMR278W
          Length = 624

 Score =  704 bits (1816), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 345/632 (54%), Positives = 438/632 (69%), Gaps = 9/632 (1%)

Query: 2   VSSNSEFDSVL-ETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRIL 60
           +SS S   S++ E +P  L+     WL  D+N ET +E++ +       EL  R + RI 
Sbjct: 1   MSSQSNILSLIDEYVPERLKVSCDRWLRYDQNEETRSEILTIIGRKDWKELGNRLEGRIP 60

Query: 61  FGTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIA 120
           FGTAGLR +MEAGF+RMN+LV+LQ +QGLA YI ++FP NL  V+GHDHRYHSKEFA+I 
Sbjct: 61  FGTAGLRGRMEAGFTRMNSLVILQTSQGLAQYIMEKFPQNLSVVVGHDHRYHSKEFADIT 120

Query: 121 TSVFLSAGFTVYNLNPPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNG 180
            + FL+AGF V+ LN    FVHTPLVP++VD++ ++ GVMITASHNPK DNGYKVYYSNG
Sbjct: 121 VATFLNAGFKVFYLNTENEFVHTPLVPYSVDKLRSACGVMITASHNPKDDNGYKVYYSNG 180

Query: 181 CQIIPPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNI 240
           CQIIPP D +IA  I++NL PWS  W+          N  L +  N+M LAY   +   +
Sbjct: 181 CQIIPPHDKNIALTIEKNLTPWSKDWNWKDLFSTEERNGNLEFNGNKMFLAYVQDITRYV 240

Query: 241 IDKKTIREFDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFP 300
               +     +  KPWFVYTPMHGVG++IF  +  + + L EN DY +V EQI PDP+FP
Sbjct: 241 FTNGS--PMLKTGKPWFVYTPMHGVGHKIFGQIAKQVLGLSENVDYFSVPEQIKPDPSFP 298

Query: 301 TISFPNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGF 360
           T+SFPNPEEKGALDMAI LA+   ++L+IANDPDADRFSAA+ +  S EW+QL+GNEIG 
Sbjct: 299 TVSFPNPEEKGALDMAIQLAEREGLTLIIANDPDADRFSAAVKDKRSHEWRQLSGNEIGS 358

Query: 361 LFGYYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKA 420
           LF  +   ++       K   PLAMLNSTVSS+MLK MA  E F + +TLTGFKWIGN+A
Sbjct: 359 LFAIFKLQEHKEKAASRK---PLAMLNSTVSSQMLKKMAQVEGFHYEETLTGFKWIGNRA 415

Query: 421 IDLKKEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQG 480
           + L+++GY V FGYEEAIGYMFP MEHDKDGI ASVVFL  Y +W  L  +  +D+L+  
Sbjct: 416 LQLEQQGYDVCFGYEEAIGYMFPCMEHDKDGIIASVVFLHMYSKWLELEGLGPLDVLDLC 475

Query: 481 IEKYGAFKEYNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGF 540
            EKYG F EYNGYY V  P +   +F YIR+EY      YP+ +G    + SFRDLT G+
Sbjct: 476 FEKYGVFSEYNGYYTVEEPALIESVFSYIRDEYCPKARPYPEKLGREFFLTSFRDLTLGY 535

Query: 541 QSDTVDNIPSLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSK 600
           QSDT+D  P+LPVD SSQMIT T K    E       +RFT+RGSGTEPKLK+YIE H+ 
Sbjct: 536 QSDTIDFKPTLPVDASSQMITATLK---PERTVGHEEIRFTIRGSGTEPKLKVYIESHAA 592

Query: 601 DPIAASKIAKLTWDVLKKEWIRPEVTGVTTSY 632
           +  AA+ +A LTW+VL++EW RPE+TG+ TS+
Sbjct: 593 NKEAAANLAHLTWNVLRREWFRPEITGLKTSF 624

>Ecym_4611 Chr4 (1191367..1193259) [1893 bp, 630 aa] {ON} similar to
           Ashbya gossypii ABL126W
          Length = 630

 Score =  699 bits (1804), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 349/629 (55%), Positives = 441/629 (70%), Gaps = 18/629 (2%)

Query: 13  ETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSKMEA 72
           E +P DLRDK+  W   DKNP+T  E+  L  + + NEL  R   RI FGTAGLR++MEA
Sbjct: 11  ELIPDDLRDKIDKWFKYDKNPQTTAEIRSLVDSQNWNELRGRLCQRISFGTAGLRARMEA 70

Query: 73  GFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGFTVY 132
           GF+RMNTL V+QA+QGLATYIK QFP+NLK V+GHDHRY+SK FAE+A + FL  GF VY
Sbjct: 71  GFARMNTLTVIQASQGLATYIKSQFPNNLKVVVGHDHRYNSKSFAEVAIAAFLQLGFEVY 130

Query: 133 NLN--PPG----TFVHTPLVPFTVDQI--GASVGVMITASHNPKMDNGYKVYYSNGCQII 184
            LN  P      ++VHTP+VPFTV  I  GAS G+MITASHNPKMDNGYKVYYSNGCQI 
Sbjct: 131 YLNYVPSNKDVESYVHTPMVPFTVSNIEGGASCGIMITASHNPKMDNGYKVYYSNGCQIT 190

Query: 185 PPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKK 244
           PP D  IA  ID NL PW  +WD+ K IE   +N +L  ++ E++  Y  ++ ++++   
Sbjct: 191 PPHDKKIASEIDANLVPWDQAWDAQKLIEDARNNNRLHDVKQELIKNYVQRIQSSLV--- 247

Query: 245 TIREFDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISF 304
           T     +  K WFVYTPMHGVGYEIF ++V   ++LKE+  YL V  Q  PDP F T+SF
Sbjct: 248 TTNSLADCGKNWFVYTPMHGVGYEIFNNIVTNTLHLKEDEHYLVVGAQKFPDPEFTTVSF 307

Query: 305 PNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGY 364
           PNPEE+GAL++AI LA  +   LV+ANDPDADRFSAA+ + +  +W+QLTGN++G+LF  
Sbjct: 308 PNPEEEGALNLAIELAARSGAELVLANDPDADRFSAAVKDGN--KWKQLTGNQLGYLFAV 365

Query: 365 YLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLK 424
               K++N + E KK  PLAML STVSS+M+  MAD E F F++TLTGFKW+ N+AIDL+
Sbjct: 366 GQLEKFSNQN-ENKK--PLAMLGSTVSSQMIAKMADVEGFTFVETLTGFKWLANRAIDLE 422

Query: 425 KEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKY 484
            +G++V F YEEAIGYMF ++ HDKDG++A+  FLQ    W    K T +D+L  G EKY
Sbjct: 423 NDGFYVPFAYEEAIGYMFSSVTHDKDGVSAATEFLQMAARWKKEGK-TPLDVLNAGYEKY 481

Query: 485 GAFKEYNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDT 544
           G F EYNGYY V +  +  D+F YIRN    N   YP  IG    V SFRDLT G+QSDT
Sbjct: 482 GNFVEYNGYYSVQDLSIIGDVFKYIRNACNGNDVPYPSTIGNEFAVASFRDLTVGYQSDT 541

Query: 545 VDNIPSLPVDPSSQMITITAK-ICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPI 603
            ++IP+LPV P S MIT   K +  +  Q S   VRFT+RGSGTEPKLK+YIE ++ D  
Sbjct: 542 GNHIPNLPVSPGSHMITCVLKPLIKETAQTSSDYVRFTIRGSGTEPKLKVYIESNALDKE 601

Query: 604 AASKIAKLTWDVLKKEWIRPEVTGVTTSY 632
            A+K+AKLTWDVLK+EW RPEVTG+ T +
Sbjct: 602 YATKLAKLTWDVLKREWFRPEVTGLQTKF 630

>Kwal_27.10258 s27 complement(265612..267474) [1863 bp, 620 aa] {ON}
           YMR278W - Hypothetical ORF [contig 37] FULL
          Length = 620

 Score =  696 bits (1797), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 339/630 (53%), Positives = 431/630 (68%), Gaps = 17/630 (2%)

Query: 9   DSVLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRS 68
           +S+   +P DL+  V +W   DKN ET NE+++L    + NELHKR D RI FGTAGLRS
Sbjct: 2   ESIKVEIPADLKSSVESWFEHDKNEETRNEILQLVTEQNWNELHKRLDQRISFGTAGLRS 61

Query: 69  KMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAG 128
           KMEAGFSRMNTL VLQA+QGLA YI ++FP N    +GHDHR++S++FAE+ +  FL   
Sbjct: 62  KMEAGFSRMNTLTVLQASQGLAKYIAEKFPENKTVAVGHDHRFNSRDFAEVTSVAFLQLR 121

Query: 129 FTVYNLN-----PPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQI 183
           F VY+L          FVHTP+VPF +D++GAS GVMITASHNPKMDNGYKVYYSNGCQI
Sbjct: 122 FKVYSLGFNADPKKDAFVHTPMVPFAIDRLGASAGVMITASHNPKMDNGYKVYYSNGCQI 181

Query: 184 IPPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDK 243
           IPP D  IA+ I +NL PW  +WD    I         + ++  M+  Y  ++ + ++  
Sbjct: 182 IPPHDRLIAQSILDNLNPWERAWDCKAVIAEATEKGYFVDMKKPMVDHYVKEISDKLVSS 241

Query: 244 KTIREFDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTIS 303
               +  +  KPWFVYTP+HGVG+EIF  +  E + L E RDY  V E   PDPAFPT+S
Sbjct: 242 ----DIGDRSKPWFVYTPLHGVGFEIFERIASEVLGLVEGRDYWCVSEHKQPDPAFPTVS 297

Query: 304 FPNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFG 363
           FPNPEE GALD+AIALA +N IS V+ NDPDADRFSAA+   H G+W+QLTGNEIGFLF 
Sbjct: 298 FPNPEEAGALDLAIALADKNGISFVLGNDPDADRFSAAV--KHQGKWRQLTGNEIGFLFA 355

Query: 364 YYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDL 423
            +++ KY     EFK  +PLA++NSTVSS+M+K +A  E F + DTLTGFKW+GN+A  L
Sbjct: 356 QFVWEKYQKESSEFKLENPLALINSTVSSQMIKKLAGVEKFHYEDTLTGFKWLGNRARQL 415

Query: 424 KKEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEK 483
           +  GY+V F YEEAIG+MF  + HDKDG++A+VVFLQ  + W   + ++ ID+L+    K
Sbjct: 416 ESSGYYVPFAYEEAIGFMFSDIVHDKDGVSAAVVFLQMLWSWKKQA-LSPIDVLQSAFGK 474

Query: 484 YGAFKEYNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSD 543
           YG FKEYNGYY V +  +T+ IF  IR+ Y    + YPK IG   +V SF DLT GFQSD
Sbjct: 475 YGVFKEYNGYYTVPDLSLTDRIFSDIRSSY----DSYPKHIGNQFDVVSFTDLTKGFQSD 530

Query: 544 TVDNIPSLPVDPSSQMITITAKICDDEYQKSD-SIVRFTMRGSGTEPKLKLYIEGHSKDP 602
           T DN P LPVDPSSQMI  T          +   IVRFT RGSGTEPKLK+YIE  S + 
Sbjct: 531 TADNTPRLPVDPSSQMIQATLVPSTSGGSGAPLEIVRFTARGSGTEPKLKVYIEATSVEE 590

Query: 603 IAASKIAKLTWDVLKKEWIRPEVTGVTTSY 632
             AS +A+ TW+VL+ EW +P+ TG++T +
Sbjct: 591 TRASDLARTTWNVLRDEWFKPKETGLSTKF 620

>ABL126W Chr2 (159207..161081) [1875 bp, 624 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YMR278W
          Length = 624

 Score =  676 bits (1745), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 336/629 (53%), Positives = 427/629 (67%), Gaps = 19/629 (3%)

Query: 13  ETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSKMEA 72
           + +P  L+D +  WL  DKN ET +E+  L   +  +EL KR   RI FGTAGLR++MEA
Sbjct: 6   DAVPSSLKDSLMEWLTFDKNSETQHEICELVSNHQWDELRKRLLPRITFGTAGLRARMEA 65

Query: 73  GFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGFTVY 132
           GFSRMNTL V+QA+QGLA YIK QFP +LK VIGHDHR+HS+EFAE   + FL   + +Y
Sbjct: 66  GFSRMNTLTVIQASQGLARYIKSQFPDDLKVVIGHDHRFHSREFAEATIAAFLQLDYDIY 125

Query: 133 NLN--PPGT----FVHTPLVPFTVDQIGA---SVGVMITASHNPKMDNGYKVYYSNGCQI 183
            LN  PPG+    FVHTP+VPF ++ +     S GVMITASHNPKMDNGYKVYY+NGCQI
Sbjct: 126 YLNYVPPGSDEDVFVHTPMVPFAINNVEGGPTSCGVMITASHNPKMDNGYKVYYANGCQI 185

Query: 184 IPPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDK 243
           IPP D  I + ID NLEPW+ +WDS   IE  + + KL  +R EML  Y D +   ++ +
Sbjct: 186 IPPHDELIGRHIDANLEPWTRAWDSKALIEEAIKSGKLHDVRKEMLQKYKDSIQTMLVKQ 245

Query: 244 KTIREFDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTIS 303
             ++       PWFVYTPMHGVGYE F   V   + ++E++DY+ V EQ  PDP FPT+S
Sbjct: 246 SNLKFAG---GPWFVYTPMHGVGYEFFKEAVASVLGIEEDKDYIVVPEQKYPDPEFPTVS 302

Query: 304 FPNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFG 363
           FPNPEE+GALDMA+ +A  N I++V+ANDPDADRFS A+   + GEW QLTGN+IG LF 
Sbjct: 303 FPNPEERGALDMAMKVADANGITVVLANDPDADRFSVAV--KYHGEWNQLTGNQIGILFA 360

Query: 364 YYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDL 423
                 Y   +P+  +   LAML S VSS++L+ MA+ E F  ++TLTGFKW+GN+A +L
Sbjct: 361 QAEMQSYFK-EPKLDRKQ-LAMLTSAVSSQLLRKMAEEEGFLAVETLTGFKWLGNRAREL 418

Query: 424 KKEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEK 483
           + EGY+V F YEEAIGYMF  + HDKDGI A+ VFLQ  +EW  ++K +  ++L++  EK
Sbjct: 419 ELEGYYVPFAYEEAIGYMFSQVVHDKDGIAAAAVFLQMCYEWKKVAKSSQ-EVLQECYEK 477

Query: 484 YGAFKEYNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSD 543
           YG F +YNGYY+ S P VT ++F Y RNEY   G  YP  IG   EV   RDLT G+QSD
Sbjct: 478 YGYFVDYNGYYISSAPAVTKEVFDYFRNEYTPAGKPYPSHIGCEFEVEYLRDLTVGYQSD 537

Query: 544 TVDNIPSLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPI 603
           T  NIP LPVD +SQMIT   K    E       VRFT RGSGTEPKLK+YIE  + +  
Sbjct: 538 TATNIPDLPVDHNSQMITCVLKPVKMETDCES--VRFTARGSGTEPKLKVYIESCAANHQ 595

Query: 604 AASKIAKLTWDVLKKEWIRPEVTGVTTSY 632
            AS ++ L WDVLK+EW RP  TG+ T++
Sbjct: 596 RASHLSHLAWDVLKREWFRPTETGLQTNF 624

>KLLA0D01573g Chr4 complement(139183..141006) [1824 bp, 607 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 607

 Score =  673 bits (1736), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 338/629 (53%), Positives = 441/629 (70%), Gaps = 35/629 (5%)

Query: 11  VLETLPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSKM 70
           V+E+LP DL+ KV  WL  DK  ET NE+++LC    + ELHKR D  I FGTAGLR +M
Sbjct: 6   VIESLPSDLQGKVRNWLKYDKVEETRNEILQLCLKGDITELHKRLDTMIAFGTAGLRGRM 65

Query: 71  EAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGFT 130
           EAGF+RMN L V QA+QGLA YIK+QFP NL  V+GHDHR++S+ F ++    FL  GF 
Sbjct: 66  EAGFNRMNALTVKQASQGLAKYIKKQFPENLTVVVGHDHRHNSRLFGKVTVDTFLQLGFK 125

Query: 131 VYNLNPPG--TFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPVD 188
           V++LN     + VHTPLVPFTV+  GASVG+MITASHNPKMDNGYKVYY+NGCQIIPP D
Sbjct: 126 VFHLNHENEKSLVHTPLVPFTVNATGASVGIMITASHNPKMDNGYKVYYTNGCQIIPPHD 185

Query: 189 ASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKKTIRE 248
             IA+ I  NLEP+S+    +           +I  + +M   Y D + + +ID    ++
Sbjct: 186 KLIAESIIHNLEPFSSPQTGT-----------IIDCKEKMTKKYIDAIGSTLIDGAVNKK 234

Query: 249 FDEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPE 308
            +E   PWFVYTPMHGVG+EIF S+  + ++L+E +DYL V+EQ  PD  FPT+SFPNPE
Sbjct: 235 TNE---PWFVYTPMHGVGFEIFESISKQLLSLEEGKDYLVVEEQKYPDADFPTVSFPNPE 291

Query: 309 EKGALDMAIALAKEND-ISLVIANDPDADRFSAAIYNSH---SGEWQQLTGNEIGFLFGY 364
           EKGALD+A+   ++ND + L+IANDPDADRFS A+ ++    +  W+QLTGNEIGFLF Y
Sbjct: 292 EKGALDLAVEYGRKNDTVDLIIANDPDADRFSVAVRDNDQNTTTAWRQLTGNEIGFLFAY 351

Query: 365 YLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLK 424
           Y + +Y +       + PLAMLNSTVSS+M+K MA+ E F + DTLTGFKW+GN+A++L+
Sbjct: 352 YEWERYKHS----PIDEPLAMLNSTVSSQMIKRMAEIEGFHYEDTLTGFKWLGNRALELE 407

Query: 425 KEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKY 484
           +EGY+  F YEEAIGYMF ++ HDKDGI+A++VFLQAY +W   S  TV+DIL     KY
Sbjct: 408 QEGYYTPFAYEEAIGYMFSSVVHDKDGISAAIVFLQAYSKW-RASGQTVLDILATASLKY 466

Query: 485 GAFKEYNGYYVVSNPQVTNDIFHYIRN-EYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSD 543
           G FKE+NGYY+V +  +T  +F  IR+ E P     YPK +G+  E+  FRDLT G+QSD
Sbjct: 467 GHFKEFNGYYIVPDLAITKQVFDAIRSIESP-----YPKKLGSSFEIIKFRDLTNGYQSD 521

Query: 544 TVDNIPSLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPI 603
           T D+IP L  DPSSQMIT    +     ++  S VRFT+RGSGTEPKLK+YIE  +    
Sbjct: 522 TPDHIPELASDPSSQMITCEMLLV----EQPTSRVRFTIRGSGTEPKLKVYIEARTNTEP 577

Query: 604 AASKIAKLTWDVLKKEWIRPEVTGVTTSY 632
            +  +AK TWDVL++EW +PE+TG+ T +
Sbjct: 578 NSIALAKFTWDVLRQEWFKPELTGLLTPF 606

>KLTH0C03872g Chr3 complement(337765..339630) [1866 bp, 621 aa] {ON}
           similar to uniprot|Q03262 Saccharomyces cerevisiae
           YMR278W Hypothetical ORF
          Length = 621

 Score =  665 bits (1717), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 331/624 (53%), Positives = 424/624 (67%), Gaps = 17/624 (2%)

Query: 15  LPVDLRDKVGTWLAQDKNPETINEVIRLCKANSLNELHKRFDNRILFGTAGLRSKMEAGF 74
           +P DL+  V  WL  DKN +T +++I+L +  S  EL  R + RI FGTAGLRS+MEAGF
Sbjct: 9   VPEDLKLGVEAWLKYDKNEQTRDQIIKLVEDKSWTELRNRLNFRITFGTAGLRSRMEAGF 68

Query: 75  SRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEFAEIATSVFLSAGFTVYNL 134
           +RMNTL VLQA+QGLA YI   FP NL  V+GHDHR++SK+FAE+    FL  GF VY+L
Sbjct: 69  NRMNTLTVLQASQGLAKYIASNFPDNLSVVVGHDHRFNSKDFAEVTIVAFLQLGFKVYDL 128

Query: 135 N-----PPGTFVHTPLVPFTVDQIGASVGVMITASHNPKMDNGYKVYYSNGCQIIPPVDA 189
                      VHTP+VPF +D + AS G+MITASHNPKMDNGYKVYYSNGCQIIPP D 
Sbjct: 129 GFTEDASQDVVVHTPMVPFGIDHLRASGGIMITASHNPKMDNGYKVYYSNGCQIIPPHDQ 188

Query: 190 SIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYSDKVDNNIIDKKTIREF 249
            I++ I  NLEPW  +WD +      + ++ LI  +  ++  Y D V  +++    I   
Sbjct: 189 RISQSILANLEPWDRAWDCAAVKAEAVQSEMLIDAKKVLVDQYVDTVRRSLV----ITNV 244

Query: 250 DEHRKPWFVYTPMHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPEE 309
           +  + PWFVYTP+HGVG+EIF  ++     L + RDYL V+EQ  PDP FPT+SFPNPEE
Sbjct: 245 NHTKAPWFVYTPLHGVGFEIFEKILSSAWRLGQGRDYLCVEEQKYPDPNFPTVSFPNPEE 304

Query: 310 KGALDMAIALAKENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLFNK 369
           KGALD AI LA+++DI+ V+ NDPDADRFS A    H+G+W+QLTGNEIGFLF  Y +  
Sbjct: 305 KGALDKAIELAEKHDITFVLGNDPDADRFSVAA--KHNGQWRQLTGNEIGFLFAQYKWET 362

Query: 370 YTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEGYH 429
           Y     +FK  +PLAM+NSTVSS+M+K MA+ E F + DTLTGFKW+GN+A +L+  GY 
Sbjct: 363 YRLESDKFKGTNPLAMINSTVSSQMIKKMAEVEGFHYEDTLTGFKWLGNRARELENAGYF 422

Query: 430 VVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKYGAFKE 489
           V F YEEAIGYMF  + HDKDGI+A+VVFLQ  + W     +T  D+L++  +KYG FKE
Sbjct: 423 VPFAYEEAIGYMFSDVVHDKDGISAAVVFLQMLWSW-KAQALTPFDVLQRAYQKYGVFKE 481

Query: 490 YNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNIP 549
           YNGYY+V +  +T+ +F  IR+ +    +  P  IG    V S+ DLTTG+QS+T D+ P
Sbjct: 482 YNGYYIVPDLSLTDKVFSGIRSGF----SLQPTHIGQEFRVESYTDLTTGYQSNTPDSEP 537

Query: 550 SLPVDPSSQMITIT-AKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASKI 608
            LPVDPSSQMIT T         Q     VRFT RGSGTEPKLK+YIE  S     AS +
Sbjct: 538 RLPVDPSSQMITATLTPTSSTGRQGFSESVRFTARGSGTEPKLKVYIEAVSSSEELASAL 597

Query: 609 AKLTWDVLKKEWIRPEVTGVTTSY 632
           AK  WDVL++EW +PE TG+ T++
Sbjct: 598 AKKAWDVLRREWFKPEQTGLATNF 621

>TDEL0A02210 Chr1 (400375..402093) [1719 bp, 572 aa] {ON} Anc_2.445
           YKL127W
          Length = 572

 Score = 47.8 bits (112), Expect = 7e-05,   Method: Compositional matrix adjust.
 Identities = 139/601 (23%), Positives = 238/601 (39%), Gaps = 100/601 (16%)

Query: 62  GTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLK---AVIGHDHRYHSKEFAE 118
           GT+GLR K +    + +       T+     I    P   K    V+G D RY++ +  +
Sbjct: 19  GTSGLRKKTKVFMEKPHY------TENFIQSILDAIPEGSKDATLVVGGDGRYYNDKILQ 72

Query: 119 IATSVFLSAGFTVYNLNPPGTFVHTPLVPFTV----DQIGASV--GVMITASHNPKM--- 169
           I  S+  + G     +   G  + TP     +    D+ G  V  G+++TASHNP     
Sbjct: 73  IIASISAANGVGKLVIGQHG-LLSTPAASHIIRTYQDKSGKKVTGGIILTASHNPGGPDN 131

Query: 170 DNGYKVYYSNGCQIIPPVDASIAKCIDENLEPWSN--------SWDSSKAIEAGLSNKKL 221
           D G K   SNG     P   S+   I E  +  ++          D S   E  L N ++
Sbjct: 132 DIGIKYNLSNGG----PAPESVTNAIWEISKKLTSYKIIKNLPQLDLSTKGEKKLGNLEI 187

Query: 222 IYLRNEMLLAYSDKVDNNIIDKKTIREF-DEHR--KPW-FVYTPMHGVGYEIFTSLVLEK 277
             +  ++  AY + +   I D   I++F D  R  K W  ++  ++GV      ++ +++
Sbjct: 188 DVV--DVTQAYVEFL-KEIFDFDLIKKFVDTQRSTKHWKLLFDGLNGVTGPYGKAIFVDE 244

Query: 278 VNLKENRDYLTVKEQIVPDPAFPTISFPNPEEKGALDMAIALAKENDISLVIANDPDADR 337
           + L EN     V +   P P F  I  P+P    A  +   + KE  I    A+D D DR
Sbjct: 245 LGLPENE----VLQNCHPKPDFGGIH-PDPNLTYARTLVERVDKEK-IEFGAASDGDGDR 298

Query: 338 FSAAIYNSHSGEWQQLTGNEIGFLFGYYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKS 397
               IY    G      G+ +       +  +Y    P F K     +  S  +S  +  
Sbjct: 299 --NMIYG--YGPAFVSPGDSVA------IIAEYAKEIPYFAKQGIYGLARSFPTSSAIDR 348

Query: 398 MADTENFKFIDTLTGFKWIGNKAIDLKKEGYHVVFGYEEAIGYMFPAMEHDKDGITASVV 457
           +A  +     +  TG+K+      D KK    +    EE+ G     +  +KDG+ A + 
Sbjct: 349 VAAEQGLNCYEVPTGWKFF-CALFDAKK----LSICGEESFGTGSNHV-REKDGVWAIIA 402

Query: 458 FLQ---AYFEWDNLSKVTVIDILEQGIEKYGA--FKEYNGYYVVSNPQVTNDIFHYIRNE 512
           +L     Y +     + ++  I ++   KYG   F  Y+  +V +  +  N+I  ++ + 
Sbjct: 403 WLNILAIYNKHHPQKEASIKTIQDEFWLKYGRTFFTRYDFEHVTT--EKANEIVKHLDSF 460

Query: 513 YPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNIPSLPVDPSSQMITITAKICDDE-- 570
                   P ++G            + F S   DN  ++      Q   +   +  ++  
Sbjct: 461 V-----NSPNVVG------------SKFPS---DNSVTVAEAGDFQYTDLDGSVSSNQGL 500

Query: 571 YQKSDSIVRFTMRGSGTEPK---LKLYIEGHSKDPIAASKIAKLTWDVLKKEWIRPEVTG 627
           Y K  S  RF +R SGT      ++LYIE +S D        K  + +  +E++RP +  
Sbjct: 501 YVKLSSGARFVLRLSGTGSSGATIRLYIEKYSDD--------KTKYGLTAEEYLRPIIDS 552

Query: 628 V 628
           V
Sbjct: 553 V 553

>ZYRO0G02508g Chr7 (192411..194120) [1710 bp, 569 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 569

 Score = 44.3 bits (103), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 132/590 (22%), Positives = 242/590 (41%), Gaps = 87/590 (14%)

Query: 62  GTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLK---AVIGHDHRYHSKEFAE 118
           GT+GLR + +      N       T+     I +  P  +K    ++G D RY++    +
Sbjct: 19  GTSGLRKRTKVFAEEPNY------TENFIQAILEAIPEGVKDSVLLVGGDGRYYNDVVLQ 72

Query: 119 IATSVFLSAGFTVYNLNPPGTFVHTPLVPFTV---DQIGASVGVMITASHNPKMDN---G 172
              ++  + G     +   G  + TP     +    +   + G+++TASHNP   N   G
Sbjct: 73  KIAAIGAANGVKRLVVGQNG-ILSTPAASHVIRSYSKAKVTGGIILTASHNPGGPNNDFG 131

Query: 173 YKVYYSNGCQIIPPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAY 232
            K   +NG      V  ++ +   + L  +    D      + L  K+   L  +++ + 
Sbjct: 132 IKYNLANGGPAPENVTNAMWEA-SKRLTSYKIVTDFPHVDLSALGEKQYGSLTVDVIDST 190

Query: 233 SDKVD--NNIIDKKTIREFDEHR---KPW-FVYTPMHGVGYEIFTSLVLEKVNLKENRDY 286
              VD    I D   I+ F  H+   K W  ++  ++GV      ++  +++ L E+   
Sbjct: 191 KAYVDFLKTIFDFPLIKSFVNHQRETKNWKLLFDGLNGVTGPYGRAIFADELGLPEDE-- 248

Query: 287 LTVKEQIVPDPAFPTISFPNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSH 346
             V +   P P F  +  P+P    A  +   + +EN I+   A+D D DR    IY   
Sbjct: 249 --VLQNCHPKPDFGGLH-PDPNLTYARTLVDRVDREN-IAFGAASDGDGDR--NMIYG-- 300

Query: 347 SGEWQQLTGNEIGFLFGYYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKF 406
           +G      G+ +       +  +Y +  P F++     +  S  +S+ +  +A   N   
Sbjct: 301 AGPAFVSPGDSVA------IIAEYASEIPYFQREGIYGLARSFPTSQAIDLVAKHHNLSC 354

Query: 407 IDTLTGFKWIGNKAIDLKKEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQ--AYFE 464
            +  TG+K+      D KK    +    EE+ G     +  +KDG+ A + +L   A + 
Sbjct: 355 YEVPTGWKFF-CALFDAKK----LSICGEESFGTGSNHI-REKDGLWAIIAWLNILAIYH 408

Query: 465 WDNLSK-VTVIDILEQGIEKYGA--FKEYNGYYVVSNPQVTNDIFHYIRNEYPK---NGN 518
             N  K V++  I ++  +KYG   F  Y+ Y  VS  +  N +  + +N   +    G+
Sbjct: 409 KRNPEKDVSIKTIQDEFWDKYGRTFFTRYD-YENVSG-EAANRVIEFFQNFVSQPGVKGS 466

Query: 519 QYPKMIGTLLEVCSFRDLTTGFQSDTVDNIPSLPVDPSSQMITITAKICDDEYQKSDSIV 578
            +P  +   L+V    D    F+   +D   S     S+Q +          + K  + V
Sbjct: 467 NFP--LDESLKVVDAGD----FEYKDLDGSVS-----SNQGL----------FLKLSNGV 505

Query: 579 RFTMRGSGT---EPKLKLYIEGHSKDPIAASKIAKLTWDVLKKEWIRPEV 625
           R  +R SGT      ++LY+E +S D   ASK     + +  +E++RP +
Sbjct: 506 RTVLRLSGTGSAGATIRLYVEQYSDD---ASK-----YGLTAEEFLRPAI 547

>TDEL0E00210 Chr5 (28244..29956) [1713 bp, 570 aa] {ON} Anc_2.445
           YKL127W
          Length = 570

 Score = 43.9 bits (102), Expect = 0.001,   Method: Compositional matrix adjust.
 Identities = 144/605 (23%), Positives = 240/605 (39%), Gaps = 108/605 (17%)

Query: 62  GTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLK---AVIGHDHRYHSKEFAE 118
           GT+GLR K       MN +     T+     I    P + K    V+G D RY++ +  +
Sbjct: 17  GTSGLRKKTAV---FMNNV---HYTENFIQSILDAIPESSKDAILVVGGDGRYYNDKILQ 70

Query: 119 IATSVFLSAGFTVYNLNPPGTFVHTPLVPFTV----DQIGASV--GVMITASHN---PKM 169
           I  ++  + G     +   G  + TP     +    D+ G  V  G+++TASHN   P+ 
Sbjct: 71  IIAAISAANGVRKLVIGQHG-LLSTPAASHIIRSYQDKDGKKVTGGIILTASHNPGGPEN 129

Query: 170 DNGYKVYYSNGCQIIPPVDASIAKCIDENLEPWSNSWDSSKAI----------EAGLS-- 217
           D G K   SNG     P   S+   I          WD SK +          E  LS  
Sbjct: 130 DIGIKYNLSNGG----PAPESVTNAI----------WDISKKLTHYKIVKGFPEINLSVK 175

Query: 218 -NKKLIYLRNEMLLAYSDKVD--NNIIDKKTIREF-DEHR--KPW-FVYTPMHGVGYEIF 270
             K    L  +++    + VD    I D   I++F D  R  K W  ++  ++GV     
Sbjct: 176 GEKSYGSLVIDVVDTTQEYVDFLKGIFDFDLIKKFVDTQRSTKNWKLLFDGLNGVTGPYG 235

Query: 271 TSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPEEKGALDMAIALAKENDISLVIA 330
            ++ ++++ L EN     V +   P P F  I  P+P    A  +   + KE  I    A
Sbjct: 236 RAIFVDELGLPENE----VLQNCHPKPDFGGIH-PDPNLTYARTLVDRVDKEK-IEFGAA 289

Query: 331 NDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLFNKYTNMDPEFKKNHPLAMLNSTV 390
           +D D DR    IY    G      G+ +       +  +Y +  P F +N    +  S  
Sbjct: 290 SDGDGDR--NMIYG--YGPAFVSPGDSVA------IIAEYASEIPYFAQNGIYGLARSFP 339

Query: 391 SSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEGYHVVFGYEEAIGYMFPAMEHDKD 450
           +S  +  +A  +        TG+K+      D KK    +    EE+ G     +  +KD
Sbjct: 340 TSTAIDRVAKAKGLNCYVVPTGWKFF-CALFDAKK----LSICGEESFGTGSNHV-REKD 393

Query: 451 GITASVVFLQ--AYFEWDNLSK-VTVIDILEQGIEKYGA--FKEYNGYYVVSNP--QVTN 503
           G+ A + +L   A +   N  K  ++  I E+   KYG   F  Y+  +V S    ++ +
Sbjct: 394 GVWAVIAWLNILAIYNKHNPEKEASIKTIQEEFWLKYGRTFFTRYDFEHVTSEDANRLVS 453

Query: 504 DIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNIPSLPVDPSSQMITIT 563
           ++  +I      N N    +IG+ L   S   +T     +  D   S+  +     +T++
Sbjct: 454 ELERFI------NSND---VIGSSLSPESPVKVTEAGDFEYTDLDGSVS-EHQGMYVTLS 503

Query: 564 AKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHSKDPIAASKIAKLTWDVLKKEWIRP 623
                     +  +VR +  GS +   ++LYIE +  D        KL +    +E++RP
Sbjct: 504 --------NGAKFVVRLSGTGS-SGATIRLYIEQYCDD--------KLKYSQSSEEYLRP 546

Query: 624 EVTGV 628
            +  V
Sbjct: 547 IIKSV 551

>Kpol_1018.161 s1018 (412372..414081) [1710 bp, 569 aa] {ON}
           (412372..414081) [1710 nt, 570 aa]
          Length = 569

 Score = 42.4 bits (98), Expect = 0.003,   Method: Compositional matrix adjust.
 Identities = 111/457 (24%), Positives = 180/457 (39%), Gaps = 78/457 (17%)

Query: 62  GTAGLRSKMEAGFSRMN-TLVVLQATQGLATYIKQQFPSNLKA---VIGHDHRYHSKEFA 117
           GT+GLR K +      N T   +QAT           P   K    V+G D RY++    
Sbjct: 19  GTSGLRKKTKVFAEEPNYTENFIQATM-------DAIPEGCKGATLVVGGDGRYYNDVIM 71

Query: 118 EIATSVFLSAGFTVYNLNPPGTFVHTPLVPFTVDQIG--ASVGVMITASHN---PKMDNG 172
               S+  + G     +   G  + TP     +       + G+++TASHN   PK D G
Sbjct: 72  NKIVSIAGANGVRKLIIGHNG-ILSTPAASHVIRSYKEKCTGGIILTASHNPGGPKNDIG 130

Query: 173 YKVYYSNGCQIIPPVDASIAKCIDENLEPWSNSWDSSKAIE-----AGL----SNKKLIY 223
            K   +NG     P   S+   I          W++SK +       GL    ++K  + 
Sbjct: 131 IKYNLANGG----PAPESVTNAI----------WEASKKLTEYKVIEGLPELDTSKIAVD 176

Query: 224 LRNEMLL--------AYSDKVDNNIIDKKTIREF---DEHRKPW-FVYTPMHGVGYEIFT 271
           ++   LL        AY D +   I D K I+EF       K W  ++  ++GV      
Sbjct: 177 IKYGPLLVDIIDSTEAYVDYL-KEIFDFKLIKEFVTKQRETKGWKLLFDSLNGVTGPYGE 235

Query: 272 SLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPEEKGALDMAIALAKENDISLVIAN 331
           ++ ++++ L  +     V +   P P F  +  P+P    A  +   + KEN I    A+
Sbjct: 236 AIFVKELGLPADE----VLQNWHPLPDFGGLH-PDPNLTYAHTLVERVDKEN-IQFGAAS 289

Query: 332 DPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLFNKYTNMDPEFKKNHPLAMLNSTVS 391
           D D DR    IY   +G      G+ +       + ++Y +  P F K     +  S  +
Sbjct: 290 DGDGDR--NMIYG--AGPAFVSPGDSVA------IISEYADEIPYFAKQGIYGVARSFPT 339

Query: 392 SRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEGYHVVFGYEEAIGYMFPAMEHDKDG 451
           S  L  +A  +     +  TG+K+      D K     V    EE+ G     +  +KDG
Sbjct: 340 SSALDRVAKAKGLNCYEVPTGWKFFCALFDDQK-----VSICGEESFGTGSNHI-REKDG 393

Query: 452 ITASVVFLQ--AYFEWDNLSK-VTVIDILEQGIEKYG 485
           + A V +L   A +   N +K  ++  I  +  +KYG
Sbjct: 394 VWAIVAWLNILAIYNKHNPTKDASIATIQHEFWQKYG 430

>NCAS0F00200 Chr6 complement(30474..32123) [1650 bp, 549 aa] {ON}
           Anc_6.11 YEL058W
          Length = 549

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 18/31 (58%), Positives = 21/31 (67%)

Query: 154 GASVGVMITASHNPKMDNGYKVYYSNGCQII 184
           G  VGVM+TASHNP +DNG KV    G  +I
Sbjct: 57  GTPVGVMVTASHNPPLDNGVKVVEPTGAMLI 87

>TBLA0G00980 Chr7 complement(248484..250160) [1677 bp, 558 aa] {ON}
           Anc_6.11 YEL058W
          Length = 558

 Score = 41.6 bits (96), Expect = 0.006,   Method: Compositional matrix adjust.
 Identities = 17/30 (56%), Positives = 22/30 (73%)

Query: 154 GASVGVMITASHNPKMDNGYKVYYSNGCQI 183
           G +VGVM+TASHNP +DNG K+   NG  +
Sbjct: 59  GKAVGVMVTASHNPPVDNGVKIVEPNGSML 88

>TDEL0G04600 Chr7 (838381..839967) [1587 bp, 528 aa] {ON} Anc_6.11
           YEL058W
          Length = 528

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 26/64 (40%), Positives = 33/64 (51%), Gaps = 2/64 (3%)

Query: 123 VFLSAGFTVYNLNPPGTFVHTPLVPFTVDQI--GASVGVMITASHNPKMDNGYKVYYSNG 180
           V+ +AGF   +         T +V     Q+  G  VGVMITASHNP  DNG KV   +G
Sbjct: 21  VYGTAGFRDDSEKLDTVMFATGIVACLRSQVLNGKPVGVMITASHNPSGDNGVKVVEPDG 80

Query: 181 CQII 184
             +I
Sbjct: 81  SMLI 84

>CAGL0B03597g Chr2 complement(359018..360640) [1623 bp, 540 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058w PCM1 phosphoacetylglucosamine mutase
          Length = 540

 Score = 41.2 bits (95), Expect = 0.008,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 22/30 (73%)

Query: 155 ASVGVMITASHNPKMDNGYKVYYSNGCQII 184
           A VGVMITASHNP  DNG K+  S+G  ++
Sbjct: 52  APVGVMITASHNPPRDNGVKIVESDGSMLL 81

>ABL029W Chr2 (343850..345556) [1707 bp, 568 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YKL127W (PGM1) and
           YMR105C (PGM2)
          Length = 568

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 98/418 (23%), Positives = 171/418 (40%), Gaps = 56/418 (13%)

Query: 62  GTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPS---NLKAVIGHDHRYHSKEFAE 118
           GT+GLR K +  F +         T+     I +  P    N   VIG D RY++    +
Sbjct: 19  GTSGLRKKTKV-FEQTE-----HYTENFIQAIMESIPEGSENAVLVIGGDGRYYNDAVMQ 72

Query: 119 IATSVFLSAGFTVYNLNPPGTFVHTPLVPFTVDQIGASV--GVMITASHNPKM-DNGYKV 175
               V  + G     +   G  + TP     +      V  G+++TASHNP   DN + +
Sbjct: 73  KIAEVGSANGVRKLIIGQNG-LLSTPAASHIIRTYHDKVTGGIILTASHNPGGPDNDFGI 131

Query: 176 YY--SNGCQIIPPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYS 233
            Y  +NG      V  S+ +    NL  +  +    K ++ G   +   Y    +L+   
Sbjct: 132 KYNLANGAPAPEKVTNSMFER-SRNLTHYKITRGMPK-LDLGKIGENQQY--GNLLVDVI 187

Query: 234 D------KVDNNIIDKKTIREFDEHRKPWF----VYTPMHGVGYEIFTSLVLEKVNLKEN 283
           D      ++   I D   I++F EH +  +    ++  ++G+      ++ ++++ L E+
Sbjct: 188 DPTEAYVRLMKEIFDFPLIKKFLEHAQKEYGLKVLFDALNGITGPYGKAIFVDELGLSED 247

Query: 284 RDYLTVKEQIVPDPAFPTISFPNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIY 343
                  +  VP P F  +  P+P    A  +   + +EN I+   A+D D DR    IY
Sbjct: 248 S-----LQNFVPKPDFGGLH-PDPNLTYAHTLVSRVDREN-IAFGAASDGDGDR--NMIY 298

Query: 344 NSHSGEWQQLTGNEIGFLFGYYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTEN 403
              +G      G+ +       +  +Y +  P F KN    +  S  +S  +  +A  +N
Sbjct: 299 G--AGPAFVSPGDSVA------IIAEYASEIPYFIKNGIHGLARSFPTSGAIDLVAKEKN 350

Query: 404 FKFIDTLTGFKWIGNKAIDLKKEGYHVVFGYEEAIGYMFPAMEH--DKDGITASVVFL 459
               +  TG+K+  N   D KK    +    EE+ G      +H  +KDG+ A V +L
Sbjct: 351 LDCYEVPTGWKFFCN-LFDSKK----LSICGEESFG---TGSDHVREKDGLWAIVAWL 400

>Kpol_1032.2 s1032 complement(1049..2668) [1620 bp, 539 aa] {ON}
           complement(1049..2668) [1620 nt, 540 aa]
          Length = 539

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 18/30 (60%), Positives = 21/30 (70%)

Query: 154 GASVGVMITASHNPKMDNGYKVYYSNGCQI 183
           G +VGVMITASHNP  DNG K+   NG  +
Sbjct: 51  GKAVGVMITASHNPPEDNGVKIVEPNGAML 80

>TBLA0I01380 Chr9 complement(297671..299386) [1716 bp, 571 aa] {ON}
           Anc_2.445 YKL127W
          Length = 571

 Score = 40.8 bits (94), Expect = 0.010,   Method: Compositional matrix adjust.
 Identities = 105/431 (24%), Positives = 163/431 (37%), Gaps = 80/431 (18%)

Query: 62  GTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKA---VIGHDHRYHSKEFAE 118
           GT+GLR K  A F +         T+     I +  P   K    V+G D RY++     
Sbjct: 20  GTSGLRKKT-AIFEKEPNY-----TENFIQAIMEAIPEGCKGATLVVGGDGRYYNDAILH 73

Query: 119 IATSVFLSAGFTVYNLNPPGTFVHTPLVPFTVDQIGA---SVGVMITASHNP---KMDNG 172
              ++  + G     +   G  + TP     +        + G+++TASHNP   K D G
Sbjct: 74  NIAAIGAANGVKKLIVGQNG-LLSTPAASHIIRTYAPGEITGGIILTASHNPGGPKNDMG 132

Query: 173 YKVYYSNGCQIIPPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAY 232
            K    NG     PV  +I              W++SK     L N K+I    E+ L  
Sbjct: 133 IKYNIQNGAPAPEPVTEAI--------------WEASKK----LQNYKIIKDFPELELKT 174

Query: 233 SDK--------VD------------NNIIDKKTIREF-DEHRKP--W-FVYTPMHGVGYE 268
             K        VD              I D   I++F D  RK   W  ++  M+GV   
Sbjct: 175 LGKNKQYGPLLVDVIDTCEAYVQFIKEIFDFPLIKKFVDTQRKTKNWKLLFDGMNGVTGP 234

Query: 269 IFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPEEKGALDMAIALAKENDISLV 328
              ++ ++++ L  +     V +   P P F     P+P    A  +   + KE  I   
Sbjct: 235 YGKAIFVDELGLPADE----VLKDWHPSPDFGG-HHPDPNLTYAKSLVDRVDKEK-IEFG 288

Query: 329 IANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLFNKYTNMDPEFKKNHPLAMLNS 388
            A+D D DR    IY    G      G+ +  +       +Y +  P FKKN    +  S
Sbjct: 289 AASDGDGDR--NMIYGY--GPAFVSPGDSVAII------AEYASDIPYFKKNGIYGLARS 338

Query: 389 TVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEGYHVVFGYEEAIGYMFPAMEHD 448
             ++  +  +A     K  +  TG+K+   K  D KK    V    EE+ G     +  +
Sbjct: 339 FPTASSIDRVAKAHGLKAYEVPTGWKFF-CKLFDSKK----VSICGEESFGTGSNHV-RE 392

Query: 449 KDGITASVVFL 459
           KDG+ A + +L
Sbjct: 393 KDGVWAIIAWL 403

>Kwal_26.7628 s26 (449302..451014) [1713 bp, 570 aa] {ON} YMR105C
           (PGM2) - Phosphoglucomutase [contig 55] FULL
          Length = 570

 Score = 40.4 bits (93), Expect = 0.013,   Method: Compositional matrix adjust.
 Identities = 105/451 (23%), Positives = 184/451 (40%), Gaps = 66/451 (14%)

Query: 62  GTAGLRSKM-----EAGFSRMNTLVVLQATQGLATYIKQQFPSNLKAVIGHDHRYHSKEF 116
           GT+GLR K      E  ++      +L+A          +   N   V+G D RY++ E 
Sbjct: 19  GTSGLRKKTKVFKDEPHYTENFIQAILEAIP--------EGSENATLVVGGDGRYYNNEV 70

Query: 117 AEIATSVFLSAGFTVYNLNPPGTFVHTPLVPFTVDQI--GASVGVMITASHN---PKMDN 171
            +I  ++  + G     L   G  + TP     +       + G+++TASHN   P+ D 
Sbjct: 71  MQIIGAIAAANGVRKMILGQNG-ILSTPAASHIIRSYPEKCTGGIILTASHNPGGPENDF 129

Query: 172 GYKVYYSNGCQIIPPVDASIAKCIDENLEPWSN--------SWDSSKAIEAGLSNKKLIY 223
           G K   SNG     P   S+   I E  +  ++          D SK  +    ++K   
Sbjct: 130 GIKYNLSNGG----PAPESVTNAIFEKSKQLTHYKIVKNFPKIDFSKIGK----DQKYGP 181

Query: 224 LRNEMLLAYSDKVD--NNIIDKKTIREFDEHRKPW----FVYTPMHGVGYEIFTSLVLEK 277
           L  +++ + +D V     I D   I++F ++++       ++  ++GV      ++ +++
Sbjct: 182 LLVDVVDSTADYVALMKEIFDFDLIKKFIDNQRSTKGFKILFDSLNGVTGPYGEAIFVKE 241

Query: 278 VNLKENRDYLTVKEQIVPDPAFPTISFPNPEEKGALDMAIALAKENDISLVIANDPDADR 337
           + L        V +  VP P F  +  P+P    A  +   + KE  I+   A+D D DR
Sbjct: 242 LGLPAEE----VLQNYVPKPDFGGLH-PDPNLTYAHTLVERVDKEQ-IAFGAASDGDGDR 295

Query: 338 FSAAIYNSHSGEWQQLTGNEIGFLFGYYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKS 397
               IY    G      G+ +       +  +Y +  P FKK     +  S  +S  +  
Sbjct: 296 --NMIYG--CGPAFVSPGDSVA------IIAEYASEIPYFKKQGIYGLARSFPTSAAIDR 345

Query: 398 MADTENFKFIDTLTGFKWIGNKAIDLKKEGYHVVFGYEEAIGYMFPAMEHDKDGITASVV 457
           +A  +     +  TG+K+      D KK    +    EE+ G     +  +KDG+ A V 
Sbjct: 346 VAKEQGLACYEVPTGWKFF-CALFDAKK----LSICGEESFGTGSNHV-REKDGVWAIVA 399

Query: 458 FLQ--AYFEWDNL-SKVTVIDILEQGIEKYG 485
           +L   A +  D+  S V++  I E+   KYG
Sbjct: 400 WLNILAIYNRDHPDSDVSIKVIQEKFWAKYG 430

>KNAG0E02390 Chr5 (475467..477176) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 40.0 bits (92), Expect = 0.017,   Method: Compositional matrix adjust.
 Identities = 106/457 (23%), Positives = 183/457 (40%), Gaps = 50/457 (10%)

Query: 62  GTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKA---VIGHDHRYHSKEFAE 118
           GT+GLR K  A F+          T+     + +  P   K    V+G D RY++     
Sbjct: 19  GTSGLRKKT-AVFTNEP-----HYTENFIQAVMEAIPEGCKGATLVVGGDGRYYNDVILH 72

Query: 119 IATSVFLSAGFTVYNLNPPGTFVHTPLVPFTVD--QIGASVGVMITASHN---PKMDNGY 173
              ++  + G     +   G  + TP     +   +   + G+++TASHN   PK D G 
Sbjct: 73  KIAAIGAANGVRKLVIGQNG-LLSTPAASHIMRTYKEKCTGGIILTASHNPGGPKNDMGI 131

Query: 174 KVYYSNGCQIIPPVDASIAKCIDENLEPWSNSWDSSK-AIEAGLSNKKLIYLRNEMLLAY 232
           K   SNG     PV   I + + + L+ +    D  + A++    N +   L  +++   
Sbjct: 132 KYNLSNGGPAPEPVTNKIWE-VSKQLDHYKIIPDLPELALDTLAENVQYGPLLVDVVDTT 190

Query: 233 SDKVD--NNIIDKKTIREF---DEHRKPW-FVYTPMHGVGYEIFTSLVLEKVNLKENRDY 286
            D V+    I D   I+ F      +K W  ++  M+GV      ++ +++  L      
Sbjct: 191 RDYVEFLKEIFDFPLIKSFIHKQRSQKHWKLLFDGMNGVTGPYGKAIFVDEFELPAEE-- 248

Query: 287 LTVKEQIVPDPAFPTISFPNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSH 346
             V +   P P F  I  P+P    A  +   + +EN I    A+D D DR    IY   
Sbjct: 249 --VLQNWHPQPDFGGIH-PDPNLTYARSLVDRVDREN-IEFGAASDGDGDR--NMIYG-- 300

Query: 347 SGEWQQLTGNEIGFLFGYYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKF 406
           +G      G+ +       +  +Y    P F K     +  S  ++  +  +A+    K 
Sbjct: 301 AGPAFVSPGDSVA------IIAEYAAEIPYFAKQGIYGLARSFPTASAIDRVAEKHGLKC 354

Query: 407 IDTLTGFKWIGNKAIDLKKEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYFEWD 466
            +  TG+K+      D KK    +    EE+ G     +  +KDG+ A + +L     ++
Sbjct: 355 YEVPTGWKFF-CALFDAKK----LSICGEESFGTGSNHV-REKDGVWAIIAWLNLLAIYN 408

Query: 467 NL---SKVTVIDILEQGIEKYGA--FKEYNGYYVVSN 498
                  V++  I E+  +KYG   F  Y+  +V SN
Sbjct: 409 RRHPDRDVSIKIIQEEFWKKYGRVFFTRYDYEHVDSN 445

>KAFR0L00340 Chr12 complement(62157..63779) [1623 bp, 540 aa] {ON}
           Anc_6.11 YEL058W
          Length = 540

 Score = 39.7 bits (91), Expect = 0.020,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 154 GASVGVMITASHNPKMDNGYKVYYSNGCQII 184
           G  +GVMITASHNP  DNG K+   +G  +I
Sbjct: 56  GKYIGVMITASHNPPQDNGVKIVEPSGAMLI 86

>Smik_5.29 Chr5 (45538..47205) [1668 bp, 555 aa] {ON} YEL058W (REAL)
          Length = 555

 Score = 39.3 bits (90), Expect = 0.033,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 154 GASVGVMITASHNPKMDNGYKVYYSNGCQII 184
           G  VGVMITASHNP  DNG K+   +G  ++
Sbjct: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87

>YEL058W Chr5 (43252..44925) [1674 bp, 557 aa] {ON}  PCM1Essential
           N-acetylglucosamine-phosphate mutase; converts
           GlcNAc-6-P to GlcNAc-1-P, which is a precursor for the
           biosynthesis of chitin and for the formation of
           N-glycosylated mannoproteins and
           glycosylphosphatidylinositol anchors
          Length = 557

 Score = 39.3 bits (90), Expect = 0.034,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 154 GASVGVMITASHNPKMDNGYKVYYSNGCQII 184
           G  VGVMITASHNP  DNG K+   +G  ++
Sbjct: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87

>Skud_5.31 Chr5 (42262..43935) [1674 bp, 557 aa] {ON} YEL058W (REAL)
          Length = 557

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 154 GASVGVMITASHNPKMDNGYKVYYSNGCQII 184
           G  VGVMITASHNP  DNG K+   +G  ++
Sbjct: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87

>KNAG0E00940 Chr5 (176887..178503) [1617 bp, 538 aa] {ON} Anc_6.11
           YEL058W
          Length = 538

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 17/22 (77%), Positives = 18/22 (81%)

Query: 154 GASVGVMITASHNPKMDNGYKV 175
           GA VGVM+TASHNP  DNG KV
Sbjct: 55  GAQVGVMVTASHNPPEDNGVKV 76

>Suva_5.10 Chr5 (19280..20941) [1662 bp, 553 aa] {ON} YEL058W (REAL)
          Length = 553

 Score = 38.9 bits (89), Expect = 0.035,   Method: Compositional matrix adjust.
 Identities = 17/31 (54%), Positives = 21/31 (67%)

Query: 154 GASVGVMITASHNPKMDNGYKVYYSNGCQII 184
           G  VGVMITASHNP  DNG K+   +G  ++
Sbjct: 57  GQYVGVMITASHNPYQDNGVKIVEPDGSMLL 87

>NDAI0K02890 Chr11 (655311..656996) [1686 bp, 561 aa] {ON} Anc_6.11
           YEL058W
          Length = 561

 Score = 38.9 bits (89), Expect = 0.037,   Method: Compositional matrix adjust.
 Identities = 15/30 (50%), Positives = 22/30 (73%)

Query: 155 ASVGVMITASHNPKMDNGYKVYYSNGCQII 184
           +++GVM+TASHNP  DNG K+   NG  ++
Sbjct: 66  SAIGVMVTASHNPPEDNGVKIIEPNGSMLL 95

>Smik_13.291 Chr13 complement(460399..462108) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 38.5 bits (88), Expect = 0.049,   Method: Compositional matrix adjust.
 Identities = 79/307 (25%), Positives = 120/307 (39%), Gaps = 61/307 (19%)

Query: 62  GTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKA---VIGHDHRYHSKEFAE 118
           GT+GLR K +    + N       T+     I +  P   K    V+G D RY++     
Sbjct: 19  GTSGLRKKTKVFKDQPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 119 IATSVFLSAGFTVYNLNPPGTFVHTPLVPFTVD--QIGASVGVMITASHN---PKMDNGY 173
              ++  + G     +   G  + TP     +   +   + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGAANGVKKLVIGQHG-LLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGI 131

Query: 174 KVYYSNGCQIIPPVDASIAKCIDENLEPWSNSWDSSKAI----------EAGLS----NK 219
           K   SNG     P   S+   I          WD SK +          E  L+    NK
Sbjct: 132 KYNLSNGG----PAPESVTNVI----------WDISKKLTSYKIIKDFPELDLATIGKNK 177

Query: 220 KLIYLRNEMLLAYSDKVD--NNIIDKKTIREF-DEHR--KPW-FVYTPMHGVGYEIFTSL 273
           K   L  +++    D VD    I D K I++F D  R  K W  ++  M+GV      ++
Sbjct: 178 KYGPLLVDIIDITKDYVDFLKEIFDFKLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAI 237

Query: 274 VLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPEEKGALDMAIALAKEND---ISLVIA 330
            +++  L  +     V +   P P F  +  P+P     L  A  L K  D   I    A
Sbjct: 238 FVDEFGLPADE----VLQNWHPSPDFGGMH-PDPN----LTYASTLVKRVDREKIEFGAA 288

Query: 331 NDPDADR 337
           +D D DR
Sbjct: 289 SDGDGDR 295

>ZYRO0F00506g Chr6 complement(49579..51231) [1653 bp, 550 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 550

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 16/27 (59%), Positives = 20/27 (74%)

Query: 154 GASVGVMITASHNPKMDNGYKVYYSNG 180
           G  +GVM+TASHNP +DNG KV   +G
Sbjct: 56  GDVIGVMVTASHNPPVDNGVKVVEPDG 82

>Kwal_56.22355 s56 complement(62955..64580) [1626 bp, 541 aa] {ON}
           YEL058W (PCM1) - Phosphoacetylglucosamine Mutase [contig
           186] FULL
          Length = 541

 Score = 37.7 bits (86), Expect = 0.079,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 19/27 (70%)

Query: 154 GASVGVMITASHNPKMDNGYKVYYSNG 180
           G +VGVMITASHNP  DNG K+    G
Sbjct: 55  GKTVGVMITASHNPPEDNGVKIVDPKG 81

>KLTH0C11506g Chr3 (944869..946503) [1635 bp, 544 aa] {ON} similar
           to uniprot|P38628 Saccharomyces cerevisiae YEL058W PCM1
           Essential N-acetylglucosamine- phosphate mutase a
           hexosephosphate mutase involved in the biosynthesis of
           chitin
          Length = 544

 Score = 37.7 bits (86), Expect = 0.082,   Method: Compositional matrix adjust.
 Identities = 16/22 (72%), Positives = 18/22 (81%)

Query: 154 GASVGVMITASHNPKMDNGYKV 175
           G +VGVMITASHNP  DNG K+
Sbjct: 55  GRTVGVMITASHNPPEDNGVKI 76

>ACR015W Chr3 (383130..384788) [1659 bp, 552 aa] {ON} Syntenic
           homolog of Saccharomyces cerevisiae YEL058W (PCM1)
          Length = 552

 Score = 37.7 bits (86), Expect = 0.091,   Method: Compositional matrix adjust.
 Identities = 17/27 (62%), Positives = 20/27 (74%)

Query: 154 GASVGVMITASHNPKMDNGYKVYYSNG 180
           GA VGVM+TASHNP  DNG K+   +G
Sbjct: 55  GAYVGVMLTASHNPPEDNGVKLVDPHG 81

>SAKL0E00902g Chr5 complement(68682..70316) [1635 bp, 544 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 544

 Score = 37.7 bits (86), Expect = 0.098,   Method: Compositional matrix adjust.
 Identities = 24/58 (41%), Positives = 31/58 (53%), Gaps = 4/58 (6%)

Query: 121 TSVFLSAGFTVYNLNPPGTFVHTPLVPFTVDQI---GASVGVMITASHNPKMDNGYKV 175
           T  + +AGF  Y  +   T + T  +   +  I   G  VGVMITASHNP  DNG K+
Sbjct: 20  TYTYGTAGFR-YKADVLDTVMFTTGILAAIRSIYLKGQYVGVMITASHNPPQDNGVKI 76

>TPHA0M00210 Chr13 complement(42336..43973) [1638 bp, 545 aa] {ON}
           Anc_6.11 YEL058W
          Length = 545

 Score = 36.6 bits (83), Expect = 0.21,   Method: Compositional matrix adjust.
 Identities = 16/30 (53%), Positives = 20/30 (66%)

Query: 154 GASVGVMITASHNPKMDNGYKVYYSNGCQI 183
           G +VGVMITASHN   DNG K+   +G  +
Sbjct: 55  GKAVGVMITASHNQPCDNGVKIVEPDGSML 84

>KLLA0D00858g Chr4 complement(80327..81952) [1626 bp, 541 aa] {ON}
           similar to uniprot|P38628 Saccharomyces cerevisiae
           YEL058W PCM1 Essential N-acetylglucosamine-phosphate
           mutase a hexosephosphate mutase involved in the
           biosynthesis of chitin
          Length = 541

 Score = 36.2 bits (82), Expect = 0.26,   Method: Compositional matrix adjust.
 Identities = 16/19 (84%), Positives = 16/19 (84%)

Query: 157 VGVMITASHNPKMDNGYKV 175
           VGVMITASHNP  DNG KV
Sbjct: 54  VGVMITASHNPPEDNGVKV 72

>KAFR0D03010 Chr4 (594118..595827) [1710 bp, 569 aa] {ON} Anc_2.445
           YKL127W
          Length = 569

 Score = 36.2 bits (82), Expect = 0.30,   Method: Compositional matrix adjust.
 Identities = 131/573 (22%), Positives = 216/573 (37%), Gaps = 93/573 (16%)

Query: 62  GTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKA---VIGHDHRYHSKEFAE 118
           GT+GLR K        N       T+     I +  P        V+G D RY++    E
Sbjct: 19  GTSGLRKKTVIFKDEPNY------TENFIQAIMESIPEGSDGATLVVGGDGRYYNDVILE 72

Query: 119 IATSVFLSAGFTVYNLNPPGTFVHTPLVPFTVDQIGASV--GVMITASHN---PKMDNGY 173
               +  + G     +   G  + TP     +      V  G+++TASHN   PK D G 
Sbjct: 73  KIAKIGAANGVKKLVVGQNG-LLSTPAASHIIRSYHEKVTGGIILTASHNPGGPKNDMGI 131

Query: 174 KVYYSNGCQIIPPVDASIAKCIDENLEPWSN--------SWDSSKAIEAGLSNKKLIYLR 225
           K   +NG     P   S+   I EN +  ++        + D+SK  E       LI + 
Sbjct: 132 KYNLANGG----PAPESVTDKIWENSKKLTSYKIIKDLPTLDTSKIGENQKYGPILIDVI 187

Query: 226 NEMLLAYSDKVDNNIIDKKTIREF---DEHRKPW-FVYTPMHGVGYEIFTSLVLEKVNLK 281
            ++  AY + +   I D + I++F       K W  ++  ++G+      ++ +++  L 
Sbjct: 188 -DVTKAYVEFL-KEIFDFELIKKFIHTQRKTKNWKLLFDGLNGITGPYGKAIFVDEFELP 245

Query: 282 ENRDYLTVKEQIVPDPAFPTISFPNPEEKGALDMAIALAKENDISLVIANDPDADRFSAA 341
           EN     V +   P P F  +  P+P    A  +   + KE  I    A+D D DR    
Sbjct: 246 ENE----VLQNYHPQPDFGGLH-PDPNLTYARSLVDRVDKEK-IEFGAASDGDGDR--NM 297

Query: 342 IYNSHSGEWQQLTGNEIGFLFGYYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADT 401
           IY    G      G+ +       +  +Y +  P F K     +  S  +S  +  +A  
Sbjct: 298 IYG--YGPAFVSPGDSVA------IIAEYASEIPYFAKQGIYGLARSFPTSAAIDRVAKA 349

Query: 402 ENFKFIDTLTGFKWIGNKAIDLKKEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQ- 460
              +  +  TG+K+      D KK    +    EE+ G     +  +KDG+ A V +L  
Sbjct: 350 HGLECYEVPTGWKFF-CALFDAKK----LSICGEESFGTGSNHV-REKDGLWAIVAWLNV 403

Query: 461 -AYFEWDNLSKVTVIDILEQGI-EKYGA--FKEYNGYYVVSNP--QVTNDIFHYIRNEYP 514
            A F   +  +   I  ++     KYG   F  Y+  +V S    +V + +  +  N   
Sbjct: 404 LAIFNKHHPEREASIKTIQDDFWLKYGRTFFTRYDYEHVTSEDANKVVDLLTEFTSNSKT 463

Query: 515 KNGNQYPKMIGTLLEVC---SFRDLTTGFQSDTVDNIPSLPVDPSSQMITITAKICDDEY 571
           KN   +P      +  C   S+ DL     S                   ++ K+ D   
Sbjct: 464 KNA-PFPGDESLTVTDCGNFSYTDLDGSVSSKQ----------------GLSVKLSDGS- 505

Query: 572 QKSDSIVRFTMRGSGTEPK---LKLYIEGHSKD 601
                  RF +R SGT      ++LY+E +S D
Sbjct: 506 -------RFVLRLSGTGSSGATIRLYVEKYSGD 531

>NCAS0F01470 Chr6 complement(293218..294927) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 35.8 bits (81), Expect = 0.33,   Method: Compositional matrix adjust.
 Identities = 87/370 (23%), Positives = 144/370 (38%), Gaps = 41/370 (11%)

Query: 62  GTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKA---VIGHDHRYHSKEFAE 118
           GT+GLR K +      N       T+     I    P   K    V+G D RY++     
Sbjct: 19  GTSGLRKKTKIFKDTPNY------TENFIQAIMDAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 119 IATSVFLSAGFTVYNLNPPGTFVHTPLVPFTVD--QIGASVGVMITASHNP---KMDNGY 173
              ++  + G     +   G  + TP     +   +     G+++TASHNP   K D G 
Sbjct: 73  KIAAIGAANGVKKLVIGQRG-LLSTPAASHIMRTYEEKTQGGIILTASHNPGGIKNDMGI 131

Query: 174 KVYYSNGCQIIPPVDASIAKCIDENLEPWSNSWDSSK-AIEAGLSNKKLIYLRNEML--- 229
           K   SNG     PV   I + I + +  +    D  +  +E    NKK   L  +++   
Sbjct: 132 KFNLSNGGPAPEPVTNKIWE-ISKKMTSFKIIKDFPELELETLGKNKKYGPLLVDVIDTT 190

Query: 230 LAYSDKVDNNIIDKKTIREF---DEHRKPW-FVYTPMHGVGYEIFTSLVLEKVNLKENRD 285
            AY + V   I D   I++F       K W  ++  M+GV      ++ ++++ L  +  
Sbjct: 191 KAYVEFV-KQIFDFDLIKKFVHKQRDTKHWKLLFDGMNGVTGPYGKAIFVDELGLPADE- 248

Query: 286 YLTVKEQIVPDPAFPTISFPNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNS 345
              V +Q  P P F  +  P+P    A  +   + +EN I    A+D D DR    IY  
Sbjct: 249 ---VLQQWHPSPDFGGVH-PDPNLTYAKALVDRVDREN-IEFGAASDGDGDR--NMIYG- 300

Query: 346 HSGEWQQLTGNEIGFLFGYYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFK 405
            +G      G+ +       +  +Y    P F K     +  S  +S  +  +A      
Sbjct: 301 -AGPAFVSPGDSVA------IIAEYAAEIPYFAKQGIYGLARSFPTSSAIDRVAKAHGLN 353

Query: 406 FIDTLTGFKW 415
             +  TG+K+
Sbjct: 354 CYEVPTGWKF 363

>KLTH0D04796g Chr4 (437416..439128) [1713 bp, 570 aa] {ON} highly
           similar to uniprot|P37012 Saccharomyces cerevisiae
           YMR105C PGM2 Phosphoglucomutase catalyzes the conversion
           from glucose-1-phosphate to glucose-6-phosphate which is
           a key step in hexose metabolism functions as the
           acceptor for a Glc-phosphotransferase and to YKL127W
           uniprot|P33401 Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 570

 Score = 35.8 bits (81), Expect = 0.40,   Method: Compositional matrix adjust.
 Identities = 96/445 (21%), Positives = 174/445 (39%), Gaps = 54/445 (12%)

Query: 62  GTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLK---AVIGHDHRYHSKEFAE 118
           GT+GLR K +   +  +       T+     I +  P   +    V+G D RY++ E  +
Sbjct: 19  GTSGLRKKTKVFMNEPHY------TENFIQAIMEAIPEGSQDAVLVVGGDGRYYNNEVLQ 72

Query: 119 IATSVFLSAGFTVYNLNPPGTFVHTPLVPFTVDQI--GASVGVMITASHN---PKMDNGY 173
               +  + G     +   G  + TP     +      ++ G+++TASHN   P+ D G 
Sbjct: 73  KIGEIGAANGVKKLIVGQNG-LLSTPAASHIIRSYPEKSTGGIILTASHNPGGPENDFGI 131

Query: 174 KVYYSNGCQIIPPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAYS 233
           K   SNG     P   S+   I E  +  ++        +  LS          +L+   
Sbjct: 132 KYNLSNGG----PAPESVTNSIFEKSKQLASYKTVKNFPKINLSKIGKNQEYGSLLVDVI 187

Query: 234 D------KVDNNIIDKKTIREFDEHRKPW----FVYTPMHGVGYEIFTSLVLEKVNLKEN 283
           D      K+   I D   I++F +H++       ++  ++G+      ++  +++ L   
Sbjct: 188 DVTAEYVKLMKEIFDFDLIKKFIDHQRSTKGFKILFDALNGITGPYGKAIFADELGLPAE 247

Query: 284 RDYLTVKEQIVPDPAFPTISFPNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIY 343
                V +   P P F  +  P+P    A  +   + KE  I+   A+D D DR    IY
Sbjct: 248 E----VLQNYEPKPDFGGLH-PDPNLTYAHTLVERVDKEQ-IAFGAASDGDGDR--NMIY 299

Query: 344 NSHSGEWQQLTGNEIGFLFGYYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTEN 403
               G      G+ +       +  +Y +  P FKK     +  S  +S  +  +A  + 
Sbjct: 300 G--CGPAFVSPGDSVA------IIAEYASEIPYFKKQGIYGLARSFPTSAAIDRVAKAQG 351

Query: 404 FKFIDTLTGFKWIGNKAIDLKKEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFLQAYF 463
               +  TG+K+      D KK    +    EE+ G     +  +KDG+ A V +L    
Sbjct: 352 LNCYEVPTGWKFF-CALFDAKK----LSICGEESFGTGSNHV-REKDGVWAIVAWLNILA 405

Query: 464 EWDNL---SKVTVIDILEQGIEKYG 485
            ++     S V++  +L++   KYG
Sbjct: 406 IYNREHPDSDVSIKVVLDEFWAKYG 430

>NDAI0H02350 Chr8 complement(571624..573333) [1710 bp, 569 aa] {ON}
           Anc_2.445 YKL127W
          Length = 569

 Score = 35.4 bits (80), Expect = 0.49,   Method: Compositional matrix adjust.
 Identities = 83/369 (22%), Positives = 144/369 (39%), Gaps = 39/369 (10%)

Query: 62  GTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKA---VIGHDHRYHSKEFAE 118
           GT+GLR K      + +       T+     I    P   K    V+G D RY++     
Sbjct: 19  GTSGLRKKTRVFKDKPHY------TENFIQAIMDAIPEGAKGATLVVGGDGRYYNDVILH 72

Query: 119 IATSVFLSAGFTVYNLNPPGTFVHTPLVPFTVD--QIGASVGVMITASHNP---KMDNGY 173
              ++  + G     +   G  + TP     +   +   + G+++TASHNP   + D G 
Sbjct: 73  KIAAIGAANGVKKLVVGQHG-LLSTPAASHIMRTYEEKTTGGIILTASHNPGGLENDMGI 131

Query: 174 KVYYSNGCQIIPPVDASIAKCIDENLEPWSNSWDSSK-AIEAGLSNKKLIYLRNEMLLAY 232
           K   SNG     PV   I + I + +  +    D  +  +E    NKK   L  +++   
Sbjct: 132 KYNLSNGGPAPEPVTNKIWE-ISKKMTHYKIIKDFPELELETLGKNKKYGPLLVDVIDIT 190

Query: 233 SDKVD--NNIIDKKTIREF---DEHRKPW-FVYTPMHGVGYEIFTSLVLEKVNLKENRDY 286
              VD    I D + I++F      +K W  ++  M+GV      ++ +++  L  +   
Sbjct: 191 KAYVDFLKEIFDFELIKKFIHNQREKKHWKLLFDGMNGVTGPYGKAIFVDEFGLPADE-- 248

Query: 287 LTVKEQIVPDPAFPTISFPNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIYNSH 346
             V +Q  P P F  +  P+P    A  +   + +E  I    A+D D DR    IY   
Sbjct: 249 --VLQQWHPQPDFGGVH-PDPNLTYAKALVDRVNREK-IEFGAASDGDGDR--NMIYG-- 300

Query: 347 SGEWQQLTGNEIGFLFGYYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTENFKF 406
           +G      G+ +       +  +Y +  P FKK     +  S  ++  +  +A       
Sbjct: 301 AGPAFVSPGDSVA------IIAEYASEIPYFKKQGIYGLARSFPTASSIDRVAKAHGLNC 354

Query: 407 IDTLTGFKW 415
               TG+K+
Sbjct: 355 YQVPTGWKF 363

>Ecym_3014 Chr3 complement(28261..29916) [1656 bp, 551 aa] {ON}
           similar to Ashbya gossypii ACR015W
          Length = 551

 Score = 35.0 bits (79), Expect = 0.61,   Method: Compositional matrix adjust.
 Identities = 15/22 (68%), Positives = 16/22 (72%)

Query: 154 GASVGVMITASHNPKMDNGYKV 175
           G  VG MITASHNP  DNG K+
Sbjct: 55  GQYVGAMITASHNPPQDNGVKL 76

>SAKL0E03630g Chr5 complement(294321..296036) [1716 bp, 571 aa] {ON}
           highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105C PGM2 Phosphoglucomutase catalyzes the
           conversion from glucose-1-phosphate to
           glucose-6-phosphate which is a key step in hexose
           metabolism functions as the acceptor for a
           Glc-phosphotransferase and to YKL127W uniprot|P33401
           Saccharomyces cerevisiae YKL127W PGM1
           Phosphoglucomutase, minor isoform; catalyzes the
           conversion from glucose-1-phosphate to glucose-6-
           phosphate, which is a key step in hexose metabolism
          Length = 571

 Score = 35.0 bits (79), Expect = 0.67,   Method: Compositional matrix adjust.
 Identities = 100/450 (22%), Positives = 172/450 (38%), Gaps = 63/450 (14%)

Query: 62  GTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFP---SNLKAVIGHDHRYHSKEFAE 118
           GT+GLR K +      N       T+     +    P    +   V+G D R+++    +
Sbjct: 19  GTSGLRKKTKVFMEEPNY------TENFIQAVMDAIPEGSQDATLVVGGDGRFYNDVVVQ 72

Query: 119 IATSVFLSAGFTVYNLNPPGTFVHTPLVPF---TVDQIGASVGVMITASHNP---KMDNG 172
              ++  + G     +   G  + TP       T      + G+++TASHNP   K D G
Sbjct: 73  KIAAIGAANGVHKLVIGQNG-ILSTPAASHIIRTYPHAKITGGIILTASHNPGGAKNDFG 131

Query: 173 YKVYYSNGCQIIPPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLLAY 232
            K   SNG     P   S+   I E  +  ++    +   +  LS K        +L+  
Sbjct: 132 IKYNLSNGG----PAPESVTNKIFEKSKQLTSYKIVANFPQLDLSKKGTDQRYGPLLVDI 187

Query: 233 SDKVDNNIIDKKTIREFDEHRKPWFVYTPMHGVGYEIF------------TSLVLEKVNL 280
            D  +  +   K+I +FD  +K  F+ T    VG+++              +L ++++ L
Sbjct: 188 IDSTEAYVKLMKSIFDFDLIKK--FIKTQKETVGFKLLFDSLNGVTGPYGKALFVDELGL 245

Query: 281 KENRDYLTVKEQIVPDPAFPTISFPNPEEKGALDMAIALAKENDISLVIANDPDADRFSA 340
                     +  VP P F  +  P+P    A  +   + K+  I+   A+D D DR   
Sbjct: 246 SAEESL----QNYVPKPDFGGLH-PDPNLTYAHTLVERVDKDK-IAFGAASDGDGDR--N 297

Query: 341 AIYNSHSGEWQQLTGNEIGFLFGYYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMAD 400
            IY    G      G+ +       +  +Y +  P F K     +  S  +S  +  +A 
Sbjct: 298 MIYG--YGPAFVSPGDSVA------IIAEYASEIPYFAKQGIYGLARSFPTSAAIDRVAK 349

Query: 401 TENFKFIDTLTGFKWIGNKAIDLKKEGYHVVFGYEEAIGYMFPAMEH--DKDGITASVVF 458
                  +  TG+K+      D KK    +    EE+ G       H  +KDG+ A + +
Sbjct: 350 AHGLNCYEVPTGWKFF-CALFDAKK----LSICGEESFG---TGSNHVREKDGVWAIMAW 401

Query: 459 LQ--AYFEWDNLSK-VTVIDILEQGIEKYG 485
           L   A +   N +K  ++  I E+   KYG
Sbjct: 402 LNILAIYNRKNPTKEASIKTIQEEFWNKYG 431

>Kpol_1033.54 s1033 (136243..137955) [1713 bp, 570 aa] {ON}
           (136243..137955) [1713 nt, 571 aa]
          Length = 570

 Score = 34.7 bits (78), Expect = 0.88,   Method: Compositional matrix adjust.
 Identities = 34/128 (26%), Positives = 54/128 (42%), Gaps = 16/128 (12%)

Query: 62  GTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLK---AVIGHDHRYHSKEFAE 118
           GT+GLR K +   S  N       T+     I    P+ +K    V+G D R+++    +
Sbjct: 19  GTSGLRKKTKIFMSEKN------YTENFIQSILNSIPNGVKNSTIVVGGDGRFYNDIILD 72

Query: 119 IATSVFLSAGFTVYNLNPPGTFVHTPLVPFTVDQIGASV---GVMITASHN---PKMDNG 172
               +  + G     +   G  + TP   + +     S    G+++TASHN   P+ D G
Sbjct: 73  KIMQISAANGVRKLVIGQNG-ILSTPAASYIIRNYKESCNGGGIILTASHNPGGPENDIG 131

Query: 173 YKVYYSNG 180
            K   SNG
Sbjct: 132 IKYNLSNG 139

>CAGL0K03421g Chr11 complement(314680..316386) [1707 bp, 568 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c Phosphoglucomutase 2
          Length = 568

 Score = 33.9 bits (76), Expect = 1.2,   Method: Compositional matrix adjust.
 Identities = 86/377 (22%), Positives = 143/377 (37%), Gaps = 55/377 (14%)

Query: 62  GTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKA---VIGHDHRYHSKEFAE 118
           GT+GLR K +    + N +      +     + +  P   K    V+G D RY++    +
Sbjct: 18  GTSGLRKKTKVFEDQPNYV------ENFIQSVMEAIPEGAKGAVLVVGGDGRYYNDVILQ 71

Query: 119 IATSVFLSAGFTVYNLNPPGTFVHTPLVPFTVD--QIGASVGVMITASHN---PKMDNGY 173
              ++  + G     +   G  + TP     +   +   + G+++TASHN   P+ D G 
Sbjct: 72  KIAAIGAANGVKKLVIGQNG-LLSTPAASHIMRTYKEKCTGGIILTASHNPGGPENDMGI 130

Query: 174 KVYYSNGCQIIPPVDASIAKCIDENLEPWS-----NSWDSSKAIEAGLSNKKLIYLRNEM 228
           K   SNG     PV   I + I + L  +         D +K +E    NKK       +
Sbjct: 131 KYNLSNGGPAPEPVTNKIWE-ISKKLTHYKIVKDFPELDLTKLVE----NKKY----GPL 181

Query: 229 LLAYSDKVDNNIIDKKTIREFD---------EHRKPW-FVYTPMHGVGYEIFTSLVLEKV 278
           L+   D  D  I   K I +F+            K W  +   M+GV      ++ +++ 
Sbjct: 182 LVDVIDTTDAYIQLLKEIFDFELIHKFIAKQRKEKGWKLLVDSMNGVTGPYAKAIFVDEF 241

Query: 279 NLKENRDYLTVKEQIVPDPAFPTISFPNPEEKGALDMAIALAKENDISLVIANDPDADRF 338
            L    D   V +   P P F  +  P+P    A  +   + KE  I    A+D D DR 
Sbjct: 242 GL----DSKEVLQNWHPQPDFGGLH-PDPNLTYAHTLVERVNKEK-IEFGAASDGDGDR- 294

Query: 339 SAAIYNSHSGEWQQLTGNEIGFLFGYYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSM 398
              IY    G      G+ +       +  +Y N  P FKK     +  S  ++  +  +
Sbjct: 295 -NMIYG--YGPAFVSPGDSVA------IIAEYANEIPYFKKQGIYGLARSFPTASAIDRV 345

Query: 399 ADTENFKFIDTLTGFKW 415
           A        +  TG+K+
Sbjct: 346 AKKHGLNCYEVPTGWKF 362

>TPHA0E01970 Chr5 (406803..408842) [2040 bp, 679 aa] {ON} Anc_5.393
           YHR091C
          Length = 679

 Score = 33.9 bits (76), Expect = 1.6,   Method: Compositional matrix adjust.
 Identities = 40/144 (27%), Positives = 64/144 (44%), Gaps = 22/144 (15%)

Query: 450 DGITASVVFLQAYFEWDNLSKVTVIDILEQGIEKYGAFKEYNGYYVV---SNPQVTNDIF 506
           D + A+  FLQ +F+   L  + + DILE+G + YG++K      VV   S+P +    F
Sbjct: 173 DKVEANGPFLQFFFKPSALFNIVIPDILERG-DDYGSYKMEQKKTVVFDFSSPNIAKP-F 230

Query: 507 H-----------YIRNEYPKNGNQYPKM--IGTLLEVCSFRDLTTGFQSDTVDNIPSLPV 553
           H           +I N Y K G    ++  +G   +   F  L  GF+     N  SL  
Sbjct: 231 HAGHLRSTIIGGFISNLYEKLGWNVVRLNYLGDWGK--QFGLLAVGFEK--YGNEESLSK 286

Query: 554 DPSSQMITITAKICDDEYQKSDSI 577
           DP   +  +  K+  D  ++ DS+
Sbjct: 287 DPIHHLFDVYVKVNKDIEKEGDSL 310

>TPHA0G02900 Chr7 (622303..624012) [1710 bp, 569 aa] {ON} 
          Length = 569

 Score = 33.1 bits (74), Expect = 2.5,   Method: Compositional matrix adjust.
 Identities = 96/416 (23%), Positives = 161/416 (38%), Gaps = 51/416 (12%)

Query: 62  GTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPS---NLKAVIGHDHRYHSKEFAE 118
           GT+GLR K +   +  N       T+     I    P    N   V+G D R+++    +
Sbjct: 19  GTSGLRKKSKVFMNEPNY------TENFIQAILDAIPEGSENSTLVVGGDGRFYNDVILQ 72

Query: 119 IATSVFLSAGFTVYNLNPPGTFVHTPLVPFTVDQIGASV--GVMITASHN---PKMDNGY 173
           +   +  + G     +   G  + TP     +      V  G+++TASHN   P+ D G 
Sbjct: 73  LIAEIGAANGVRKLIIGQAG-ILSTPAASHIIRTYHEEVTGGIILTASHNPGGPENDIGI 131

Query: 174 KVYYSNGCQIIPPVDASIAKCIDE---NLEPWSNSWDSSKA-IEAGLSNKKLIYLRNEML 229
           K   +NG     P   S+   I E   NL  +    D  K  I     N K   L  +++
Sbjct: 132 KYNLANGG----PAPESVTNAIWEASKNLTTYKTMKDFPKIDINTISENVKYGPLLIDII 187

Query: 230 LAYSDKVD--NNIIDKKTIREFDEHRKP---W-FVYTPMHGVGYEIFTSLVLEKVNLKEN 283
            +  D V     I D   I++F E ++    W  ++  ++GV      ++ +++  L  +
Sbjct: 188 DSTEDYVKFLKEIFDFPLIKKFIETQRKTNNWKLLFDSLNGVTGPYGKAIFVDEFGLPAD 247

Query: 284 RDYLTVKEQIVPDPAFPTISFPNPEEKGALDMAIALAKENDISLVIANDPDADRFSAAIY 343
                V +   P P F  +  P+P    A  +   + KE  I    A+D D DR    IY
Sbjct: 248 E----VLQNWHPQPDFGGLH-PDPNLTYARTLVDRVDKEK-IEFGAASDGDGDR--NMIY 299

Query: 344 NSHSGEWQQLTGNEIGFLFGYYLFNKYTNMDPEFKKNHPLAMLNSTVSSRMLKSMADTEN 403
               G      G+ +       +  +Y N  P F K     +  S  +S  +  +A  + 
Sbjct: 300 G--YGPAFVSPGDSVA------IIAEYANEIPYFAKQGIYGVARSFPTSSAIDLVAKHKG 351

Query: 404 FKFIDTLTGFKWIGNKAIDLKKEGYHVVFGYEEAIGYMFPAMEHDKDGITASVVFL 459
               +  TG+K+      D KK    +    EE+ G     +  +KDG+ A + +L
Sbjct: 352 LDCYEVPTGWKFF-CALFDAKK----LSICGEESFGTGSNHV-REKDGVWAIIAWL 401

>YMR105C Chr13 complement(475897..477606) [1710 bp, 569 aa] {ON}
           PGM2Phosphoglucomutase, catalyzes the conversion from
           glucose-1-phosphate to glucose-6-phosphate, which is a
           key step in hexose metabolism; functions as the acceptor
           for a Glc-phosphotransferase
          Length = 569

 Score = 33.1 bits (74), Expect = 2.6,   Method: Compositional matrix adjust.
 Identities = 76/307 (24%), Positives = 118/307 (38%), Gaps = 61/307 (19%)

Query: 62  GTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKA---VIGHDHRYHSKEFAE 118
           GT+GLR K +      N       T+     I +  P   K    V+G D RY++     
Sbjct: 19  GTSGLRKKTKVFKDEPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILH 72

Query: 119 IATSVFLSAGFTVYNLNPPGTFVHTPLVPFTVD--QIGASVGVMITASHN---PKMDNGY 173
              ++  + G     +   G  + TP     +   +   + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGAANGIKKLVIGQHG-LLSTPAASHIMRTYEEKCTGGIILTASHNPGGPENDMGI 131

Query: 174 KVYYSNGCQIIPPVDASIAKCIDENLEPWSNSWDSSKAI----------EAGLS----NK 219
           K   SNG     P   S+   I          W+ SK +          E  L     NK
Sbjct: 132 KYNLSNGG----PAPESVTNAI----------WEISKKLTSYKIIKDFPELDLGTIGKNK 177

Query: 220 KLIYLRNEMLLAYSDKVD--NNIIDKKTIREF-DEHR--KPW-FVYTPMHGVGYEIFTSL 273
           K   L  +++    D V+    I D   I++F D  R  K W  ++  M+GV      ++
Sbjct: 178 KYGPLLVDIIDITKDYVNFLKEIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGPYGKAI 237

Query: 274 VLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPEEKGALDMAIALAKEND---ISLVIA 330
            +++  L  +     V +   P P F  +  P+P     L  A +L K  D   I    A
Sbjct: 238 FVDEFGLPADE----VLQNWHPSPDFGGMH-PDPN----LTYASSLVKRVDREKIEFGAA 288

Query: 331 NDPDADR 337
           +D D DR
Sbjct: 289 SDGDGDR 295

>Skud_13.263 Chr13 complement(451194..452903) [1710 bp, 569 aa] {ON}
           YKL127W (REAL)
          Length = 569

 Score = 32.3 bits (72), Expect = 3.8,   Method: Compositional matrix adjust.
 Identities = 77/312 (24%), Positives = 118/312 (37%), Gaps = 71/312 (22%)

Query: 62  GTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLKA---VIGHDHRYHSKEFAE 118
           GT+GLR K +    + N       T+     I +  P   K    V+G D RY++     
Sbjct: 19  GTSGLRKKTKVFKDQPNY------TENFIQSIMEAIPEGSKGATLVVGGDGRYYNDVILN 72

Query: 119 IATSVFLSAGFTVYNLNPPGTFVHTPLVPFTVD--QIGASVGVMITASHN---PKMDNGY 173
              ++  + G     +   G  + TP     +   +   + G+++TASHN   P+ D G 
Sbjct: 73  KIAAIGSANGIKKLVIGQYG-LLSTPAASHIMRTYEEECTGGIILTASHNPGGPENDMGI 131

Query: 174 KVYYSNGCQIIPPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLL--- 230
           K   SNG     P   S+   I          WD SK     L+N K++    E+ L   
Sbjct: 132 KYNLSNGG----PAPESVTNAI----------WDISKK----LTNYKIVKDFPELDLKTI 173

Query: 231 ------------------AYSDKVDNNIIDKKTIREF-DEHR--KPW-FVYTPMHGVGYE 268
                             AY D +   I D   I++F D  R  K W  ++  M+GV   
Sbjct: 174 GKNKKYGPLLIDVIDITKAYVDFL-KKIFDFDLIKKFIDNQRSTKNWKLLFDSMNGVTGP 232

Query: 269 IFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPEEKGALDMAIALAKEND---I 325
              ++ +++  L        V +   P P F  +  P+P     L  A +L K  D   I
Sbjct: 233 YGKAIFVDEFGLPAEE----VLQNWHPSPDFGGMH-PDPN----LTYASSLVKRVDREKI 283

Query: 326 SLVIANDPDADR 337
               A+D D DR
Sbjct: 284 EFGAASDGDGDR 295

>KLLA0F10527g Chr6 (969804..971084) [1281 bp, 426 aa] {ON} similar
           to uniprot|P32783 Saccharomyces cerevisiae YBR236C ABD1
           Methyltransferase catalyzes the transfer of a methyl
           group from S-adenosylmethionine to the GpppN terminus of
           capped mRNA
          Length = 426

 Score = 31.2 bits (69), Expect = 8.4,   Method: Compositional matrix adjust.
 Identities = 18/56 (32%), Positives = 26/56 (46%), Gaps = 11/56 (19%)

Query: 496 VSNPQVTNDIFH--YIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNIP 549
           V  P   N I+   +  NEY KNGN++P   G +          T +  D +DN+P
Sbjct: 297 VEKPSWGNSIYKVTFSNNEYQKNGNEFPSPFGQMY---------TFWLEDAIDNVP 343

>NCAS0H01720 Chr8 complement(326096..329251,329324..329329) [3162
           bp, 1053 aa] {ON} Anc_5.363 YHR077C
          Length = 1053

 Score = 31.6 bits (70), Expect = 8.9,   Method: Compositional matrix adjust.
 Identities = 27/123 (21%), Positives = 50/123 (40%), Gaps = 16/123 (13%)

Query: 480 GIEKYGAFKEYNGYYVVSNPQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTG 539
            IE    F EY+G ++++NP+                  Q  KM+  + +    R L   
Sbjct: 498 NIEILTVFLEYSGKFLINNPET---------------KPQMEKMVQLIRDKTKDRQLNIN 542

Query: 540 FQSDTVDNIPSLPVDPSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPKLKLYIEGHS 599
              + ++NI +L   PS + + +  K    E Q    ++R  +    ++  +KL  + H 
Sbjct: 543 -TKNALENIITLLYPPSVKSLNLKKKQYTPEQQFYRILIRSELSNIDSKHTIKLLRKAHW 601

Query: 600 KDP 602
            DP
Sbjct: 602 DDP 604

>CAGL0K07480g Chr11 complement(740462..742165) [1704 bp, 567 aa]
           {ON} highly similar to uniprot|P37012 Saccharomyces
           cerevisiae YMR105c PGM2 phosphoglucomutase
          Length = 567

 Score = 31.2 bits (69), Expect = 9.1,   Method: Compositional matrix adjust.
 Identities = 33/134 (24%), Positives = 53/134 (39%), Gaps = 15/134 (11%)

Query: 62  GTAGLRSKMEAGFSRMNTLVVLQATQGLATYIKQQFPSNLK---AVIGHDHRYHSKEFAE 118
           GT+GLR K +      N       T+     I    P   K    V+G D R+++    +
Sbjct: 17  GTSGLRKKTKVFMEEPNY------TENFIQAIMDAIPEGAKDAVLVVGGDGRFYNDVIMQ 70

Query: 119 IATSVFLSAGFTVYNLNPPGTFVHTPLVPFTVDQIG--ASVGVMITASHN---PKMDNGY 173
              ++  + G     +   G  + TP     +       + G+++TASHN   P+ D G 
Sbjct: 71  KIAAIGAANGVRKLIIGQNG-LLSTPAASHVIRSYAEKCTGGIILTASHNPGGPENDLGI 129

Query: 174 KVYYSNGCQIIPPV 187
           K   +NG     PV
Sbjct: 130 KYNLANGGPAPEPV 143

>KNAG0A06280 Chr1 (955994..957706) [1713 bp, 570 aa] {ON} 
          Length = 570

 Score = 31.2 bits (69), Expect = 9.8,   Method: Compositional matrix adjust.
 Identities = 136/617 (22%), Positives = 231/617 (37%), Gaps = 135/617 (21%)

Query: 62  GTAGLRSKMEAGFSRMNTLVVLQA---TQGLATYIKQQFPSNLK---AVIGHDHRYHSKE 115
           GT+GLR K         T V ++    T+     I +  P   K    VIG D R+++  
Sbjct: 20  GTSGLRKK---------TAVFMKEPHYTENFIQAILEAIPEGCKDATLVIGGDGRFYNDV 70

Query: 116 FAEIATSVFLSAGFTVYNLNPPGTFVHTPLVPFTVDQIG--ASVGVMITASHN---PKMD 170
                 ++  + G     +   G  + TP   + +      A+ G+++TASHN   P+ D
Sbjct: 71  VINKIAAISAANGVRKLVIGQNG-LLSTPATSYIIRSYKDKATGGIILTASHNPGGPEND 129

Query: 171 NGYKVYYSNGCQIIPPVDASIAKCIDENLEPWSNSWDSSKAIEAGLSNKKLIYLRNEMLL 230
            G K   +NG     P   S+   +          W+ SK     L++ K+I     + L
Sbjct: 130 MGIKYNLANGG----PAPESVTNAM----------WEISKK----LTSYKIIKDFPTLDL 171

Query: 231 AYSDKVDN---------NIIDKKTIREFDEHRKPWF--------------------VYTP 261
           +   K+ N         +IID  T +E+ E  K  F                    ++  
Sbjct: 172 S---KIGNDQKYGPLLVDIID--TTKEYVEFLKTIFDFPLIKAFITKQRETNNWKLLFDS 226

Query: 262 MHGVGYEIFTSLVLEKVNLKENRDYLTVKEQIVPDPAFPTISFPNPEEKGALDMAIALAK 321
           ++G+      ++ +++  L          +   P P F  +  P+P    A  +   + +
Sbjct: 227 LNGITGPYGKAIFVDEFGLPAEE----ALQNWHPQPDFGGLH-PDPNLTYAKTLVERVDR 281

Query: 322 ENDISLVIANDPDADRFSAAIYNSHSGEWQQLTGNEIGFLFGYYLFNKYTNMDPEFKKNH 381
           E  I    A+D D DR    IY   +G      G+ +       +  +Y    P F K  
Sbjct: 282 EK-IQFGAASDGDGDR--NMIYG--AGPAFVSPGDSVA------IIAEYAAEIPYFAKQG 330

Query: 382 PLAMLNSTVSSRMLKSMADTENFKFIDTLTGFKWIGNKAIDLKKEGYHVVFGYEEAIGYM 441
              +  S  +S  +  +A     K  +  TG+K+      D KK    +    EE+ G  
Sbjct: 331 IYGLARSFPTSNAIDLVAQKHGLKCYEVPTGWKFF-CALFDAKK----LSICGEESFGTG 385

Query: 442 FPAMEHDKDGITASVVFLQ--AYFEWDNLSK-VTVIDILEQGIEKYGA--FKEYNGYYVV 496
              +  +KDG+ A V +L   A +   N  K  ++  + E+   KYG   F  Y+  +V 
Sbjct: 386 SNHI-REKDGLWAVVAWLNVLALYNKHNPEKDASIKTVQEEFWHKYGRVFFTRYDYEHVS 444

Query: 497 SN--PQVTNDIFHYIRNEYPKNGNQYPKMIGTLLEVCSFRDLTTGFQSDTVDNIPSLPVD 554
           S    +V N +  YI           P  +G+            G +S TV        D
Sbjct: 445 SEDAAKVVNQLEGYIAK---------PDFVGSAF---------AGDKSVTVTEAG----D 482

Query: 555 PSSQMITITAKICDDEYQKSDSIVRFTMRGSGTEPK---LKLYIEGHSKDPIAASKIAKL 611
            S   +  +       Y K  +  RF +R SGT      ++LYIE ++ D        K 
Sbjct: 483 FSYTDLDGSVSSHQGLYVKLSNGARFVLRLSGTGSSGATIRLYIENYTDD--------KS 534

Query: 612 TWDVLKKEWIRPEVTGV 628
            + +  +E+++P +T V
Sbjct: 535 KYGLEPEEFLKPTITSV 551

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.317    0.135    0.400 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 72,332,528
Number of extensions: 3348535
Number of successful extensions: 9220
Number of sequences better than 10.0: 78
Number of HSP's gapped: 9400
Number of HSP's successfully gapped: 78
Length of query: 632
Length of database: 53,481,399
Length adjustment: 116
Effective length of query: 516
Effective length of database: 40,180,143
Effective search space: 20732953788
Effective search space used: 20732953788
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.7 bits)
S2: 69 (31.2 bits)