Re-run this search with the SEG filter switched off

Re-run this search as BLASTX i.e. nucleotide query

Get selected genes'

Hit NameAncStatusLength (aa)HSP LengthHSP ScoreHSP E-value
Kpol_1068.78.841ON32332316900.0
TPHA0I002608.841ON3233209781e-132
SAKL0D01452g8.841ON3273249261e-124
Ecym_46128.841ON3263259101e-122
Suva_16.17singletonON3243229011e-120
NCAS0D049408.841ON3273238921e-119
YLL062C (MHT1)na 1ON3243228901e-119
Kwal_27.102558.841ON3293268861e-118
KLTH0C03850g8.841ON3293258851e-118
Smik_12.1na 1ON3243168791e-117
KLLA0D01551g8.841ON3313238791e-117
KAFR0B00210singletonON3263228741e-116
Suva_13.515na 2ON3253228681e-116
TBLA0B032608.841ON3263248661e-115
ZYRO0G14212g8.841ON3253268651e-115
NDAI0F00250singletonON3293248651e-115
TPHA0G03760singletonON3313168621e-115
YPL273W (SAM4)8.841ON3253228601e-114
Skud_12.4na 1ON3253228501e-113
KNAG0B06970singletonON3323138491e-113
KAFR0F04420singletonON3263208491e-113
TDEL0E05690singletonON3283238441e-112
KAFR0L00150singletonON3263248411e-111
Smik_6.4848.841ON3253228161e-108
ABL125W8.841ON3363198051e-106
TDEL0E00240singletonON3283228021e-105
Suva_64.1singletonON2732717711e-102
Suva_16.328.841ON2592476682e-86
SAKL0D09306gna 3ON3263366385e-81
Skud_101.1singletonON2001945545e-70
Skud_100.1singletonON2001945475e-69
Kwal_0.322na 3ON3323415404e-66
KLTH0H12716gna 3ON3483335302e-64
AFR410WsingletonON3703175209e-63
Skud_47.2singletonON96962611e-27
YMR321Cna 2ON105952281e-22
SAKL0G16126gsingletonON22880730.78
Skud_15.4718.778ON112237694.2
Suva_16.5177.542ON72750694.3
Kwal_56.22747na 4ON153854694.8
NDAI0G001601.404ON29172675.3
KAFR0H006405.609ON583121668.5
BLASTP 2.2.26 [Sep-21-2011]

Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, 
Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), 
"Gapped BLAST and PSI-BLAST: a new generation of protein database search
programs",  Nucleic Acids Res. 25:3389-3402.

Reference for compositional score matrix adjustment: Altschul, Stephen F., 
John C. Wootton, E. Michael Gertz, Richa Agarwala, Aleksandr Morgulis,
Alejandro A. Schaffer, and Yi-Kuo Yu (2005) "Protein database searches
using compositionally adjusted substitution matrices", FEBS J. 272:5101-5109.

Query= Kpol_1068.7
         (323 letters)

Database: Seq/AA.fsa 
           114,666 sequences; 53,481,399 total letters

Searching..................................................done

                                                                 Score    E
Sequences producing significant alignments:                      (bits) Value

Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}...   655   0.0  
TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841 ...   381   e-132
SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {O...   361   e-124
Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar ...   355   e-122
Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON} ...   351   e-120
NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON}               348   e-119
YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}  MH...   347   e-119
Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {O...   345   e-118
KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {O...   345   e-118
Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL0...   343   e-117
KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {O...   343   e-117
KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON}       341   e-116
Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {O...   338   e-116
TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.84...   338   e-115
ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} simil...   337   e-115
NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON}       337   e-115
TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON}     336   e-115
YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}  SAM4S-adenos...   335   e-114
Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON} YLL...   332   e-113
KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON}             331   e-113
KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON}               331   e-113
TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {...   329   e-112
KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON}      328   e-111
Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W (...   318   e-108
ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-synteni...   314   e-106
TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON}       313   e-105
Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)        301   e-102
Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W (R...   261   2e-86
SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar...   250   5e-81
Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   218   5e-70
Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL27...   215   5e-69
Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MH...   212   4e-66
KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} simi...   208   2e-64
AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-synte...   204   9e-63
Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)      105   1e-27
YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON} P...    92   1e-22
SAKL0G16126g Chr7 complement(1394366..1395052) [687 bp, 228 aa] ...    33   0.78 
Skud_15.471 Chr15 (824424..827792) [3369 bp, 1122 aa] {ON} YOR30...    31   4.2  
Suva_16.517 Chr16 (889644..891827) [2184 bp, 727 aa] {ON} YPR185...    31   4.3  
Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL01...    31   4.8  
NDAI0G00160 Chr7 (21194..22069) [876 bp, 291 aa] {ON} Anc_1.404        30   5.3  
KAFR0H00640 Chr8 (119409..121160) [1752 bp, 583 aa] {ON} Anc_5.6...    30   8.5  

>Kpol_1068.7 s1068 complement(11996..12967) [972 bp, 323 aa] {ON}
           complement(11996..12967) [972 nt, 324 aa]
          Length = 323

 Score =  655 bits (1690), Expect = 0.0,   Method: Compositional matrix adjust.
 Identities = 323/323 (100%), Positives = 323/323 (100%)

Query: 1   MRVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRN 60
           MRVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRN
Sbjct: 1   MRVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRN 60

Query: 61  IIEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDN 120
           IIEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDN
Sbjct: 61  IIEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDN 120

Query: 121 YLIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYE 180
           YLIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYE
Sbjct: 121 YLIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYE 180

Query: 181 LEAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSNNDNLILTGANCISF 240
           LEAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSNNDNLILTGANCISF
Sbjct: 181 LEAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSNNDNLILTGANCISF 240

Query: 241 KYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVRI 300
           KYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVRI
Sbjct: 241 KYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVRI 300

Query: 301 VGGCCRTTPDDINKIKDMITKVK 323
           VGGCCRTTPDDINKIKDMITKVK
Sbjct: 301 VGGCCRTTPDDINKIKDMITKVK 323

>TPHA0I00260 Chr9 (49179..50150) [972 bp, 323 aa] {ON} Anc_8.841
           YPL273W
          Length = 323

 Score =  381 bits (978), Expect = e-132,   Method: Compositional matrix adjust.
 Identities = 168/320 (52%), Positives = 237/320 (74%), Gaps = 1/320 (0%)

Query: 1   MRVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRN 60
           MRVP  + I   P+E+LV DGG GT LE+RG+N++SPLWST+ F+ D FWD   + ++R 
Sbjct: 1   MRVPFRKFIDEHPNEILVLDGGQGTELENRGVNINSPLWSTISFVNDKFWDENIENTERK 60

Query: 61  IIEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDN 120
            I  ++ D+  +G+ + ST+TYQTSF+ +S +T++K+++ Y +L+R IT FCR  I +D+
Sbjct: 61  CIREMFNDFKDAGANVFSTLTYQTSFSSVSENTDIKSLQEYHELLRKITGFCRRCISDDD 120

Query: 121 YLIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYE 180
           YL+G IG + A +GAEY GNYG     I+YL+YFKPQL+EFNN+ +IDIIGFET+PNK+E
Sbjct: 121 YLLGCIGAYAASIGAEYDGNYGLFAGKIDYLKYFKPQLDEFNNDMNIDIIGFETIPNKHE 180

Query: 181 LEAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYS-NNDNLILTGANCIS 239
           LEAILSWD+ +I++P++++LSL D  GLRDGTSFEE+  +F KY   N NL+  G NCIS
Sbjct: 181 LEAILSWDEDIINRPFFIALSLSDKNGLRDGTSFEEMGRLFAKYKGRNKNLVYVGGNCIS 240

Query: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVR 299
           + Y+ +NI KLH  +P L LI YPNSGEIYD  +K+W+      ++WE+++ E   + V+
Sbjct: 241 YAYSIDNIRKLHDIVPHLNLIAYPNSGEIYDQKSKQWSSTSAIKISWEEVVNEYADAGVK 300

Query: 300 IVGGCCRTTPDDINKIKDMI 319
           I+GGCCRTTPDDI +IK  +
Sbjct: 301 IIGGCCRTTPDDIKQIKKAV 320

>SAKL0D01452g Chr4 complement(115954..116937) [984 bp, 327 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 327

 Score =  361 bits (926), Expect = e-124,   Method: Compositional matrix adjust.
 Identities = 165/324 (50%), Positives = 236/324 (72%), Gaps = 3/324 (0%)

Query: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61
           R PI++  +  PDE+LV DGG GT LE+RGI V++P+WST+PF+ + FW +E+ + DR I
Sbjct: 3   RQPIKQFFQEHPDEILVMDGGQGTELENRGIKVANPVWSTIPFISESFWSNES-SRDRQI 61

Query: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121
           ++ ++ D+I  GSRIL T TYQTSF  +S +T +KT++ Y QL+  I +F R  IGED Y
Sbjct: 62  VKEMFDDFIKVGSRILMTTTYQTSFKSVSENTPIKTLKEYNQLLERIVAFSRECIGEDKY 121

Query: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181
           LIG IG +GA +  E+TG+YG +P  I++LEYF+PQL+ FN+++ ID+IGFET+PN +EL
Sbjct: 122 LIGCIGAWGAHVCCEFTGDYGANPERIDFLEYFRPQLQNFNSSEQIDLIGFETIPNVHEL 181

Query: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCIS 239
           +AILSWD+S+ISKP+Y+ LS+ +NG LRDGT+ +E+A I K   +  N NL+L G NC+S
Sbjct: 182 KAILSWDESIISKPFYIGLSVHENGVLRDGTTMKEVADIIKSLGDKLNPNLMLLGINCVS 241

Query: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVR 299
           F ++   +S LH+ +P +P+IVYPNSGEIYD + K W  ++   +TW+D++K    +  R
Sbjct: 242 FNHSHLILSSLHKELPDMPMIVYPNSGEIYDTVKKIWLHNENQKVTWDDVVKSYIENGAR 301

Query: 300 IVGGCCRTTPDDINKIKDMITKVK 323
           I+GGCCRT+P DI  I   I K K
Sbjct: 302 IIGGCCRTSPQDIKDIVQAIEKYK 325

>Ecym_4612 Chr4 (1193587..1194567) [981 bp, 326 aa] {ON} similar to
           Ashbya gossypii ABL125W
          Length = 326

 Score =  355 bits (910), Expect = e-122,   Method: Compositional matrix adjust.
 Identities = 155/325 (47%), Positives = 235/325 (72%), Gaps = 3/325 (0%)

Query: 1   MRVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRN 60
           +R  +++L+++ PD++L+ DGG GT LE+RGINV++P+WST+PF+ D FW S+  + DR 
Sbjct: 2   VRASVKQLLQSNPDQILIMDGGQGTELENRGINVANPVWSTIPFINDSFW-SDRSSRDRQ 60

Query: 61  IIEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDN 120
           I+ G++ +YI +G+ +L TITYQ+SF  +S +T++KT+E Y QL+  I +F R+ IG DN
Sbjct: 61  IVAGMFEEYIAAGANLLMTITYQSSFKSVSENTDIKTLEEYNQLLDRIVAFSRTCIGADN 120

Query: 121 YLIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYE 180
           YL+G IG +GA + AE++G+YG+ P  I YL+YF+PQL  FN  +DID+IGFET+PN +E
Sbjct: 121 YLVGCIGSWGAHICAEFSGDYGEHPERIPYLDYFRPQLNNFNLQEDIDVIGFETIPNIHE 180

Query: 181 LEAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCI 238
           L AILSWD+S+I KP+Y+ +S+ ++G LRDGT+  ++A +F+      N N +  G NC 
Sbjct: 181 LTAILSWDESIIKKPFYIGMSVHEHGTLRDGTTMSQVAQLFRSLGKKLNPNFLALGINCC 240

Query: 239 SFKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNV 298
           SF+Y+   +  LH+ +P +PLI YPNSGE+YD + K W  ++   +TW++++K    S  
Sbjct: 241 SFRYSHMILESLHEELPYIPLIAYPNSGELYDTVKKIWLKNENCIVTWDEIVKSYLQSGA 300

Query: 299 RIVGGCCRTTPDDINKIKDMITKVK 323
           RI+GGCCRTTP+DI +I   + K K
Sbjct: 301 RIIGGCCRTTPNDIRQIVTAVKKYK 325

>Suva_16.17 Chr16 complement(15787..16761) [975 bp, 324 aa] {ON}
           YLL062C (REAL)
          Length = 324

 Score =  351 bits (901), Expect = e-120,   Method: Compositional matrix adjust.
 Identities = 161/322 (50%), Positives = 229/322 (71%), Gaps = 4/322 (1%)

Query: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61
           R+ IE+LI   P +VLV DGG GT LE+RGI+++SP+WS  PF+ D FW  E+ +SDR +
Sbjct: 3   RIAIEKLILEHPQKVLVLDGGQGTELENRGIDINSPVWSAAPFISDSFW--ESTSSDRTL 60

Query: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121
           +E +YRD++ +G+ +L T+TYQ +F+ IS +T +KT+  Y + +  + SF R  IGED Y
Sbjct: 61  VEEMYRDFMDAGANVLMTVTYQANFSSISENTSIKTLSDYNRFLDRVVSFTRRVIGEDRY 120

Query: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181
           LIGSIGP+ A + +EYTG+YG  P +I+YL++FK QL+ FN + +ID+IGFETVPN +EL
Sbjct: 121 LIGSIGPWAAHVSSEYTGDYGSHPEDIDYLQHFKAQLDNFNKHTEIDLIGFETVPNFHEL 180

Query: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCIS 239
           +AILSWD+++ISKP+YV LS+ DNG LRDGT+ EEIA   K      N + +L G NCIS
Sbjct: 181 KAILSWDENIISKPFYVGLSVHDNGLLRDGTTMEEIAAYVKSLGRKINRHFLLLGVNCIS 240

Query: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVR 299
           F  ++  +  LHQA+P +PL+ YPNSGE+YD  TK W   +    +WE +++E   +  R
Sbjct: 241 FNQSTSILKSLHQALPDMPLLAYPNSGEVYDTKTKTWHQAKGKQNSWEVVVEEFIDNGAR 300

Query: 300 IVGGCCRTTPDDINKIKDMITK 321
           I+GGCCRT+  DI++I   + K
Sbjct: 301 IIGGCCRTSAKDISEIASAVDK 322

>NCAS0D04940 Chr4 (948608..949591) [984 bp, 327 aa] {ON} 
          Length = 327

 Score =  348 bits (892), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 162/323 (50%), Positives = 230/323 (71%), Gaps = 4/323 (1%)

Query: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61
           R  I+E ++  PD+VLV DGG GT LE+RGINV++P+WST+PF+ + FW S+  ++DR I
Sbjct: 3   RQSIKEYLQQNPDKVLVLDGGQGTELENRGINVANPVWSTIPFVSESFW-SDKSSNDRQI 61

Query: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121
           ++ ++ D++ +G+ IL T TYQTSF  +S +T++KT++ Y +L+  I SF R  IGE  Y
Sbjct: 62  VKEMFEDFLAAGAEILMTTTYQTSFKSVSENTDIKTLQEYNELLNRIVSFSRDCIGEQKY 121

Query: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181
           LIG IGP+GA + AE+ G+YG  P NI+Y +YFKPQL+ F  N+++D+IGFETVPN  EL
Sbjct: 122 LIGCIGPWGAHVCAEFNGDYGAHPENIDYYQYFKPQLDNFFANENLDLIGFETVPNVNEL 181

Query: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCIS 239
           +AILSWD+ ++SKP+Y+ LS+ +NG LRDGT+ EEI  IFK   N  N NL+L G NC+S
Sbjct: 182 KAILSWDEKILSKPFYIGLSVHENGVLRDGTTMEEIGNIFKSLGNKVNPNLLLLGINCVS 241

Query: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQT-FGLTWEDLIKELRTSNV 298
           F ++   +  +H+ +P +PLI YPNSGE+YD + K W    +   LTWE ++K    +  
Sbjct: 242 FNHSPSILEDIHKNLPDMPLIAYPNSGEVYDTVKKIWLPQNSENSLTWEQVVKRYIEAGA 301

Query: 299 RIVGGCCRTTPDDINKIKDMITK 321
           RI+GGCCRTTP DI +I   + K
Sbjct: 302 RIIGGCCRTTPKDILEISKAVKK 324

>YLL062C Chr12 complement(16639..17613) [975 bp, 324 aa] {ON}
           MHT1S-methylmethionine-homocysteine methyltransferase,
           functions along with Sam4p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 324

 Score =  347 bits (890), Expect = e-119,   Method: Compositional matrix adjust.
 Identities = 164/322 (50%), Positives = 222/322 (68%), Gaps = 4/322 (1%)

Query: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61
           R+PI+ELI   P +VL+ DGG GT LE+RGIN++SP+WS  PF  + FW  E  + +R +
Sbjct: 3   RIPIKELIVEHPGKVLILDGGQGTELENRGININSPVWSAAPFTSESFW--EPSSQERKV 60

Query: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121
           +E +YRD++ +G+ IL TITYQ +F  IS +T +KT+  YK+ +  I SF R  IGE+ Y
Sbjct: 61  VEEMYRDFMIAGANILMTITYQANFQSISENTSIKTLAAYKRFLDKIVSFTREFIGEERY 120

Query: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181
           LIGSIGP+ A +  EYTG+YG  P NI+Y  +FKPQLE FN N DID+IGFET+PN +EL
Sbjct: 121 LIGSIGPWAAHVSCEYTGDYGPHPENIDYYGFFKPQLENFNQNRDIDLIGFETIPNFHEL 180

Query: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCIS 239
           +AILSWD+ +ISKP+Y+ LS+ DN  LRDGT+ EEI+   K   N  N NL+L G NC+S
Sbjct: 181 KAILSWDEDIISKPFYIGLSVDDNSLLRDGTTLEEISVHIKGLGNKINKNLLLMGVNCVS 240

Query: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVR 299
           F  ++  +  LH+ +P +PL+VYPNSGEIY+P  K W         WE  +K+   +  R
Sbjct: 241 FNQSALILKMLHEHLPGMPLLVYPNSGEIYNPKEKTWHRPTNKLDDWETTVKKFVDNGAR 300

Query: 300 IVGGCCRTTPDDINKIKDMITK 321
           I+GGCCRT+P DI +I   + K
Sbjct: 301 IIGGCCRTSPKDIAEIASAVDK 322

>Kwal_27.10255 s27 complement(264291..265280) [990 bp, 329 aa] {ON}
           YPL273W (SAM4) - S-adenosylmethionine:homocysteine
           S-methyltransferase [contig 37] FULL
          Length = 329

 Score =  345 bits (886), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 153/326 (46%), Positives = 229/326 (70%), Gaps = 3/326 (0%)

Query: 1   MRVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTS-DR 59
           +R  I+E +   P EVLV DGG GT LE+RGI V++P+WST+PF+ + FW +E ++S DR
Sbjct: 2   VRTSIKEFLEKNPREVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSAEDQSSKDR 61

Query: 60  NIIEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGED 119
            I++ +Y D++ +G+R+L T+TYQ SF  +S +T +KT+E Y  L+  I +F R  IG+D
Sbjct: 62  QIVKEMYSDFLKAGARVLMTVTYQASFKSVSENTRIKTLEEYDSLLNRIVTFSRECIGDD 121

Query: 120 NYLIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKY 179
            +L+G IG +GA   +E+TG+YG  P  I++L+YFKPQL+ F NN++ID+IGFET+PN +
Sbjct: 122 KFLVGCIGAWGAHNCSEFTGDYGAEPEKIDFLQYFKPQLDNFTNNENIDLIGFETIPNIH 181

Query: 180 ELEAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANC 237
           EL AILSWD+S+I+KP+Y+ LS+ +NG LRDGT+  ++A + K + +  N N  L G NC
Sbjct: 182 ELRAILSWDESIINKPFYIGLSVHENGLLRDGTTMHQVAELIKSFGDRLNPNFTLLGINC 241

Query: 238 ISFKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSN 297
           +S+  + + +  LH+ +P +PLI YPNSGE+YD + K W    +  L+WE ++K    S 
Sbjct: 242 VSYNQSHDILRSLHEELPEMPLIAYPNSGEVYDTVKKIWNPKNSQTLSWEQIVKSYIDSG 301

Query: 298 VRIVGGCCRTTPDDINKIKDMITKVK 323
            RI+GGCCRT+P DI  I + + K +
Sbjct: 302 ARIIGGCCRTSPKDIEAIHEAVQKYR 327

>KLTH0C03850g Chr3 complement(336417..337406) [990 bp, 329 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 329

 Score =  345 bits (885), Expect = e-118,   Method: Compositional matrix adjust.
 Identities = 156/325 (48%), Positives = 226/325 (69%), Gaps = 3/325 (0%)

Query: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDS-ETKTSDRN 60
           R  ++E + + P+EVLV DGG GT LE+RGI V++P+WST+PF+ D FW + ++ + DR 
Sbjct: 3   RPSVKEYLASNPEEVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWTANDSSSKDRQ 62

Query: 61  IIEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDN 120
           I++ +Y D++ +G+R+L T+TYQ SF  +S +T + T+E Y  L+  I SF RS IG+D 
Sbjct: 63  IVKEMYEDFLKAGARVLMTVTYQASFKSVSENTSITTLEEYDALLSRIVSFSRSCIGDDK 122

Query: 121 YLIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYE 180
           +L+G IGP+GA   +E+TG+YG  P  I+YL+YFKPQL+ F  NDD+D+IGFET+PN +E
Sbjct: 123 WLVGCIGPWGAHNCSEFTGDYGSEPEKIDYLQYFKPQLDNFTVNDDLDLIGFETIPNIHE 182

Query: 181 LEAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCI 238
           L AILSWD +++ KP+Y+ LS+ ++G LRDGT+  E+A + K   +  N N +L G NC+
Sbjct: 183 LRAILSWDTTILPKPFYIGLSVHEHGVLRDGTTMHEVAELIKSLGDKINPNFVLLGINCV 242

Query: 239 SFKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNV 298
           S+ ++ E +  LHQ IP LPLI YPNSGE+YD + K W       LTW+ ++K    S  
Sbjct: 243 SYNHSPEILRSLHQEIPELPLIAYPNSGEVYDTVKKIWNPKGDHTLTWDQVVKSYIDSGA 302

Query: 299 RIVGGCCRTTPDDINKIKDMITKVK 323
           RI+GGCCRT+P DI  I   + K +
Sbjct: 303 RIIGGCCRTSPKDIAAINAAVNKYR 327

>Smik_12.1 Chr12 complement(885..1859) [975 bp, 324 aa] {ON} YLL062C
           (REAL)
          Length = 324

 Score =  343 bits (879), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 159/316 (50%), Positives = 222/316 (70%), Gaps = 4/316 (1%)

Query: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61
           R+PIE+L+   P +VLV DGG GT LE+RGIN++SP+WS  PF+ D FW  E  + +R +
Sbjct: 3   RIPIEKLLIEHPQKVLVLDGGQGTELENRGININSPVWSAAPFVSDSFW--EKSSRERKV 60

Query: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121
           +E +YRD++ +G+ +L TITYQ +F  IS +T +KT+  Y++ +  I  F R  IGE+ Y
Sbjct: 61  VEEMYRDFMNAGANVLMTITYQANFKSISKNTTIKTLPAYRRFLDQIVCFSRRLIGEERY 120

Query: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181
           LIGSIGP+ A + +EYTGNYG  P +I+Y E+F+PQL+ FN N+DID+IGFET+PN +EL
Sbjct: 121 LIGSIGPWAAHVSSEYTGNYGPHPEDIDYYEFFRPQLDTFNENEDIDLIGFETIPNFHEL 180

Query: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCIS 239
           +AILSW + +IS+P+YV LS+ DNG LRDGT+ EEI+   K   +  N N +L G NCIS
Sbjct: 181 KAILSWGEDIISRPFYVGLSVHDNGLLRDGTTLEEISAHIKGLGSKINKNFLLLGVNCIS 240

Query: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVR 299
           F  ++  +  LH+ +P  PL+VYPNSGEIYDP  K W        +W+  +++   S  R
Sbjct: 241 FNQSTLILKALHEVLPDFPLLVYPNSGEIYDPKEKTWYHPTDKLDSWDVTVRKFIDSGAR 300

Query: 300 IVGGCCRTTPDDINKI 315
           I+GGCCRT+P DI +I
Sbjct: 301 IIGGCCRTSPKDIAEI 316

>KLLA0D01551g Chr4 complement(137965..138960) [996 bp, 331 aa] {ON}
           highly similar to uniprot|Q08985 Saccharomyces
           cerevisiae YPL273W SAM4
           S-adenosylmethionine-homocysteine methyltransferase,
          Length = 331

 Score =  343 bits (879), Expect = e-117,   Method: Compositional matrix adjust.
 Identities = 163/323 (50%), Positives = 225/323 (69%), Gaps = 3/323 (0%)

Query: 1   MRVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRN 60
           MRVPI++     PD VLV DGG GT LE+RGINV++P+WSTVPF+ + FW S+  + DR 
Sbjct: 1   MRVPIKKYFEENPDVVLVMDGGQGTELENRGINVANPVWSTVPFINESFWSSDA-SKDRI 59

Query: 61  IIEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDN 120
           I++ ++ D+I +G+ IL TITYQTSF  +S +T ++T+E Y  L+  I SF RS IGED 
Sbjct: 60  IVKQMFEDFIEAGADILMTITYQTSFKSVSENTPIRTLEEYNGLLDRIVSFSRSCIGEDR 119

Query: 121 YLIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYE 180
           YLIG IG +GA + +E+TG+YG  P  I+Y EYF+PQL  F  + DIDIIGFET+PN +E
Sbjct: 120 YLIGCIGAWGAHVCSEFTGDYGPHPDQIDYFEYFRPQLGNFVQSKDIDIIGFETIPNIHE 179

Query: 181 LEAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCI 238
           L AILSWD++V+SKP+Y+ LS+ + G LRDGTS ++IA +     +  N NL+  G NC 
Sbjct: 180 LRAILSWDETVLSKPFYIGLSVHEYGVLRDGTSMQQIADLISSLGDKLNSNLMFIGINCC 239

Query: 239 SFKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNV 298
           +F  +   +  LH + P +PLIVYPNSGEIYD + K W  ++    TW+D++K    +  
Sbjct: 240 AFNQSHMILESLHNSCPNMPLIVYPNSGEIYDTVKKIWLKNENQLCTWDDVVKSYIENGA 299

Query: 299 RIVGGCCRTTPDDINKIKDMITK 321
           RI+GGCCRTT DDI +++  + K
Sbjct: 300 RIIGGCCRTTVDDIKEVRLAVNK 322

>KAFR0B00210 Chr2 complement(50980..51960) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  341 bits (874), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 156/322 (48%), Positives = 225/322 (69%), Gaps = 3/322 (0%)

Query: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61
           R PI+E +   P +VLV DGG GT LE+RGI+V++P+WST+PF+ + FW S   + DR I
Sbjct: 3   RQPIKEYLEENPKKVLVLDGGQGTELENRGIHVANPVWSTIPFISESFW-SNASSKDREI 61

Query: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121
           ++G+++D++ +G+ IL TITYQTSF  ++ +T +KT++ Y +L+  I SF RS IG++ Y
Sbjct: 62  VKGMFQDFLDAGADILMTITYQTSFKSVTENTPIKTLKEYNELLERIVSFSRSCIGDEKY 121

Query: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181
           LIG IGP+GA + AE+ G+YG  P NI+Y  YFKPQL+ F  N D+D+IGFETVPN +EL
Sbjct: 122 LIGCIGPWGAHVCAEFNGDYGGHPENIDYYAYFKPQLDNFFQNKDLDLIGFETVPNFHEL 181

Query: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCIS 239
           +AILSWD +++SKP+Y+ LS+ +NG LRDGT+  EI    K   +  N N +L G NC+S
Sbjct: 182 KAILSWDDTILSKPFYIGLSVHENGVLRDGTTMNEIGYYIKSLGSKINPNFLLLGINCVS 241

Query: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVR 299
           F  + + +  +H+ +P +PLI YPNSGEIYD + K W  +    +TW D++     +  R
Sbjct: 242 FSDSPDILESIHKELPDMPLIAYPNSGEIYDTVKKIWLPNHYSDITWNDVVNRYIKAGAR 301

Query: 300 IVGGCCRTTPDDINKIKDMITK 321
           I+GGCCRT PDDI ++   + K
Sbjct: 302 IIGGCCRTMPDDIEQVSAAVKK 323

>Suva_13.515 Chr13 complement(901226..902203) [978 bp, 325 aa] {ON}
           YPL273W (REAL)
          Length = 325

 Score =  338 bits (868), Expect = e-116,   Method: Compositional matrix adjust.
 Identities = 150/322 (46%), Positives = 230/322 (71%), Gaps = 3/322 (0%)

Query: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61
           R+P+++L+ + P +VLV DGG GT LE+RGI V++P+WST+PF+ + FW  E+ +++R I
Sbjct: 3   RIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDES-SANRKI 61

Query: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121
           ++ ++ D++ +G+ IL TITYQTSF  +S +T +KT+  Y  L+  I  F R  IGE+ +
Sbjct: 62  VKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKH 121

Query: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181
           LIG IGP+GA +  E+TGNYG +P +I++ +YFKPQL+ FN ND +D++GFET+PN +EL
Sbjct: 122 LIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHEL 181

Query: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCIS 239
           +AILSWD+S++SKP+Y+ LS+ ++G LRDGT+ E +A + K   +  N N +L G NC+S
Sbjct: 182 KAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVS 241

Query: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVR 299
           F  + + +  LH+A+P +PL+ YPNSGE+YD   K W  +     +W+ ++K+   S  R
Sbjct: 242 FNQSPDILESLHRALPNMPLLAYPNSGEVYDTEKKIWMPNSDKLNSWDTVVKQYIGSGAR 301

Query: 300 IVGGCCRTTPDDINKIKDMITK 321
           I+GGCCRTTP DI ++   + K
Sbjct: 302 IIGGCCRTTPKDIQEVSAAVKK 323

>TBLA0B03260 Chr2 (760392..761372) [981 bp, 326 aa] {ON} Anc_8.841
           YPL273W
          Length = 326

 Score =  338 bits (866), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 161/324 (49%), Positives = 232/324 (71%), Gaps = 2/324 (0%)

Query: 1   MRVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRN 60
           MR   +E     P+ V+V DGG GT LE RG++VSS +WSTVPF+  +FW  + K+ + +
Sbjct: 1   MRQSFKEYFNTHPNAVIVMDGGQGTELERRGVDVSSKVWSTVPFIGREFWQKDEKSQNIS 60

Query: 61  IIEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDN 120
           I++ +++ ++ +GS+ L +ITYQ SF+ IS++T+++ +E Y +L+  I  FCR  IG   
Sbjct: 61  IVKDMFQAFVAAGSQALMSITYQCSFSTISSNTKIQALEEYNELLNKIVKFCRECIGNSK 120

Query: 121 YLIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYE 180
           YLIGSIGP+ + + AEYTG+YG  P N++YL YFKPQL+ FN+NDDID+I  ETVPNKYE
Sbjct: 121 YLIGSIGPYASHVSAEYTGDYGLHPENVDYLNYFKPQLDNFNDNDDIDLIAMETVPNKYE 180

Query: 181 LEAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFK-KYSNNDNLILTGANCIS 239
           L+A+LSWD + I KP+Y+SLS+ D+G LRDGTS + I+T+F+ +   N NL++ G NC+S
Sbjct: 181 LKALLSWDGTTIKKPFYISLSVGDDGNLRDGTSMDTISTMFQNREVKNPNLMMVGVNCVS 240

Query: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGL-TWEDLIKELRTSNV 298
           +      I KL  A+P LPL+ YPNSGE+YD +T+ W  +    L +WE L+K+L  + V
Sbjct: 241 YDKTLMIIKKLQIAVPDLPLVCYPNSGEVYDQITQSWKTNNDIKLDSWETLVKDLVANGV 300

Query: 299 RIVGGCCRTTPDDINKIKDMITKV 322
           R+VGGCCRTTPDDI+KI   ++ +
Sbjct: 301 RMVGGCCRTTPDDIHKIAQAVSHL 324

>ZYRO0G14212g Chr7 (1133202..1134179) [978 bp, 325 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 325

 Score =  337 bits (865), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 159/326 (48%), Positives = 229/326 (70%), Gaps = 7/326 (2%)

Query: 1   MRVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRN 60
           MR  + E++R+  D VLV DGG GT LE+RG+N+S P+WSTVPF K++FW+ +   +DR+
Sbjct: 1   MRQQLLEVLRDT-DRVLVMDGGQGTELENRGMNISGPIWSTVPFTKEEFWNFDQPYTDRD 59

Query: 61  IIEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDN 120
           ++  +++ Y+ +G+++LST+TYQTS+  I  HT++ T   Y QL+  I  FCR  IG+D+
Sbjct: 60  VVNSMFKAYVDAGAQLLSTVTYQTSYKTICAHTDIHTRTQYDQLLDRIVGFCRRCIGDDH 119

Query: 121 YLIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYE 180
           YL+GSIGP+ A +GAEYTG+YG  P  I+Y +YF+PQ+  FN N+ IDIIG ETVPN +E
Sbjct: 120 YLVGSIGPYAAHVGAEYTGDYGPKPEEIDYWQYFEPQVANFNRNETIDIIGLETVPNVHE 179

Query: 181 LEAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSNNDNLILTGANCISF 240
           L++ILSWD++ ISKP+YVSL + D+G LRDGT  E++  +F   SN  NL+L G NC S 
Sbjct: 180 LKSILSWDETKISKPFYVSLCVGDDGNLRDGTPLEQLVPLFANRSNK-NLLLVGINCCSL 238

Query: 241 KYASENISKLHQAIPTLP--LIVYPNSGEIYDPLTKKW---TIDQTFGLTWEDLIKELRT 295
             +S+ +S L++ + + P  L+VYPNSGEIYD  T+ W   T   +  L+W  L++E R 
Sbjct: 239 SVSSQALSHLNEILASTPMGLLVYPNSGEIYDHKTQTWSRPTGLDSHRLSWPSLVQEYRK 298

Query: 296 SNVRIVGGCCRTTPDDINKIKDMITK 321
              R +GGCCRTTP DI +I  ++ +
Sbjct: 299 FGARAIGGCCRTTPLDIQEICKVVDR 324

>NDAI0F00250 Chr6 complement(47567..48556) [990 bp, 329 aa] {ON} 
          Length = 329

 Score =  337 bits (865), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 155/324 (47%), Positives = 230/324 (70%), Gaps = 6/324 (1%)

Query: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61
           R PI++ +   P ++L+ DGG GT LE+RGINV++P+WST+PF+ D FW  ++ + DR I
Sbjct: 3   RQPIKDYLSENPKKILILDGGQGTELENRGINVANPVWSTIPFVNDSFWSGQS-SKDREI 61

Query: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121
           ++ ++ D++ +G+ IL T TYQTSF  +S +T +KT++ Y +L+  I +F R  IGE+ Y
Sbjct: 62  VKQMFNDFLEAGAEILMTTTYQTSFKSVSENTNIKTLKEYDELLTRIVNFSRDCIGENKY 121

Query: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181
           LIG IGP+GA + +E+TGNYG+ P  I+Y EYFKPQL  F  NDD+DIIGFET+PN YEL
Sbjct: 122 LIGCIGPWGAHICSEFTGNYGEHPELIDYYEYFKPQLVNFVQNDDLDIIGFETIPNVYEL 181

Query: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCIS 239
           + ILSW   ++ KP+Y+ LS+ +NG LRDGT+  ++A I    S+  N NL+L G NC+S
Sbjct: 182 KTILSWGTDILPKPFYIGLSVHENGVLRDGTTMSQVADIINSLSDKLNPNLVLLGINCVS 241

Query: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTI--DQTFGLTWEDLIKELRTSN 297
             ++ + +  +H  +P LPLIVYPNSGE+YD + K W    D+T+ ++W+++++    + 
Sbjct: 242 LAHSPDILDSIHSNLPDLPLIVYPNSGEVYDTVKKIWLPPNDETY-MSWDEVVERYLKAG 300

Query: 298 VRIVGGCCRTTPDDINKIKDMITK 321
            RI+GGCCRTTP+DI +I D + K
Sbjct: 301 ARIIGGCCRTTPNDIKQISDAVHK 324

>TPHA0G03760 Chr7 complement(795934..796929) [996 bp, 331 aa] {ON} 
          Length = 331

 Score =  336 bits (862), Expect = e-115,   Method: Compositional matrix adjust.
 Identities = 155/316 (49%), Positives = 225/316 (71%), Gaps = 3/316 (0%)

Query: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61
           R  I+  ++  P++VLV DGG GT LE+RGI V++P+WST+PF+ + FW S+  + DR I
Sbjct: 3   RQCIKNYLQENPNKVLVMDGGQGTELENRGIKVANPVWSTIPFISESFW-SDQSSEDRKI 61

Query: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121
           ++ ++ D+I +G+ IL T TYQTSF  +S +T +K  + Y +L+  I  F R  IGE+ Y
Sbjct: 62  VKEMFNDFINAGAEILMTTTYQTSFKSVSENTPIKNTKHYNELLNRIIDFSRDCIGEERY 121

Query: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181
           LIG IG +GA + AE+ G+YG+ P NI++ EYFKPQL+ F NN+ +D+IGFETVPN +EL
Sbjct: 122 LIGCIGSWGAHICAEFHGDYGEHPENIDFYEYFKPQLDNFFNNNKLDLIGFETVPNIHEL 181

Query: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCIS 239
           +AILSWD+ ++SKP+Y+ LS+ +NG LRDGTS +E+A + K +    N NL L G NC+S
Sbjct: 182 KAILSWDEKILSKPFYIGLSVHENGLLRDGTSMQEVANLIKGFGEKLNPNLTLLGINCVS 241

Query: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVR 299
           + ++++ I  +H+ +P LPLI YPNSGEIYD   K W  ++    TW+D++K    + VR
Sbjct: 242 YNHSNDIIKSIHKELPNLPLIAYPNSGEIYDTTKKIWLPNKNPIFTWDDIVKGYIEAGVR 301

Query: 300 IVGGCCRTTPDDINKI 315
           I+GGCCRTTP+DI  +
Sbjct: 302 IIGGCCRTTPNDIKAV 317

>YPL273W Chr16 (25087..26064) [978 bp, 325 aa] {ON}
           SAM4S-adenosylmethionine-homocysteine methyltransferase,
           functions along with Mht1p in the conversion of
           S-adenosylmethionine (AdoMet) to methionine to control
           the methionine/AdoMet ratio
          Length = 325

 Score =  335 bits (860), Expect = e-114,   Method: Compositional matrix adjust.
 Identities = 150/322 (46%), Positives = 227/322 (70%), Gaps = 3/322 (0%)

Query: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61
           R+P+++ + + P +VLV DGG GT LE+RGI V++P+WST+PF+ + FW  E+ +++R I
Sbjct: 3   RLPLKQFLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDES-SANRKI 61

Query: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121
           ++ ++ D++ +G+ IL T TYQTS+  +S +T ++T+  Y  L+  I  F R+ IGED Y
Sbjct: 62  VKEMFNDFLNAGAEILMTTTYQTSYKSVSENTPIRTLSEYNNLLNRIVDFSRNCIGEDKY 121

Query: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181
           LIG IGP+GA +  E+TG+YG  P NI++ +YFKPQLE FN ND +D+IGFET+PN +EL
Sbjct: 122 LIGCIGPWGAHICREFTGDYGAEPENIDFYQYFKPQLENFNKNDKLDLIGFETIPNIHEL 181

Query: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCIS 239
           +AILSWD+S++S+P+Y+ LS+ ++G LRDGT+ EEIA + K   +  N N    G NC+S
Sbjct: 182 KAILSWDESILSRPFYIGLSVHEHGVLRDGTTMEEIAQVIKDLGDKINPNFSFLGINCVS 241

Query: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVR 299
           F  + + +  LHQA+P + L+ YPNSGE+YD   K W  +     +W+ ++K+  +S  R
Sbjct: 242 FNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYISSGAR 301

Query: 300 IVGGCCRTTPDDINKIKDMITK 321
           I+GGCCRT+P DI +I   + K
Sbjct: 302 IIGGCCRTSPKDIQEISAAVKK 323

>Skud_12.4 Chr12 complement(4676..5653) [978 bp, 325 aa] {ON}
           YLL062C (REAL)
          Length = 325

 Score =  332 bits (850), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 158/322 (49%), Positives = 216/322 (67%), Gaps = 4/322 (1%)

Query: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61
           R+ IE+LI   P  VLV DGG GT LE+RGIN+  P+WS  PF  D FW  E  + DR +
Sbjct: 3   RISIEKLILEYPTRVLVLDGGQGTELENRGINIGGPVWSATPFTSDSFW--EQSSHDREV 60

Query: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121
           +E +YRD++ +G+ +L TITYQ +F  IS +T ++T+  Y   +  I SF R  IGE+ Y
Sbjct: 61  VEEMYRDFMNAGANVLMTITYQANFKSISENTSIQTLSAYNGFLDRIVSFTRRFIGEERY 120

Query: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181
           L+GSIGP+ A + +EYTGNYG  P +I+Y  +FKPQL+ FN N DID+IGFETVPN +EL
Sbjct: 121 LVGSIGPWAAHVSSEYTGNYGPHPEDIDYYNFFKPQLDSFNENKDIDLIGFETVPNFHEL 180

Query: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCIS 239
           +AILSW + +ISKP+YV LS+ DNG LRDGT+ EE++   K   +  N +L+L G NCIS
Sbjct: 181 KAILSWGEDIISKPFYVGLSVHDNGLLRDGTTMEEVSAHIKGLGSRINKHLLLMGVNCIS 240

Query: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVR 299
           F  ++  +  LH+++P  PL+VYPNSGE+YD   K W        +W+  +K    S  R
Sbjct: 241 FNRSTLILRTLHESLPDTPLLVYPNSGEVYDVKEKTWHWPTDKPESWDITVKTFIDSGAR 300

Query: 300 IVGGCCRTTPDDINKIKDMITK 321
           I+GGCCRT+P DI +I   + +
Sbjct: 301 IIGGCCRTSPKDIAEIATAVRR 322

>KNAG0B06970 Chr2 (1387382..1388380) [999 bp, 332 aa] {ON} 
          Length = 332

 Score =  331 bits (849), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 151/313 (48%), Positives = 222/313 (70%), Gaps = 3/313 (0%)

Query: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61
           R PI+E ++  P +VLV DGG GT LE+RGINV++P+WSTVPF+   FW S   + DR I
Sbjct: 3   RQPIQEYLKVNPRKVLVLDGGQGTELENRGINVANPVWSTVPFIDSSFW-SNKSSKDRVI 61

Query: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121
           ++G++  ++ +G+ IL T TYQTSF  +S +T ++ +E Y  L+  I  F R  IG D Y
Sbjct: 62  VKGMFDAFLDAGAEILMTTTYQTSFKSVSENTPIQNLEEYSSLLDRIVQFSRDCIGPDKY 121

Query: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181
           LIG IGP+GA + AE+ G+YG +P+ I+YL YFKPQL+ F +ND++D+IGFET+PN +EL
Sbjct: 122 LIGCIGPWGAHVCAEFNGDYGPNPAEIDYLSYFKPQLDNFFHNDNLDLIGFETIPNIHEL 181

Query: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCIS 239
            AILSWD++++SKP+Y+ LS+ +NG LRDG++ +++A + K +    N NL L G NC+S
Sbjct: 182 RAILSWDETILSKPFYIGLSVHNNGLLRDGSTMKDVADLIKSFGGKLNKNLTLLGINCVS 241

Query: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVR 299
           F  + + +  +H+ +P +PLI YPNSGE+YD + K W  ++   +TWE+++     +  R
Sbjct: 242 FSDSPDILESIHKELPDMPLIAYPNSGEVYDTVKKIWLPNRDMVMTWEEVVDRYIKAGAR 301

Query: 300 IVGGCCRTTPDDI 312
           IVGGCCRT+P DI
Sbjct: 302 IVGGCCRTSPKDI 314

>KAFR0F04420 Chr6 (867176..868156) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  331 bits (849), Expect = e-113,   Method: Compositional matrix adjust.
 Identities = 161/320 (50%), Positives = 218/320 (68%), Gaps = 3/320 (0%)

Query: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61
           RVPI+E +    D++LV DGG GT LE RGIN+SSP+WST+PF+ + FW S + ++DR I
Sbjct: 3   RVPIKEYLLRNSDKILVLDGGQGTELEKRGINISSPVWSTLPFINESFW-SNSSSNDRKI 61

Query: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121
           I+ +Y D+I++G+ +LST TYQTSFA IS +T ++T++ Y +L+  IT F R  IG+  Y
Sbjct: 62  IKDMYSDFISAGADVLSTTTYQTSFASISENTNIQTLKDYHELLNRITKFTRECIGDSKY 121

Query: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181
           L+GSIG + A L AEYTG++GD+   I+Y  YFKPQL+ FN + +IDIIGFET+PN +EL
Sbjct: 122 LVGSIGTYAAYLSAEYTGDFGDAADTIDYHGYFKPQLDNFNRSTEIDIIGFETIPNIHEL 181

Query: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCIS 239
            AILS +K  +SKP+Y+SLS      LRDGTS + +  + K + +  N NLIL G NCI 
Sbjct: 182 RAILSLNKKDLSKPFYISLSTNSKAQLRDGTSLKGVVDVIKSFESTLNPNLILLGINCIG 241

Query: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVR 299
              +   +  L+  +P  PLIVYPNSGE YDP+ K W  D+    TWE ++     +  R
Sbjct: 242 LNSSHLTMEYLNNHLPQFPLIVYPNSGEKYDPVRKIWLADEDPAFTWEYIVHRYLDAGAR 301

Query: 300 IVGGCCRTTPDDINKIKDMI 319
           IVGGCCRTTP DI  I + I
Sbjct: 302 IVGGCCRTTPSDIRSISEAI 321

>TDEL0E05690 Chr5 complement(1057559..1058545) [987 bp, 328 aa] {ON}
           
          Length = 328

 Score =  329 bits (844), Expect = e-112,   Method: Compositional matrix adjust.
 Identities = 155/323 (47%), Positives = 227/323 (70%), Gaps = 4/323 (1%)

Query: 1   MRVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRN 60
           +R+PI++L+  +  E+LV DGG GT LE+RGI V++P+WST+PFL + FW +++ + +R 
Sbjct: 2   VRIPIKKLVI-ESKEILVLDGGQGTELENRGIEVANPVWSTIPFLSESFW-TDSSSKERK 59

Query: 61  IIEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDN 120
           I+E ++ D+  SGS IL TITYQTSF  I  +T+ KT+  Y  L+  I  F RS IG++ 
Sbjct: 60  IVESVFDDFKKSGSNILMTITYQTSFTSIVENTQFKTLAEYNTLLDRIVKFSRSCIGDER 119

Query: 121 YLIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYE 180
           YLIGS+GP+GA +  E+TGNYG  P +I+Y EYFKPQL+ FN  D+ID+IGFETVPN +E
Sbjct: 120 YLIGSVGPWGAHVCCEFTGNYGLHPESIDYYEYFKPQLDNFNGQDEIDLIGFETVPNFHE 179

Query: 181 LEAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCI 238
           L+AILSWD++ I+KP+Y+ LS+ +NG LRDGT+ EEI    K      + N +L G NC+
Sbjct: 180 LKAILSWDETKIAKPFYIGLSVHNNGVLRDGTTMEEIGEYIKGLGEKISSNFLLLGVNCV 239

Query: 239 SFKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNV 298
           SF  +S+ +  +H+A+P +PL+ YPNSGE+YD   K W  ++    +W+ +++    +  
Sbjct: 240 SFNDSSDMVKSIHKALPDMPLLAYPNSGEVYDTEKKIWFDNKDKLDSWDSVVRSYIDNGA 299

Query: 299 RIVGGCCRTTPDDINKIKDMITK 321
           RI+GGCCRT+P DI ++   + K
Sbjct: 300 RIIGGCCRTSPRDIAEVSAAVKK 322

>KAFR0L00150 Chr12 complement(16662..17642) [981 bp, 326 aa] {ON} 
          Length = 326

 Score =  328 bits (841), Expect = e-111,   Method: Compositional matrix adjust.
 Identities = 151/324 (46%), Positives = 221/324 (68%), Gaps = 3/324 (0%)

Query: 1   MRVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRN 60
           +RVP+++ ++  P++VLVSDGG G  LE RG+++   LWST PFL   FW S+  ++D  
Sbjct: 2   VRVPLKKYLKENPEKVLVSDGGQGLELERRGLDIKHRLWSTRPFLSKSFW-SDPSSNDIR 60

Query: 61  IIEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDN 120
           I++G++ D++ +G+ IL T TYQTSF  +S  TE+K++  Y +L+  I  F R+ IG++ 
Sbjct: 61  IVKGMFEDFVNAGAEILMTTTYQTSFKAVSESTELKSLREYNELLDKIVGFTRACIGDNR 120

Query: 121 YLIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYE 180
           YLIGSIG +GA +G EY+G+YGDSP  +++  YFKPQL+ F NND+IDI+GFET+ N  E
Sbjct: 121 YLIGSIGSYGALVGGEYSGDYGDSPETVDFYSYFKPQLDNFLNNDEIDIVGFETIANFTE 180

Query: 181 LEAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCI 238
           L+++LSWD+  +SKP+Y+SLS+ DNG LRDGT    I    K  +   N NL   G NC+
Sbjct: 181 LKSLLSWDEKKVSKPFYISLSVHDNGNLRDGTPMHLITDYIKSLATAINPNLTFLGVNCV 240

Query: 239 SFKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNV 298
           ++  A+E I  +H  +PT+PL V+PNSGE+++     WT +     +WE ++K   +S V
Sbjct: 241 NYNKATEIIDSIHNGLPTMPLSVFPNSGEVFNVEKGIWTANPEAAASWEAVVKRFISSGV 300

Query: 299 RIVGGCCRTTPDDINKIKDMITKV 322
           RIVGGCCRT P DI +I   + K+
Sbjct: 301 RIVGGCCRTRPHDIEQISKAVKKL 324

>Smik_6.484 Chr6 (800680..801657) [978 bp, 325 aa] {ON} YPL273W
           (REAL)
          Length = 325

 Score =  318 bits (816), Expect = e-108,   Method: Compositional matrix adjust.
 Identities = 151/322 (46%), Positives = 227/322 (70%), Gaps = 3/322 (0%)

Query: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61
           R+P+++L+ + P +VLV DGG GT LE+RGI V++P+WST+PF+ + F  S+  +S R I
Sbjct: 3   RLPLKQLLADNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESF-WSDESSSSRKI 61

Query: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121
           ++ ++ D++ +G+ IL T TYQTS+  +S +T +KT+  Y  L+  I  F R  IGED Y
Sbjct: 62  VKEMFNDFLDAGAEILMTTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRGCIGEDKY 121

Query: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181
           LIG IGP+GA +  E+TG+YG +P +I++ +YFKPQL+ FN ND++D+IGFET+PN +EL
Sbjct: 122 LIGCIGPWGAHICREFTGDYGANPESIDFYQYFKPQLDNFNKNDNLDLIGFETIPNIHEL 181

Query: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCIS 239
           +AILSWD+SV+SKP+Y+ LS+ ++G LRDGT+ +E+A + K   +  N N  L G NC+S
Sbjct: 182 KAILSWDESVLSKPFYIGLSVHEHGVLRDGTTMQEVAKVIKDLGDKINPNFSLLGINCVS 241

Query: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVR 299
           F  + + +  LHQA+P + L+ YPNSGE+YD   K W  +     +W+ ++K   +S  R
Sbjct: 242 FNQSPDILESLHQALPDMALLAYPNSGEVYDTEKKIWLPNSDKLNSWDAVVKRYISSGAR 301

Query: 300 IVGGCCRTTPDDINKIKDMITK 321
           I+GGCCRT+P DI +I   + K
Sbjct: 302 IIGGCCRTSPKDIQEIFTAVKK 323

>ABL125W Chr2 (161358..162368) [1011 bp, 336 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 336

 Score =  314 bits (805), Expect = e-106,   Method: Compositional matrix adjust.
 Identities = 147/319 (46%), Positives = 208/319 (65%), Gaps = 3/319 (0%)

Query: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61
           R+PI + +   P  VLV DGG GT LE+RGI V+SP+WS  PFL    W  +  + +R I
Sbjct: 3   RIPIRQYLEEDPTRVLVMDGGQGTELENRGIVVASPVWSAAPFLDAAAW-QQPDSRERAI 61

Query: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121
           +  + RD++ +G+ ++ TITYQ SF  ++T+T + T++ Y  L+  I  FCR  +G+D Y
Sbjct: 62  VASVLRDFVAAGAEVIMTITYQASFTSVTTNTGITTLQDYNALLDRIVGFCRETVGDDKY 121

Query: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181
           L+GSIG +GA + AE+TG+YG  P +I+YL YFKPQL+ FN    +D+IGFET+PN +EL
Sbjct: 122 LVGSIGAWGAHVCAEFTGDYGPRPDHIDYLAYFKPQLDNFNAQPALDLIGFETIPNAHEL 181

Query: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN-NDNLILTGANCISF 240
            AILSWD+SVI+KP+YV+LS+ D G LRDGT   ++A I    +  N N +  G NC S 
Sbjct: 182 RAILSWDESVIAKPFYVALSVHDAGTLRDGTPMADVAAIVAAAAPLNPNFLGLGINCSSL 241

Query: 241 KYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVRI 300
                 +++LH  +P LP+ +YPNSGEIYDP+ K W       + W  ++     S  RI
Sbjct: 242 SRTPAILAELHALLPALPMTIYPNSGEIYDPVKKVWNASPHV-VDWGAVVASYIRSGARI 300

Query: 301 VGGCCRTTPDDINKIKDMI 319
           +GGCCRT P+DI +I D +
Sbjct: 301 IGGCCRTIPNDIRQIADAV 319

>TDEL0E00240 Chr5 complement(38804..39790) [987 bp, 328 aa] {ON} 
          Length = 328

 Score =  313 bits (802), Expect = e-105,   Method: Compositional matrix adjust.
 Identities = 146/322 (45%), Positives = 221/322 (68%), Gaps = 4/322 (1%)

Query: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61
           RVP+ +++ +   ++LV DGG GT +E+RGI V++P+WS++PF+ + FW  E  + +R I
Sbjct: 3   RVPLRKVLTDS-RKILVLDGGQGTEMENRGIEVANPVWSSIPFVSESFWTDEW-SKERKI 60

Query: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121
           +E IY+D+++SGS +L T+TYQ SF  I+ +TE++T+  Y  L+  I +F R  IG++ Y
Sbjct: 61  VEEIYKDFMSSGSDMLMTVTYQASFKAIAENTELQTLSEYNSLLDRIVAFSRRCIGDERY 120

Query: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181
           L+GS+GP+ A   +EYTG+YG    +I+Y  Y+KPQL+ FN  ++ID+IG ETVPN +EL
Sbjct: 121 LVGSVGPWAAYNASEYTGDYGLHADSIDYYGYYKPQLDNFNKQEEIDMIGIETVPNFHEL 180

Query: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCIS 239
           +AILSWD+  I+KP+YVSL+  D+G LRDGT+ E+IA   K   N  N N +L G NC+S
Sbjct: 181 KAILSWDEKKIAKPFYVSLTTHDSGVLRDGTAMEDIAQYIKCLGNNLNPNFMLLGINCVS 240

Query: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVR 299
           F  + + +  LH A+P + L+ YPNSGE+Y+P  K W  ++    +W+ ++K    S  R
Sbjct: 241 FNDSRDILELLHNALPEMLLLAYPNSGEVYEPKKKIWLANKCKTTSWDSVVKSFINSGAR 300

Query: 300 IVGGCCRTTPDDINKIKDMITK 321
           I+GGCCRT+P DI  +   + K
Sbjct: 301 IIGGCCRTSPQDIADVSIAVKK 322

>Suva_64.1 Chr64 (76..894) [819 bp, 273 aa] {ON} YPL273W (REAL)
          Length = 273

 Score =  301 bits (771), Expect = e-102,   Method: Compositional matrix adjust.
 Identities = 132/271 (48%), Positives = 202/271 (74%), Gaps = 3/271 (1%)

Query: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61
           R+P+++L+ + P +VLV DGG GT LE+RGI V++P+WST+PF+ + FW  E+ +++R I
Sbjct: 3   RIPLKQLLADDPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISESFWSDES-SANRKI 61

Query: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNY 121
           ++ ++ D++ +G+ IL TITYQTSF  +S +T +KT+  Y  L+  I  F R  IGE+ +
Sbjct: 62  VKEMFNDFLAAGAEILMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKH 121

Query: 122 LIGSIGPFGARLGAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYEL 181
           LIG IGP+GA +  E+TGNYG +P +I++ +YFKPQL+ FN ND +D++GFET+PN +EL
Sbjct: 122 LIGCIGPWGAHVCCEFTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHEL 181

Query: 182 EAILSWDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCIS 239
           +AILSWD+S++SKP+Y+ LS+ ++G LRDGT+ E +A + K   +  N N +L G NC+S
Sbjct: 182 KAILSWDESILSKPFYIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVS 241

Query: 240 FKYASENISKLHQAIPTLPLIVYPNSGEIYD 270
           F  + + +  LH+A+P +PL+ YPNSGE+YD
Sbjct: 242 FNQSPDILESLHRALPNMPLLAYPNSGEVYD 272

>Suva_16.32 Chr16 (40969..41748) [780 bp, 259 aa] {ON} YPL273W
           (REAL)
          Length = 259

 Score =  261 bits (668), Expect = 2e-86,   Method: Compositional matrix adjust.
 Identities = 118/247 (47%), Positives = 172/247 (69%), Gaps = 2/247 (0%)

Query: 77  LSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNYLIGSIGPFGARLGAE 136
           L TITYQTSF  +S +T +KT+  Y  L+  I  F R  IGE+ +LIG IGP+GA +  E
Sbjct: 11  LMTITYQTSFKSVSENTPIKTLAAYDNLLTRIVDFSRDCIGEEKHLIGCIGPWGAHVCCE 70

Query: 137 YTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYELEAILSWDKSVISKPY 196
           +TGNYG +P +I++ +YFKPQL+ FN ND +D++GFET+PN +EL+AILSWD+S++SKP+
Sbjct: 71  FTGNYGPNPESIDFYQYFKPQLDNFNKNDKLDLLGFETIPNIHELKAILSWDESILSKPF 130

Query: 197 YVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCISFKYASENISKLHQAI 254
           Y+ LS+ ++G LRDGT+ E +A + K   +  N N +L G NC+SF  + + +  LH+A+
Sbjct: 131 YIGLSVHEHGVLRDGTTMEGVAKVIKDLGDKINPNFLLLGINCVSFNQSPDILESLHRAL 190

Query: 255 PTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTWEDLIKELRTSNVRIVGGCCRTTPDDINK 314
           P +PL+ YPNSGE+YD   K W  +     +W+ ++K+   S  RI+GGCCRTTP DI +
Sbjct: 191 PNMPLLAYPNSGEVYDTEKKIWLPNSDKLNSWDTVVKQYIGSGARIIGGCCRTTPKDIQE 250

Query: 315 IKDMITK 321
           +   + K
Sbjct: 251 VSAAVKK 257

>SAKL0D09306g Chr4 (771565..772545) [981 bp, 326 aa] {ON} similar to
           uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 326

 Score =  250 bits (638), Expect = 5e-81,   Method: Compositional matrix adjust.
 Identities = 142/336 (42%), Positives = 203/336 (60%), Gaps = 27/336 (8%)

Query: 2   RVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNI 61
           R PI E + +    +LV DGG GT +E RGI+V  PLWST+PF+K +        +  N 
Sbjct: 3   RQPIAEYLES---SILVLDGGQGTEMERRGIDVIHPLWSTLPFIKKN-------PTHLNH 52

Query: 62  IEGIYRDYITSGSRILSTITYQTSFALISTHT--EVKTIEGYKQLIRNITSFCR-SAIGE 118
           I+G+Y D+ TSG+R LSTITYQ SFA +  ++  +V T + Y+Q + +I  F R   I +
Sbjct: 53  IKGMYHDFSTSGARALSTITYQASFATLKQYSDGQVVTEQQYQQFLNDIIGFTRDQCISD 112

Query: 119 DNYLIGSIGPFGARL--GAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVP 176
             YLIG +GP+ A L  GAEY+G+YG     I++ +YFKPQL+ F+ +D ID++GFET+P
Sbjct: 113 SQYLIGCVGPYAAYLCNGAEYSGDYGSE--KIDFKQYFKPQLDVFSRDDRIDMVGFETIP 170

Query: 177 NKYELEAILSWDKSVI--SKPYYVSLSLLDNGGLRDGTSFEEIATIFKKY--SNNDNLIL 232
           N  EL+ +LS D + +  +KP+Y+S+S   NG LRDGT   +I    K    S   NL+ 
Sbjct: 171 NIEELKTLLSKDFTSMLGTKPFYISISTDSNGNLRDGTPVAKICETIKDADKSTPPNLLF 230

Query: 233 TGANCISFKYASENISKLHQAI----PTLPLIVYPNSGEIYDPLTKKWTIDQTFG--LTW 286
            G NC+ + ++   +S+L+  +      L   VYPNSGEIYD  T  W  +      LTW
Sbjct: 231 LGINCVDYHHSYNILSRLNGGLGDDCSLLFKAVYPNSGEIYDGNTHTWHTNSEIAPELTW 290

Query: 287 EDLIKELRTSNVRIVGGCCRTTPDDINKIKDMITKV 322
             L+ +      +++GGCCRTTPDDI +I D + KV
Sbjct: 291 NYLVSKFAEQKCQLIGGCCRTTPDDIKQIADAVNKV 326

>Skud_101.1 Chr101 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  218 bits (554), Expect = 5e-70,   Method: Compositional matrix adjust.
 Identities = 100/194 (51%), Positives = 139/194 (71%), Gaps = 2/194 (1%)

Query: 79  TITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNYLIGSIGPFGARLGAEYT 138
           T TYQTS+  +S +T +KT+  Y  L+  I  F R  IGE+ YLIG IGP+GA +  E+T
Sbjct: 2   TTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRDCIGENKYLIGCIGPWGAHICREFT 61

Query: 139 GNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYELEAILSWDKSVISKPYYV 198
           G+YG  P +I++ EYFKPQL+ FN ND +D+IGFET+PN +EL AILSWD+S++SKP+Y+
Sbjct: 62  GDYGPDPESIDFYEYFKPQLDNFNKNDKLDLIGFETIPNVHELRAILSWDESILSKPFYI 121

Query: 199 SLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCISFKYASENISKLHQAIPT 256
            LS+ ++G LRDGT+ EE+A + K   +  N N  L G NC+SF  + + +  LHQA+P 
Sbjct: 122 GLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQALPD 181

Query: 257 LPLIVYPNSGEIYD 270
           + L+ YPNSGE+YD
Sbjct: 182 MALLAYPNSGEVYD 195

>Skud_100.1 Chr100 complement(3..602) [600 bp, 200 aa] {ON} YPL273W
           (REAL)
          Length = 200

 Score =  215 bits (547), Expect = 5e-69,   Method: Compositional matrix adjust.
 Identities = 98/194 (50%), Positives = 138/194 (71%), Gaps = 2/194 (1%)

Query: 79  TITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNYLIGSIGPFGARLGAEYT 138
           T TYQTS+  +S +T +KT+  Y  L+  I  F R  IGED YLIG IGP+GA +  E+T
Sbjct: 2   TTTYQTSYKSVSENTPIKTLSEYNNLLTRIVDFSRVCIGEDKYLIGCIGPWGAHICCEFT 61

Query: 139 GNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYELEAILSWDKSVISKPYYV 198
           G+YG  P +I++ +YFKPQL+ FN +D +D+IGFET+PN +EL AILSWD+S++SKP+Y+
Sbjct: 62  GDYGPDPQSIDFYKYFKPQLDNFNKSDKLDLIGFETIPNVHELRAILSWDESILSKPFYI 121

Query: 199 SLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLILTGANCISFKYASENISKLHQAIPT 256
            LS+ ++G LRDGT+ EE+A + K   +  N N  L G NC+SF  + + +  LHQ +P 
Sbjct: 122 GLSVHEHGVLRDGTTMEEVAKVIKGLGDKINPNFSLLGINCVSFNQSPDILESLHQVLPN 181

Query: 257 LPLIVYPNSGEIYD 270
           + L+ YPNSGE+YD
Sbjct: 182 MALLAYPNSGEVYD 195

>Kwal_0.322 s0 (152442..153440) [999 bp, 332 aa] {ON} YLL062C (MHT1)
           - S-methylmethionine:homocysteine S-methyltransferase
           [contig 86] FULL
          Length = 332

 Score =  212 bits (540), Expect = 4e-66,   Method: Compositional matrix adjust.
 Identities = 118/341 (34%), Positives = 202/341 (59%), Gaps = 30/341 (8%)

Query: 1   MRVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRN 60
           MR+ +EE +++   E+L+ DGG GT LE RGIN++ PLWST+P++  D            
Sbjct: 1   MRLQLEEYLKH---EILLLDGGQGTELEKRGINIAHPLWSTLPYVTKD-------KKHLK 50

Query: 61  IIEGIYRDYITSGSRILSTITYQTSFALISTHTE--VKTIEGYKQLIRNITSFCRS-AIG 117
           II+ +Y  + ++G   L TITYQ SF  +  H++  +   + Y + +  +  +  +  I 
Sbjct: 51  IIKEMYSAFESAGCNALMTITYQASFLSMKNHSDGLINNEKEYTRFLDYVIDYTENQCIS 110

Query: 118 EDNYLIGSIGPFGARL--GAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETV 175
            ++YL+GS+GP+ A L  GAEY+G+Y +   NI+++E+F+PQ++ F  +  ID+IG ET+
Sbjct: 111 PNSYLVGSVGPYAAYLSNGAEYSGHYIE--DNIDFIEFFRPQVQHFAVSSRIDLIGIETI 168

Query: 176 PNKYELEAILSWDKSVIS--KPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSNN--DNLI 231
           PN  E +A+L  + S +   KPYY+S++  + G LRDGT+ ++I    K+ + +   NL+
Sbjct: 169 PNFEEFKALLRPEFSRLCALKPYYISITTDNEGNLRDGTARQDICETIKRSAQDLPPNLV 228

Query: 232 LTGANCISFKYASENISKLHQAIPTLPL-------IVYPNSGEIYDPLTKKWTIDQTFGL 284
             G NC+SF + ++ +  L+ ++  + +        VYPNSGE+Y   T  W  +   G 
Sbjct: 229 FFGINCVSFAHCADILKLLNDSLDDIGVENRLRFRAVYPNSGEVYHGDTHSWGPNPEIGP 288

Query: 285 --TWEDLIKELRTSNVRIVGGCCRTTPDDINKIKDMITKVK 323
             TWE+L  ++      ++GGCCRT+P D+ +I  +++ +K
Sbjct: 289 ADTWENLASKVVQQGCLMIGGCCRTSPADLRQIASVVSDIK 329

>KLTH0H12716g Chr8 (1079836..1080882) [1047 bp, 348 aa] {ON} similar
           to uniprot|Q12525 Saccharomyces cerevisiae YLL062C MHT1
           S-methylmethionine-homocysteine methyltransferase
          Length = 348

 Score =  208 bits (530), Expect = 2e-64,   Method: Compositional matrix adjust.
 Identities = 125/333 (37%), Positives = 190/333 (57%), Gaps = 30/333 (9%)

Query: 1   MRVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRN 60
           MR P++E  +N    +L+ DGG GT LE +G+++S PLWST+PF+  +      KT    
Sbjct: 1   MRKPLKEFFKNN---ILLLDGGQGTELEKKGVSISHPLWSTLPFIIKN------KTHLEA 51

Query: 61  IIEGIYRDYITSGSRILSTITYQTSFALISTHTE--VKTIEGYKQLIRNITSFC-RSAIG 117
           I E +YRD+  +GS  L TITYQ SF+ +  ++E  V + E Y   +  +  F  R  I 
Sbjct: 52  IKE-MYRDFAEAGSNALMTITYQASFSSMKKYSEGLVNSEEDYAAFLDYVIGFTDRECIT 110

Query: 118 EDNYLIGSIGPFGARL--GAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETV 175
            D YL+GS+GP+   L  GAEY+G YG+    I++++Y+ PQ++ F  +  ID+IG ET+
Sbjct: 111 PDKYLVGSVGPYAGLLSNGAEYSGYYGE--GKIDFIDYYSPQVKHFALSPRIDLIGIETI 168

Query: 176 PNKYELEAILS--WDKSVISKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSN--NDNLI 231
           PN  E +A+LS  + +   SKPYY+S++  +NG LRDGTS  EI    K+ ++   DN +
Sbjct: 169 PNIDEFKALLSPEFSRLSFSKPYYISVTTDNNGCLRDGTSLNEICRAIKQSASLLPDNFV 228

Query: 232 LTGANCISFKYASENISKLHQAIPTLPLI-------VYPNSGEIYDPLTKKWTIDQTFGL 284
               NC+ F +  E +  L+  +    +         YPNSGEIY   T  W+ +   G 
Sbjct: 229 FFAINCVEFLHCVEILQSLNDCLEMQGVDRRFRFRGAYPNSGEIYHGGTHSWSSNPYAGP 288

Query: 285 --TWEDLIKELRTSNVRIVGGCCRTTPDDINKI 315
             TWE+L   L +    ++GGCCRT  ++I ++
Sbjct: 289 EDTWENLTLGLLSQECLMLGGCCRTGSEEIRQM 321

>AFR410W Chr6 (1171334..1172446) [1113 bp, 370 aa] {ON} Non-syntenic
           homolog of Saccharomyces cerevisiae YPL273W (SAM4)
          Length = 370

 Score =  204 bits (520), Expect = 9e-63,   Method: Compositional matrix adjust.
 Identities = 113/317 (35%), Positives = 180/317 (56%), Gaps = 22/317 (6%)

Query: 16  VLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRNIIEGIYRDYITSGSR 75
           VLV DGG+G  LE RG++V SPLWST PFL+ D        +  + I G+YR++  +GSR
Sbjct: 59  VLVMDGGMGVELERRGMDVKSPLWSTAPFLRGD-------RAALDTIRGLYREFRAAGSR 111

Query: 76  ILSTITYQTSF-ALISTHTEVKTIEGYKQLIRNITSFC-RSAIG-EDNYLIGSIGPFGAR 132
            +ST+TYQ SF +++     V +   Y++ +  +  F  R  +    +Y+IGS+GP+ A 
Sbjct: 112 GISTLTYQASFHSMVKYSGSVSSRADYEKFLEQVVDFTYRECVDPARDYIIGSVGPYAAF 171

Query: 133 L--GAEYTGNYGDSPSNINYLEYFKPQLEEFNNNDDIDIIGFETVPNKYELEAILSWDKS 190
           L  GAEYTG+YG     IN+  YF+PQ+ +F  +  ID I FETVPN  EL A+L  +  
Sbjct: 172 LCNGAEYTGDYGF--ETINFFNYFEPQVSKFATDPRIDAIAFETVPNVVELMAMLQPEFH 229

Query: 191 VI--SKPYYVSLSLLDNGGLRDGTSFEEIATIFKKYSNN--DNLILTGANCISFKYASEN 246
            +  +KP+Y+S+S  D   LRDGT    +  + ++  ++   NL+  G NC+    ++  
Sbjct: 230 ALLKNKPFYISISAKDEHVLRDGTPLAVVGQLIRERMDDLPPNLLCFGLNCVDLTRSAAM 289

Query: 247 ISKLHQAIPTLPL---IVYPNSGEIYDPLTKKWTIDQ-TFGLTWEDLIKELRTSNVRIVG 302
           +++L+  +   P+    +YPN   ++D     W   +    LTW + +K     + R++G
Sbjct: 290 LAELNMQLQDCPIKFQAIYPNGTSVFDESLSAWRPSKDAESLTWAEAVKLYLNQDCRMIG 349

Query: 303 GCCRTTPDDINKIKDMI 319
           GCC TTP D+ +I + +
Sbjct: 350 GCCGTTPQDMRQIAEAL 366

>Skud_47.2 Chr47 (1368..1655) [288 bp, 96 aa] {ON} YPL273W (REAL)
          Length = 96

 Score =  105 bits (261), Expect = 1e-27,   Method: Compositional matrix adjust.
 Identities = 44/96 (45%), Positives = 74/96 (77%), Gaps = 1/96 (1%)

Query: 1  MRVPIEELIRNQPDEVLVSDGGLGTLLESRGINVSSPLWSTVPFLKDDFWDSETKTSDRN 60
          +R+P+++L+ + P +VLV DGG GT LE+RGI V++P+WST+PF+ D FW  E+ +++R 
Sbjct: 2  VRLPLKQLLEDNPKKVLVLDGGQGTELENRGIKVANPVWSTIPFISDSFWSDES-SANRK 60

Query: 61 IIEGIYRDYITSGSRILSTITYQTSFALISTHTEVK 96
          I++G++ D++ +G+ IL T TYQTS+  +S +T +K
Sbjct: 61 IVKGMFNDFLNAGAEILMTTTYQTSYKSVSENTPIK 96

>YMR321C Chr13 complement(917579..917896) [318 bp, 105 aa] {ON}
           Putative protein of unknown function; proposed to be a
           palmitoylated membrane protein
          Length = 105

 Score = 92.4 bits (228), Expect = 1e-22,   Method: Compositional matrix adjust.
 Identities = 40/95 (42%), Positives = 59/95 (62%)

Query: 227 NDNLILTGANCISFKYASENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQTFGLTW 286
           N NL   G NC+SF  + + +  LHQA+P + L+ YPNSGE+YD   K W  +     +W
Sbjct: 9   NPNLSFLGINCVSFNQSPDILESLHQALPNMALLAYPNSGEVYDTEKKIWLPNSDKLNSW 68

Query: 287 EDLIKELRTSNVRIVGGCCRTTPDDINKIKDMITK 321
           + ++K+  +S  RI+GGCCRT+P DI +I   + K
Sbjct: 69  DTVVKQYISSGARIIGGCCRTSPKDIQEISAAVKK 103

>SAKL0G16126g Chr7 complement(1394366..1395052) [687 bp, 228 aa]
           {ON} highly similar to uniprot|Q6HD38 Bacillus
           thuringiensis subsp BT9727_4222 ThiJ/PfpI family protein
          Length = 228

 Score = 32.7 bits (73), Expect = 0.78,   Method: Compositional matrix adjust.
 Identities = 22/80 (27%), Positives = 33/80 (41%), Gaps = 1/80 (1%)

Query: 198 VSLSLLDNGGLRDGTSFEEIATIFKKYSNNDNLILTGANCISFKYASENISKLHQAIPTL 257
           +S ++ ++GG+        I  +  K SN +NLI  G     F  A E I +L   +P L
Sbjct: 118 ISRAIYEDGGIISSVCHGAIGLLNIKLSNGENLI-KGKKVTGFSNAEEQIVELDSVVPYL 176

Query: 258 PLIVYPNSGEIYDPLTKKWT 277
                   G  Y+   K W 
Sbjct: 177 TEDELSKRGAKYEKAAKPWV 196

>Skud_15.471 Chr15 (824424..827792) [3369 bp, 1122 aa] {ON} YOR304W
            (REAL)
          Length = 1122

 Score = 31.2 bits (69), Expect = 4.2,   Method: Compositional matrix adjust.
 Identities = 16/37 (43%), Positives = 20/37 (54%)

Query: 244  SENISKLHQAIPTLPLIVYPNSGEIYDPLTKKWTIDQ 280
            S+N S     +P LPL + PN  EI D   K+  IDQ
Sbjct: 1084 SQNESTRASTVPNLPLGIVPNQKEINDHTDKRPKIDQ 1120

>Suva_16.517 Chr16 (889644..891827) [2184 bp, 727 aa] {ON} YPR185W
           (REAL)
          Length = 727

 Score = 31.2 bits (69), Expect = 4.3,   Method: Compositional matrix adjust.
 Identities = 15/50 (30%), Positives = 28/50 (56%)

Query: 73  GSRILSTITYQTSFALISTHTEVKTIEGYKQLIRNITSFCRSAIGEDNYL 122
           G+ + ST  Y +SF  I  H+ VKT E  ++L++ + S  +    +D+ +
Sbjct: 419 GTSVGSTSKYSSSFGNIRRHSSVKTTENTEKLLKAVRSPLQLQESQDDLM 468

>Kwal_56.22747 s56 (262824..267440) [4617 bp, 1538 aa] {ON} YLL015W
           (BPT1) - ABC-type transmembrane transporter; highly
           homologous to human MRP1 and to C. elegans mrp-1 [contig
           184] FULL
          Length = 1538

 Score = 31.2 bits (69), Expect = 4.8,   Method: Compositional matrix adjust.
 Identities = 22/54 (40%), Positives = 27/54 (50%), Gaps = 3/54 (5%)

Query: 221 FKKYSNNDNLILTGANCISFKYASEN--ISKLHQAIPTLPLIVYPNSGEIYDPL 272
           FKK S   NLIL   NC+    AS    I  L   +P  P IV+P S  ++D L
Sbjct: 505 FKKISIITNLILFAWNCVPILVASSTFLIYALTMDVPLTPQIVFP-SLSLFDIL 557

>NDAI0G00160 Chr7 (21194..22069) [876 bp, 291 aa] {ON} Anc_1.404
          Length = 291

 Score = 30.4 bits (67), Expect = 5.3,   Method: Compositional matrix adjust.
 Identities = 19/72 (26%), Positives = 36/72 (50%), Gaps = 4/72 (5%)

Query: 1   MRVPIEELIRNQPDEVLVSDGGL----GTLLESRGINVSSPLWSTVPFLKDDFWDSETKT 56
           ++ P+ E ++ +  E   SDG L    G +  S    V++   + + FLK     ++T  
Sbjct: 175 IQFPLYEFLKKKWKEADASDGPLNPVKGAISGSIAGGVAAATTTPLDFLKTRLMLNKTSI 234

Query: 57  SDRNIIEGIYRD 68
             R++++ IYRD
Sbjct: 235 PVRHLVQNIYRD 246

>KAFR0H00640 Chr8 (119409..121160) [1752 bp, 583 aa] {ON} Anc_5.609
           YDR475C
          Length = 583

 Score = 30.0 bits (66), Expect = 8.5,   Method: Compositional matrix adjust.
 Identities = 29/121 (23%), Positives = 51/121 (42%), Gaps = 14/121 (11%)

Query: 47  DDFWDSETKTSDRN-IIEGIY----RDYITSGSRILSTITYQTSFALISTHTEVKTIEGY 101
           D+F+D+ET+T +   ++   Y     DY+  G         + ++ L+ THT  K++E  
Sbjct: 97  DEFYDNETETENSQFLLNNRYLLNDMDYVRHGRSHSPPPARRNNYGLLGTHTNNKSLELT 156

Query: 102 K--------QLIRNITSFCRSAIGEDNYLIGSIGPFGARLGAEYTGNYGDSPSNINYLEY 153
           K        +++R      RS +  D+ +I    P   +L  E   +  D   N     Y
Sbjct: 157 KMFKIAENGRIVREDYP-SRSTLKNDSLVITKFSPDRKKLWNERQLHLEDKLQNKERSFY 215

Query: 154 F 154
           F
Sbjct: 216 F 216

  Database: Seq/AA.fsa
    Posted date:  Aug 24, 2012  3:22 PM
  Number of letters in database: 53,481,399
  Number of sequences in database:  114,666
  
Lambda     K      H
   0.316    0.137    0.403 

Gapped
Lambda     K      H
   0.267   0.0410    0.140 

Matrix: BLOSUM62
Gap Penalties: Existence: 11, Extension: 1
Number of Sequences: 114666
Number of Hits to DB: 39,178,474
Number of extensions: 1892494
Number of successful extensions: 5542
Number of sequences better than 10.0: 59
Number of HSP's gapped: 5637
Number of HSP's successfully gapped: 59
Length of query: 323
Length of database: 53,481,399
Length adjustment: 110
Effective length of query: 213
Effective length of database: 40,868,139
Effective search space: 8704913607
Effective search space used: 8704913607
Neighboring words threshold: 11
Window for multiple hits: 40
X1: 16 ( 7.3 bits)
X2: 38 (14.6 bits)
X3: 64 (24.7 bits)
S1: 41 (21.6 bits)
S2: 66 (30.0 bits)